F305502

General Info

Members Datasets Scaffolds Average Seq Length
199 138 398 235

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10295430|Ga0070681_102954302
Length 266
Sequence MGGLGLSARGGASQAGQRDVTFLRAATRYFCEGIMATTALLQQAKAECWSDEEVVARVLGGETALFEIIMRRYNQRLYRVARSILRNDAEAEDVMQDAYVRAYQHLSQFAGRAKFSTWLTRIAVHEALARAQRRSRVQELDAEPYGGNMDPLAAKTPDPEQQASDHELLALLQSAVLELPPSYRSVLLLRDIEEMSTADTAEALELSEENVKVRLHRARALLRRELFSRAGMQRRNAFPFMGARCDRMVAAVMRRLAELQAGTTTP

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 23.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10295430 3300005458 Unclassified 1530
2 Ga0068869_100001259 3300005334 Bacteria 14960
3 Ga0070680_100030236 3300005336 Bacteria 4351
4 Ga0070680_100298394 3300005336 Bacteria 1366
5 Ga0070680_100305571 3300005336 Unclassified 1349
6 Ga0068868_100165682 3300005338 Bacteria 1828
7 Ga0070687_100299827 3300005343 Bacteria 1019
8 Ga0070669_100069333 3300005353 Bacteria 2604
9 Ga0070675_100378202 3300005354 Bacteria 1260
10 Ga0070675_100537138 3300005354 Bacteria 1056
11 Ga0070674_100013494 3300005356 Bacteria 5053
12 Ga0070674_100017575 3300005356 Bacteria 4504
13 Ga0070673_100224811 3300005364 Bacteria 1626
14 Ga0070714_100446941 3300005435 Bacteria 1227
15 Ga0070713_100000836 3300005436 Bacteria 19666
16 Ga0070713_100034813 3300005436 Bacteria 4050
17 Ga0070713_100201147 3300005436 Unclassified 1799
18 Ga0070713_100634332 3300005436 Bacteria 1017
19 Ga0070710_10118225 3300005437 Bacteria 1601
20 Ga0070711_100001242 3300005439 Bacteria 13786
21 Ga0070711_100261347 3300005439 Bacteria 1362
22 Ga0070694_100146800 3300005444 Bacteria 1719
23 Ga0070663_100189439 3300005455 Bacteria 1600
24 Ga0070681_10023725 3300005458 Bacteria 6173
25 Ga0070681_10238721 3300005458 Unclassified 1731
26 Ga0068867_100731062 3300005459 Bacteria 876
27 Ga0070699_100132613 3300005518 Bacteria 2197
28 Ga0070679_100066183 3300005530 Bacteria 3602
29 Ga0070679_100635656 3300005530 Unclassified 1010
30 Ga0070679_100798545 3300005530 Bacteria 887
31 Ga0070697_100015831 3300005536 Bacteria 5925
32 Ga0070696_100096199 3300005546 Bacteria 2116
33 Ga0070693_100136519 3300005547 Bacteria 1539
34 Ga0070704_100044756 3300005549 Bacteria 3078
35 Ga0070664_100885899 3300005564 Bacteria 836
36 Ga0068857_100279550 3300005577 Unclassified 1535
37 Ga0068856_100166574 3300005614 Unclassified 2215
38 Ga0068852_100637650 3300005616 Unclassified 1072
39 Ga0068859_100014947 3300005617 Bacteria 7790
40 Ga0068866_10041501 3300005718 Unclassified 2283
41 Ga0068863_100040894 3300005841 Bacteria 4407
42 Ga0068858_100008998 3300005842 Bacteria 9550
43 Ga0068858_100122309 3300005842 Bacteria 2435
44 Ga0068862_100068035 3300005844 Bacteria 3071
45 Ga0068862_100112627 3300005844 Bacteria 2390
46 Ga0068862_100140495 3300005844 Bacteria 2143
47 Ga0070717_10232433 3300006028 Unclassified 1624
48 Ga0070717_10258623 3300006028 Bacteria 1540
49 Ga0070716_100027600 3300006173 Bacteria 3052
50 Ga0070716_100588493 3300006173 Unclassified 835
51 Ga0070712_100000605 3300006175 Bacteria 21027
52 Ga0097621_100170596 3300006237 Bacteria 1875
53 Ga0075428_100010363 3300006844 Bacteria 10346
54 Ga0075428_100522538 3300006844 Bacteria 1269
55 Ga0075428_100633661 3300006844 Bacteria 1141
56 Ga0075430_100005723 3300006846 Bacteria 10485
57 Ga0075431_100067359 3300006847 Bacteria 3696
58 Ga0075431_100109832 3300006847 Bacteria 2847
59 Ga0075431_100313173 3300006847 Bacteria 1584
60 Ga0075433_10098182 3300006852 Bacteria 2593
61 Ga0075433_10577571 3300006852 Bacteria 987
62 Ga0068865_100009293 3300006881 Bacteria 6090
63 Ga0068865_100129813 3300006881 Unclassified 1887
64 Ga0075436_100017239 3300006914 Bacteria 4943
65 Ga0075436_100032539 3300006914 Unclassified 3595
66 Ga0075436_100035074 3300006914 Bacteria 3460
67 Ga0097620_100014947 3300006931 Bacteria 7790
68 Ga0075435_100034044 3300007076 Bacteria 4033
69 Ga0105240_10001008 3300009093 Bacteria 50213
70 Ga0105240_10017403 3300009093 Bacteria 9687
71 Ga0105240_10027683 3300009093 Bacteria 7418
72 Ga0105245_10263575 3300009098 Bacteria 1678
73 Ga0114129_10292720 3300009147 Bacteria 2172
74 Ga0114129_10859577 3300009147 Unclassified 1152
75 Ga0114129_11133330 3300009147 Bacteria 978
76 Ga0105241_10333455 3300009174 Bacteria 1312
77 Ga0105248_10039617 3300009177 Bacteria 5280
78 Ga0105248_10254052 3300009177 Bacteria 1978
79 Ga0105237_10018033 3300009545 Bacteria 7312
80 Ga0105237_10027866 3300009545 Bacteria 5756
81 Ga0105237_10061259 3300009545 Bacteria 3763
82 Ga0105238_10194737 3300009551 Bacteria 2003
83 Ga0105249_10256258 3300009553 Bacteria 1736
84 Ga0105239_10025343 3300010375 Bacteria 6529
85 Ga0157373_10046945 3300013100 Bacteria 3081
86 Ga0157371_10741483 3300013102 Bacteria 737
87 Ga0157369_10052025 3300013105 Unclassified 4432
88 Ga0157374_10034992 3300013296 Bacteria 4593
89 Ga0157378_10092515 3300013297 Bacteria 2751
90 Ga0163162_10004938 3300013306 Bacteria 12855
91 Ga0157372_10618642 3300013307 Bacteria 1262
92 Ga0157372_10943006 3300013307 Unclassified 1000
93 Ga0163163_10008746 3300014325 Bacteria 9010
94 Ga0157380_10042322 3300014326 Bacteria 3560
95 Ga0157379_10028211 3300014968 Bacteria 4997
96 Ga0157376_10268228 3300014969 Bacteria 1602
97 Ga0157376_10616734 3300014969 Bacteria 1081
98 Ga0207682_10008207 3300025893 Unclassified 4140
99 Ga0207680_10082230 3300025903 Bacteria 2026
100 Ga0207647_10004664 3300025904 Bacteria 10154
101 Ga0207699_10146038 3300025906 Bacteria 1559
102 Ga0207654_10040786 3300025911 Bacteria 2617
103 Ga0207654_10277210 3300025911 Unclassified 1133
104 Ga0207707_10107814 3300025912 Bacteria 2435
105 Ga0207707_10379621 3300025912 Bacteria 1215
106 Ga0207695_10005854 3300025913 Bacteria 16137
107 Ga0207695_10009488 3300025913 Bacteria 12035
108 Ga0207695_10144524 3300025913 Bacteria 2324
109 Ga0207671_10084645 3300025914 Unclassified 2382
110 Ga0207693_10175058 3300025915 Unclassified 1689
111 Ga0207663_10005218 3300025916 Bacteria 6538
112 Ga0207660_10028123 3300025917 Bacteria 3844
113 Ga0207660_10046016 3300025917 Bacteria 3077
114 Ga0207662_10282543 3300025918 Bacteria 1098
115 Ga0207652_10027080 3300025921 Bacteria 4777
116 Ga0207652_10442005 3300025921 Bacteria 1172
117 Ga0207646_10075482 3300025922 Bacteria 3012
118 Ga0207659_10227119 3300025926 Bacteria 1504
119 Ga0207700_10005247 3300025928 Bacteria 7726
120 Ga0207700_10011507 3300025928 Bacteria 5646
121 Ga0207700_10424803 3300025928 Unclassified 1168
122 Ga0207664_10162060 3300025929 Bacteria 1908
123 Ga0207664_10181421 3300025929 Bacteria 1807
124 Ga0207669_10017289 3300025937 Bacteria 3694
125 Ga0207669_10020919 3300025937 Bacteria 3441
126 Ga0207665_10292989 3300025939 Unclassified 1214
127 Ga0207711_10076108 3300025941 Bacteria 2922
128 Ga0207689_10003226 3300025942 Bacteria 14941
129 Ga0207667_10476319 3300025949 Unclassified 1267
130 Ga0207651_10146538 3300025960 Bacteria 1832
131 Ga0207651_10229979 3300025960 Unclassified 1505
132 Ga0207712_10510150 3300025961 Bacteria 1029
133 Ga0207703_10014931 3300026035 Bacteria 6060
134 Ga0207639_10155136 3300026041 Bacteria 1922
135 Ga0207678_10020152 3300026067 Bacteria 5856
136 Ga0207708_10071722 3300026075 Bacteria 2654
137 Ga0207702_10190495 3300026078 Bacteria 1894
138 Ga0207648_10612509 3300026089 Bacteria 1004
139 Ga0207674_10467271 3300026116 Unclassified 1219
140 Ga0207674_10853000 3300026116 Unclassified 878
141 Ga0207675_100112974 3300026118 Bacteria 2564
142 Ga0207675_100517511 3300026118 Bacteria 1189
143 Ga0209966_1030254 3300027695 Bacteria 1094
144 Ga0207428_10024948 3300027907 Bacteria 5013
145 Ga0207428_10135997 3300027907 Unclassified 1879
146 Ga0268265_10097735 3300028380 Bacteria 2363
147 Ga0268265_10121361 3300028380 Bacteria 2154
148 Ga0268265_10141890 3300028380 Bacteria 2012
149 Ga0268265_10708260 3300028380 Bacteria 973
150 Ga0268264_10937821 3300028381 Bacteria 870
151 Ga0373931_0094530 3300035691 Bacteria 1671
152 Ga0373937_0211910 3300036401 Unclassified 1823
153 Ga0436365_0015277 3300039437 Unclassified 2265
154 Ga0436363_1267543 3300039450 Unclassified 2338
155 Ga0436362_1139557 3300039453 Unclassified 4727
156 Ga0466963_0346155 3300044694 Bacteria 1047
157 Ga0466963_0427547 3300044694 Unclassified 934
158 Ga0466959_0321779 3300045049 Bacteria 1057
159 Ga0466958_0127116 3300045836 Bacteria 1599
160 Ga0466967_0134103 3300045976 Bacteria 2302
161 Ga0495652_0369983 3300046529 Unclassified 1022
162 Ga0495665_0131355 3300046531 Unclassified 1311
163 Ga0495587_0161846 3300046536 Bacteria 1273
164 Ga0495587_0207691 3300046536 Bacteria 1106
165 Ga0495645_0115400 3300046543 Bacteria 1897
166 Ga0495667_0263468 3300046559 Unclassified 1096
167 Ga0495635_0047321 3300046663 Bacteria 2967
168 Ga0495646_0204617 3300046680 Bacteria 1074
169 Ga0495647_0095457 3300046681 Unclassified 1225
170 Ga0495658_0091835 3300046683 Unclassified 1799
171 Ga0495669_0013568 3300046684 Bacteria 3474
172 Ga0495669_0021788 3300046684 Bacteria 2784
173 Ga0495581_0036621 3300047315 Bacteria 2839
174 Ga0495604_0208780 3300047317 Bacteria 1350
175 Ga0495636_0116319 3300047318 Unclassified 1180
176 Ga0495674_0216026 3300047319 Unclassified 1587
177 Ga0495675_0001864 3300047444 Bacteria 12553
178 Ga0495675_0153252 3300047444 Bacteria 1423
179 Ga0495602_0073160 3300048088 Bacteria 2919
180 Ga0496102_0339387 3300048905 Unclassified 1415
181 Ga0496112_0005621 3300048915 Bacteria 10877
182 Ga0501040_0098201 3300049576 Bacteria 2041
183 nmdc:mga05p37_444249_c1 3300050507 Bacteria 1503
184 nmdc:mga05p37_989970_c1 3300050507 Bacteria 895
185 nmdc:mga0qj67_11429_c1 3300050509 Bacteria 6653
186 nmdc:mga06r32_184104_c1 3300050510 Bacteria 2075
187 nmdc:mga06r32_255957_c1 3300050510 Unclassified 1738
188 nmdc:mga08y16_14139_c1 3300050511 Bacteria 8400
189 nmdc:mga08y16_50557_c1 3300050511 Unclassified 4350
190 nmdc:mga0rr50_25598_c1 3300050513 Bacteria 4104
191 nmdc:mga08x19_1674_c1 3300050514 Bacteria 13639
192 nmdc:mga08x19_53548_c1 3300050514 Unclassified 2596
193 nmdc:mga0a205_569508_c1 3300050515 Bacteria 987
194 Ga0495601_0014183 3300053077 Unclassified 4802
195 Ga0495601_0201616 3300053077 Unclassified 1300
196 Ga0495619_0078267 3300053085 Unclassified 2223
197 Ga0495619_0209413 3300053085 Bacteria 1350
198 Ga0587060_009532 3300060243 Bacteria 815
199 Ga0466962_0076285 3300061719 Bacteria 1602
200 Ga0070681_10295430
201 Ga0068869_100001259
202 Ga0070680_100030236
203 Ga0070680_100298394
204 Ga0070680_100305571
205 Ga0068868_100165682
206 Ga0070687_100299827
207 Ga0070669_100069333
208 Ga0070675_100378202
209 Ga0070675_100537138
210 Ga0070674_100013494
211 Ga0070674_100017575
212 Ga0070673_100224811
213 Ga0070714_100446941
214 Ga0070713_100000836
215 Ga0070713_100034813
216 Ga0070713_100201147
217 Ga0070713_100634332
218 Ga0070710_10118225
219 Ga0070711_100001242
220 Ga0070711_100261347
221 Ga0070694_100146800
222 Ga0070663_100189439
223 Ga0070681_10023725
224 Ga0070681_10238721
225 Ga0068867_100731062
226 Ga0070699_100132613
227 Ga0070679_100066183
228 Ga0070679_100635656
229 Ga0070679_100798545
230 Ga0070697_100015831
231 Ga0070696_100096199
232 Ga0070693_100136519
233 Ga0070704_100044756
234 Ga0070664_100885899
235 Ga0068857_100279550
236 Ga0068856_100166574
237 Ga0068852_100637650
238 Ga0068859_100014947
239 Ga0068866_10041501
240 Ga0068863_100040894
241 Ga0068858_100008998
242 Ga0068858_100122309
243 Ga0068862_100068035
244 Ga0068862_100112627
245 Ga0068862_100140495
246 Ga0070717_10232433
247 Ga0070717_10258623
248 Ga0070716_100027600
249 Ga0070716_100588493
250 Ga0070712_100000605
251 Ga0097621_100170596
252 Ga0075428_100010363
253 Ga0075428_100522538
254 Ga0075428_100633661
255 Ga0075430_100005723
256 Ga0075431_100067359
257 Ga0075431_100109832
258 Ga0075431_100313173
259 Ga0075433_10098182
260 Ga0075433_10577571
261 Ga0068865_100009293
262 Ga0068865_100129813
263 Ga0075436_100017239
264 Ga0075436_100032539
265 Ga0075436_100035074
266 Ga0097620_100014947
267 Ga0075435_100034044
268 Ga0105240_10001008
269 Ga0105240_10017403
270 Ga0105240_10027683
271 Ga0105245_10263575
272 Ga0114129_10292720
273 Ga0114129_10859577
274 Ga0114129_11133330
275 Ga0105241_10333455
276 Ga0105248_10039617
277 Ga0105248_10254052
278 Ga0105237_10018033
279 Ga0105237_10027866
280 Ga0105237_10061259
281 Ga0105238_10194737
282 Ga0105249_10256258
283 Ga0105239_10025343
284 Ga0157373_10046945
285 Ga0157371_10741483
286 Ga0157369_10052025
287 Ga0157374_10034992
288 Ga0157378_10092515
289 Ga0163162_10004938
290 Ga0157372_10618642
291 Ga0157372_10943006
292 Ga0163163_10008746
293 Ga0157380_10042322
294 Ga0157379_10028211
295 Ga0157376_10268228
296 Ga0157376_10616734
297 Ga0207682_10008207
298 Ga0207680_10082230
299 Ga0207647_10004664
300 Ga0207699_10146038
301 Ga0207654_10040786
302 Ga0207654_10277210
303 Ga0207707_10107814
304 Ga0207707_10379621
305 Ga0207695_10005854
306 Ga0207695_10009488
307 Ga0207695_10144524
308 Ga0207671_10084645
309 Ga0207693_10175058
310 Ga0207663_10005218
311 Ga0207660_10028123
312 Ga0207660_10046016
313 Ga0207662_10282543
314 Ga0207652_10027080
315 Ga0207652_10442005
316 Ga0207646_10075482
317 Ga0207659_10227119
318 Ga0207700_10005247
319 Ga0207700_10011507
320 Ga0207700_10424803
321 Ga0207664_10162060
322 Ga0207664_10181421
323 Ga0207669_10017289
324 Ga0207669_10020919
325 Ga0207665_10292989
326 Ga0207711_10076108
327 Ga0207689_10003226
328 Ga0207667_10476319
329 Ga0207651_10146538
330 Ga0207651_10229979
331 Ga0207712_10510150
332 Ga0207703_10014931
333 Ga0207639_10155136
334 Ga0207678_10020152
335 Ga0207708_10071722
336 Ga0207702_10190495
337 Ga0207648_10612509
338 Ga0207674_10467271
339 Ga0207674_10853000
340 Ga0207675_100112974
341 Ga0207675_100517511
342 Ga0209966_1030254
343 Ga0207428_10024948
344 Ga0207428_10135997
345 Ga0268265_10097735
346 Ga0268265_10121361
347 Ga0268265_10141890
348 Ga0268265_10708260
349 Ga0268264_10937821
350 Ga0373931_0094530
351 Ga0373937_0211910
352 Ga0436365_0015277
353 Ga0436363_1267543
354 Ga0436362_1139557
355 Ga0466963_0346155
356 Ga0466963_0427547
357 Ga0466959_0321779
358 Ga0466958_0127116
359 Ga0466967_0134103
360 Ga0495652_0369983
361 Ga0495665_0131355
362 Ga0495587_0161846
363 Ga0495587_0207691
364 Ga0495645_0115400
365 Ga0495667_0263468
366 Ga0495635_0047321
367 Ga0495646_0204617
368 Ga0495647_0095457
369 Ga0495658_0091835
370 Ga0495669_0013568
371 Ga0495669_0021788
372 Ga0495581_0036621
373 Ga0495604_0208780
374 Ga0495636_0116319
375 Ga0495674_0216026
376 Ga0495675_0001864
377 Ga0495675_0153252
378 Ga0495602_0073160
379 Ga0496102_0339387
380 Ga0496112_0005621
381 Ga0501040_0098201
382 nmdc:mga05p37_444249_c1
383 nmdc:mga05p37_989970_c1
384 nmdc:mga0qj67_11429_c1
385 nmdc:mga06r32_184104_c1
386 nmdc:mga06r32_255957_c1
387 nmdc:mga08y16_14139_c1
388 nmdc:mga08y16_50557_c1
389 nmdc:mga0rr50_25598_c1
390 nmdc:mga08x19_1674_c1
391 nmdc:mga08x19_53548_c1
392 nmdc:mga0a205_569508_c1
393 Ga0495601_0014183
394 Ga0495601_0201616
395 Ga0495619_0078267
396 Ga0495619_0209413
397 Ga0587060_009532
398 Ga0466962_0076285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

69

137

0.96

PF04545

Sigma70_r4

Sigma-70, region 4

175

224

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

169

222

0.95

PF07638

Sigma70_ECF

ECF sigma factor

52

228

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9554 146 193
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9503 16 106
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9433 129 195
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9223 132 189
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9206 132 189
ID Description Score Start End Superfamily
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9522 17 102 1.10.1740.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9514 15 105 1.10.1740.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9504 16 106 1.10.1740.10
2w48A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9423 149 184 1.10.10.60
4go1A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9403 149 187 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3S2UN73-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6642 15 229 GO:0003677
GO:0006352
GO:0016987
AF-A0A3S2UN73-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6546 15 229 GO:0003677
GO:0006352
GO:0016987
AF-A0A534YII2-F1-model_v4 RNA polymerase sigma factor 0.5785 15 227 GO:0003677
GO:0006352
GO:0016987
AF-A0A2E0WMM8-F1-model_v4 RNA polymerase subunit sigma 0.5735 9 228 GO:0003677
GO:0006352
GO:0016987
AF-A0A2G2M073-F1-model_v4 RNA polymerase subunit sigma-24 0.5581 17 191 GO:0003677
GO:0006352
GO:0016987

Map