F305419

General Info

Members Datasets Scaffolds Average Seq Length
199 153 199 280

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100238162|Ga0070669_1002381622
Length 282
Sequence LSLPFQKWQALGNDYLIVEQDRLPFDLSPERIRRLCSPHFGCHSDGVLLLSPSTKDSFVARLRIFNPDGSEAELSGNGARQAILYLRRQGWTDEDVFSIETAAGEIRPTIIDERTCAVEMGRARLQSPDFPSGNGDGRGTLTVDSRTFDFQHINVGNPQCVIEVGEELEQLDLGTLGPPIERHELFPNRTNVAFIRIDSSNAVTARIFERGVGETLSSGTGACASALTALLRGAHSPVTVKLEGGELVVEADEQLNVRLTGWAEPVFEGELSAELVSALEQL

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 0
Rhizoplane 8.54
Rhizosphere 86.43
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003501 3300001977 Bacteria 2475
2 JGI24748J21848_1002276 3300002074 Bacteria 2154
3 JGI24034J26672_10000334 3300002239 Bacteria 6057
4 Ga0070676_10088607 3300005328 Bacteria 1891
5 Ga0070683_100038090 3300005329 Bacteria 4405
6 Ga0070677_10000008 3300005333 Bacteria 74027
7 Ga0070682_100000090 3300005337 Bacteria 82642
8 Ga0070660_100005003 3300005339 Bacteria 9165
9 Ga0070687_100057350 3300005343 Bacteria 2042
10 Ga0070692_10094681 3300005345 Bacteria 1628
11 Ga0070668_100042597 3300005347 Bacteria 3480
12 Ga0070669_100238162 3300005353 Bacteria 1445
13 Ga0070669_100250878 3300005353 Bacteria 1409
14 Ga0070675_100030032 3300005354 Bacteria 4386
15 Ga0070674_100000023 3300005356 Bacteria 84887
16 Ga0070673_100003692 3300005364 Bacteria 9586
17 Ga0070659_100000300 3300005366 Bacteria 38760
18 Ga0070711_100018148 3300005439 Bacteria 4488
19 Ga0070700_100006906 3300005441 Bacteria 6096
20 Ga0070694_100074694 3300005444 Bacteria 2343
21 Ga0070663_100014802 3300005455 Bacteria 5015
22 Ga0070663_100115389 3300005455 Bacteria 2023
23 Ga0070662_100000061 3300005457 Bacteria 58911
24 Ga0070662_100002066 3300005457 Bacteria 12312
25 Ga0070681_10011832 3300005458 Bacteria 8651
26 Ga0070681_10287008 3300005458 Bacteria 1556
27 Ga0068867_100001394 3300005459 Bacteria 16721
28 Ga0070685_10046229 3300005466 Bacteria 2498
29 Ga0070679_100000818 3300005530 Bacteria 26995
30 Ga0070684_100005151 3300005535 Bacteria 9994
31 Ga0070684_100026700 3300005535 Bacteria 4867
32 Ga0070684_100253176 3300005535 Bacteria 1610
33 Ga0070693_100000087 3300005547 Bacteria 39196
34 Ga0070664_100057838 3300005564 Bacteria 3297
35 Ga0068854_100071400 3300005578 Bacteria 2540
36 Ga0068864_100341180 3300005618 Bacteria 1412
37 Ga0068866_10000008 3300005718 Bacteria 117658
38 Ga0068861_100046942 3300005719 Bacteria 3258
39 Ga0068870_10065854 3300005840 Bacteria 1961
40 Ga0068858_100000097 3300005842 Bacteria 91503
41 Ga0068858_100000142 3300005842 Bacteria 75787
42 Ga0068860_100009272 3300005843 Bacteria 9786
43 Ga0081455_10023152 3300005937 Bacteria 5784
44 Ga0081540_1004933 3300005983 Bacteria 10038
45 Ga0081540_1024720 3300005983 Bacteria 3478
46 Ga0075365_10013880 3300006038 Bacteria 4832
47 Ga0070715_10000021 3300006163 Bacteria 119283
48 Ga0075367_10016185 3300006178 Bacteria 4070
49 Ga0075367_10210055 3300006178 Bacteria 1217
50 Ga0075433_10000055 3300006852 Bacteria 48950
51 Ga0075433_10049682 3300006852 Bacteria 3649
52 Ga0111539_10264986 3300009094 Bacteria 2000
53 Ga0105245_10000130 3300009098 Bacteria 72166
54 Ga0105243_10009649 3300009148 Bacteria 7348
55 Ga0105242_10079007 3300009176 Bacteria 2747
56 Ga0105238_10000055 3300009551 Bacteria 139232
57 Ga0105249_10000143 3300009553 Bacteria 92539
58 Ga0105239_10559488 3300010375 Bacteria 1303
59 Ga0105246_10428262 3300011119 Bacteria 1106
60 Ga0105246_10613754 3300011119 Bacteria 942
61 Ga0157370_10005384 3300013104 Bacteria 14369
62 Ga0157374_10005318 3300013296 Bacteria 10814
63 Ga0157374_10088352 3300013296 Bacteria 2952
64 Ga0157372_10111130 3300013307 Bacteria 3139
65 Ga0157375_10014759 3300013308 Bacteria 6982
66 Ga0157380_10002353 3300014326 Bacteria 12707
67 Ga0157379_10039546 3300014968 Bacteria 4208
68 Ga0207682_10005118 3300025893 Bacteria 5371
69 Ga0207642_10000002 3300025899 Bacteria 658166
70 Ga0207685_10000028 3300025905 Bacteria 97935
71 Ga0207707_10016527 3300025912 Bacteria 6434
72 Ga0207707_10220205 3300025912 Bacteria 1652
73 Ga0207693_10312266 3300025915 Bacteria 1231
74 Ga0207663_10000714 3300025916 Bacteria 14787
75 Ga0207660_10152637 3300025917 Bacteria 1776
76 Ga0207657_10010599 3300025919 Bacteria 9186
77 Ga0207652_10000827 3300025921 Bacteria 29489
78 Ga0207681_10147487 3300025923 Bacteria 1759
79 Ga0207694_10000063 3300025924 Bacteria 139700
80 Ga0207659_10007072 3300025926 Bacteria 6888
81 Ga0207687_10000032 3300025927 Bacteria 143196
82 Ga0207687_10000073 3300025927 Bacteria 73917
83 Ga0207690_10035629 3300025932 Bacteria 3217
84 Ga0207706_10000250 3300025933 Bacteria 58868
85 Ga0207706_10034868 3300025933 Bacteria 4477
86 Ga0207686_10120701 3300025934 Bacteria 1784
87 Ga0207709_10005702 3300025935 Bacteria 7033
88 Ga0207669_10000026 3300025937 Bacteria 92199
89 Ga0207704_10192667 3300025938 Bacteria 1484
90 Ga0207689_10143440 3300025942 Bacteria 1968
91 Ga0207661_10002261 3300025944 Bacteria 13276
92 Ga0207661_10038644 3300025944 Bacteria 3742
93 Ga0207679_10036597 3300025945 Bacteria 3482
94 Ga0207651_10002447 3300025960 Bacteria 8882
95 Ga0207712_10000058 3300025961 Bacteria 140948
96 Ga0207703_10000103 3300026035 Bacteria 99918
97 Ga0207703_10000287 3300026035 Bacteria 55757
98 Ga0207678_10014891 3300026067 Bacteria 6840
99 Ga0207678_10148868 3300026067 Bacteria 1998
100 Ga0207708_10000292 3300026075 Bacteria 39342
101 Ga0207641_10000016 3300026088 Bacteria 307363
102 Ga0207648_10000960 3300026089 Bacteria 32619
103 Ga0207648_10036679 3300026089 Bacteria 4319
104 Ga0207674_10220257 3300026116 Bacteria 1846
105 Ga0268266_10000056 3300028379 Bacteria 289176
106 Ga0268264_10004866 3300028381 Bacteria 11380
107 Ga0268264_10356264 3300028381 Bacteria 1394
108 Ga0373953_0128638 3300035117 Bacteria 1079
109 Ga0373955_0316061 3300035172 Bacteria 943
110 Ga0316574_0286661 3300035398 Unclassified 1048
111 Ga0395901_0354824 3300038443 Bacteria 1513
112 Ga0451853_0774009 3300041512 Bacteria 2758
113 Ga0466963_0000008 3300044694 Bacteria 74916
114 Ga0466963_0017476 3300044694 Bacteria 4471
115 Ga0466967_0049105 3300045976 Bacteria 3689
116 Ga0466967_0451743 3300045976 Bacteria 1256
117 Ga0495592_0000261 3300046454 Bacteria 44965
118 Ga0495603_0000098 3300046455 Bacteria 40307
119 Ga0495603_0001120 3300046455 Bacteria 15587
120 Ga0495603_0024158 3300046455 Bacteria 3675
121 Ga0495641_0000312 3300046461 Bacteria 39169
122 Ga0495653_0036589 3300046463 Bacteria 3865
123 Ga0495653_0053070 3300046463 Bacteria 3103
124 Ga0495582_0000001 3300046473 Bacteria 252434
125 Ga0495662_0000071 3300046476 Bacteria 35579
126 Ga0495618_0000014 3300046514 Bacteria 163136
127 Ga0495620_0000139 3300046515 Bacteria 59244
128 Ga0495628_0038848 3300046516 Bacteria 3808
129 Ga0495628_0152847 3300046516 Bacteria 1757
130 Ga0495630_0001794 3300046517 Bacteria 14978
131 Ga0495630_0001844 3300046517 Bacteria 14793
132 Ga0495630_0316283 3300046517 Bacteria 1193
133 Ga0495644_0000377 3300046523 Bacteria 20229
134 Ga0495586_0019076 3300046535 Bacteria 3650
135 Ga0495656_0001564 3300046615 Bacteria 7486
136 Ga0495634_0000293 3300046642 Bacteria 47827
137 Ga0495634_0071352 3300046642 Bacteria 2287
138 Ga0495635_0000076 3300046663 Bacteria 61665
139 Ga0495657_0029983 3300046675 Bacteria 3812
140 Ga0495657_0042227 3300046675 Bacteria 3115
141 Ga0495599_0009974 3300046678 Bacteria 5815
142 Ga0495647_0000001 3300046681 Bacteria 222371
143 Ga0495647_0000851 3300046681 Bacteria 9140
144 Ga0495658_0000002 3300046683 Bacteria 309651
145 Ga0495658_0200772 3300046683 Bacteria 1243
146 Ga0495669_0000779 3300046684 Bacteria 13635
147 Ga0495613_0076918 3300046689 Bacteria 2428
148 Ga0495624_0000724 3300046690 Bacteria 25913
149 Ga0495670_0012182 3300046691 Bacteria 4227
150 Ga0495649_0005501 3300046694 Bacteria 8035
151 Ga0495600_0000420 3300046809 Bacteria 21910
152 Ga0495600_0086832 3300046809 Bacteria 2041
153 Ga0495604_0000050 3300047317 Bacteria 108094
154 Ga0495604_0046063 3300047317 Bacteria 3401
155 Ga0495680_0000241 3300047322 Bacteria 60168
156 Ga0495680_0005092 3300047322 Bacteria 12403
157 Ga0495673_0130505 3300047469 Bacteria 988
158 Ga0495593_0058082 3300047673 Bacteria 2030
159 Ga0495602_0098244 3300048088 Bacteria 2410
160 Ga0496100_0000013 3300048903 Bacteria 177476
161 Ga0496101_0000035 3300048904 Bacteria 177237
162 Ga0496106_0000062 3300048909 Bacteria 85769
163 Ga0496107_0000020 3300048910 Bacteria 148990
164 Ga0496107_0029056 3300048910 Bacteria 3931
165 Ga0496108_0000006 3300048911 Bacteria 469473
166 Ga0496108_0000055 3300048911 Bacteria 125202
167 Ga0496108_0019061 3300048911 Bacteria 5628
168 Ga0496109_0000009 3300048912 Bacteria 236561
169 Ga0496109_0000043 3300048912 Bacteria 134649
170 Ga0496109_0012056 3300048912 Bacteria 7446
171 Ga0496109_0481517 3300048912 Bacteria 1172
172 Ga0496110_0019787 3300048913 Bacteria 5671
173 Ga0496112_0000025 3300048915 Bacteria 146197
174 Ga0496112_0506670 3300048915 Bacteria 1142
175 Ga0496113_0008602 3300048916 Bacteria 6656
176 Ga0496113_0010725 3300048916 Bacteria 6072
177 Ga0496125_0064283 3300048928 Bacteria 2917
178 Ga0501034_0027919 3300049571 Bacteria 5739
179 Ga0501043_0345709 3300049579 Unclassified 1131
180 Ga0501047_0063594 3300049581 Bacteria 3560
181 Ga0501070_0058602 3300049586 Bacteria 3192
182 Ga0501072_0506409 3300049588 Bacteria 955
183 Ga0501075_0001540 3300049591 Bacteria 15041
184 Ga0501080_0039572 3300049742 Bacteria 4400
185 Ga0501083_0167614 3300049744 Bacteria 1436
186 Ga0501044_0069060 3300049823 Bacteria 3598
187 nmdc:mga03n38_143128_c1 3300050490 Bacteria 1196
188 nmdc:mga0yw44_164848_c1 3300050492 Bacteria 1452
189 nmdc:mga06z11_11271_c1 3300050494 Bacteria 3849
190 nmdc:mga06z11_196344_c1 3300050494 Bacteria 1170
191 nmdc:mga08y16_119659_c1 3300050511 Bacteria 2741
192 nmdc:mga0a205_113_c1 3300050515 Bacteria 30301
193 nmdc:mga0a205_1740_c1 3300050515 Bacteria 18824
194 Ga0495601_0011517 3300053077 Bacteria 5296
195 Ga0495612_0004920 3300053078 Bacteria 5526
196 Ga0495595_0107448 3300053084 Bacteria 1351
197 Ga0495619_0000084 3300053085 Bacteria 70164
198 Ga0495619_0010813 3300053085 Bacteria 5744
199 Ga0500614_000152 3300053123 Bacteria 17444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10613754 Ga0105246_106137542 243
2 3300047469 Ga0495673_0130505 Ga0495673_0130505_216_974 251
3 3300049588 Ga0501072_0506409 Ga0501072_0506409_145_918 251
4 3300005353 Ga0070669_100250878 Ga0070669_1002508782 263
5 3300025923 Ga0207681_10147487 Ga0207681_101474872 263
6 3300045976 Ga0466967_0451743 Ga0466967_0451743_346_1188 270
7 3300046663 Ga0495635_0000076 Ga0495635_0000076_49905_50738 276
8 3300005339 Ga0070660_100005003 Ga0070660_1000050039 279
9 3300005343 Ga0070687_100057350 Ga0070687_1000573503 279
10 3300005345 Ga0070692_10094681 Ga0070692_100946811 279
11 3300005347 Ga0070668_100042597 Ga0070668_1000425974 279
12 3300005353 Ga0070669_100238162 Ga0070669_1002381622 279
13 3300005354 Ga0070675_100030032 Ga0070675_1000300324 279
14 3300005366 Ga0070659_100000300 Ga0070659_10000030022 279
15 3300005441 Ga0070700_100006906 Ga0070700_1000069062 279
16 3300005444 Ga0070694_100074694 Ga0070694_1000746943 279
17 3300005455 Ga0070663_100014802 Ga0070663_1000148025 279
18 3300005457 Ga0070662_100002066 Ga0070662_1000020664 279
19 3300005466 Ga0070685_10046229 Ga0070685_100462293 279
20 3300005578 Ga0068854_100071400 Ga0068854_1000714003 279
21 3300005618 Ga0068864_100341180 Ga0068864_1003411802 279
22 3300005719 Ga0068861_100046942 Ga0068861_1000469422 279
23 3300005840 Ga0068870_10065854 Ga0068870_100658542 279
24 3300006178 Ga0075367_10016185 Ga0075367_100161853 279
25 3300006852 Ga0075433_10000055 Ga0075433_1000005540 279
26 3300009094 Ga0111539_10264986 Ga0111539_102649862 279
27 3300009148 Ga0105243_10009649 Ga0105243_100096493 279
28 3300013307 Ga0157372_10111130 Ga0157372_101111303 279
29 3300013308 Ga0157375_10014759 Ga0157375_100147593 279
30 3300025919 Ga0207657_10010599 Ga0207657_100105999 279
31 3300025926 Ga0207659_10007072 Ga0207659_100070727 279
32 3300025933 Ga0207706_10034868 Ga0207706_100348684 279
33 3300025935 Ga0207709_10005702 Ga0207709_100057026 279
34 3300025938 Ga0207704_10192667 Ga0207704_101926672 279
35 3300025942 Ga0207689_10143440 Ga0207689_101434402 279
36 3300025945 Ga0207679_10036597 Ga0207679_100365972 279
37 3300026067 Ga0207678_10014891 Ga0207678_100148916 279
38 3300026075 Ga0207708_10000292 Ga0207708_1000029222 279
39 3300026089 Ga0207648_10036679 Ga0207648_100366795 279
40 3300026116 Ga0207674_10220257 Ga0207674_102202572 279
41 3300028381 Ga0268264_10356264 Ga0268264_103562642 279
42 3300038443 Ga0395901_0354824 Ga0395901_0354824_139_978 279
43 3300046455 Ga0495603_0000098 Ga0495603_0000098_6155_6994 279
44 3300046463 Ga0495653_0053070 Ga0495653_0053070_738_1577 279
45 3300046517 Ga0495630_0001794 Ga0495630_0001794_12487_13335 279
46 3300046517 Ga0495630_0316283 Ga0495630_0316283_61_909 279
47 3300046675 Ga0495657_0042227 Ga0495657_0042227_808_1656 279
48 3300047317 Ga0495604_0000050 Ga0495604_0000050_35565_36404 279
49 3300048910 Ga0496107_0029056 Ga0496107_0029056_2316_3158 279
50 3300048912 Ga0496109_0012056 Ga0496109_0012056_5308_6150 279
51 3300050494 nmdc:mga06z11_11271_c1 nmdc:mga06z11_11271_c1_1009_1851 279
52 3300050511 nmdc:mga08y16_119659_c1 nmdc:mga08y16_119659_c1_1626_2468 279
53 3300050515 nmdc:mga0a205_1740_c1 nmdc:mga0a205_1740_c1_14979_15818 279
54 3300053077 Ga0495601_0011517 Ga0495601_0011517_3141_3989 279
55 3300053085 Ga0495619_0000084 Ga0495619_0000084_3821_4660 279
56 3300001977 JGI24746J21847_1003501 JGI24746J21847_10035013 280
57 3300002074 JGI24748J21848_1002276 JGI24748J21848_10022762 280
58 3300002239 JGI24034J26672_10000334 JGI24034J26672_100003345 280
59 3300005328 Ga0070676_10088607 Ga0070676_100886072 280
60 3300005329 Ga0070683_100038090 Ga0070683_1000380904 280
61 3300005333 Ga0070677_10000008 Ga0070677_1000000829 280
62 3300005337 Ga0070682_100000090 Ga0070682_10000009048 280
63 3300005356 Ga0070674_100000023 Ga0070674_10000002349 280
64 3300005364 Ga0070673_100003692 Ga0070673_1000036927 280
65 3300005439 Ga0070711_100018148 Ga0070711_1000181484 280
66 3300005455 Ga0070663_100115389 Ga0070663_1001153892 280
67 3300005457 Ga0070662_100000061 Ga0070662_10000006114 280
68 3300005458 Ga0070681_10011832 Ga0070681_100118325 280
69 3300005458 Ga0070681_10287008 Ga0070681_102870081 280
70 3300005459 Ga0068867_100001394 Ga0068867_10000139412 280
71 3300005530 Ga0070679_100000818 Ga0070679_10000081814 280
72 3300005535 Ga0070684_100005151 Ga0070684_1000051516 280
73 3300005535 Ga0070684_100026700 Ga0070684_1000267005 280
74 3300005535 Ga0070684_100253176 Ga0070684_1002531762 280
75 3300005547 Ga0070693_100000087 Ga0070693_10000008733 280
76 3300005564 Ga0070664_100057838 Ga0070664_1000578383 280
77 3300005718 Ga0068866_10000008 Ga0068866_1000000873 280
78 3300005842 Ga0068858_100000097 Ga0068858_10000009764 280
79 3300005842 Ga0068858_100000142 Ga0068858_10000014216 280
80 3300005843 Ga0068860_100009272 Ga0068860_1000092723 280
81 3300005937 Ga0081455_10023152 Ga0081455_100231523 280
82 3300005983 Ga0081540_1004933 Ga0081540_10049337 280
83 3300005983 Ga0081540_1024720 Ga0081540_10247202 280
84 3300006038 Ga0075365_10013880 Ga0075365_100138805 280
85 3300006163 Ga0070715_10000021 Ga0070715_1000002151 280
86 3300006178 Ga0075367_10210055 Ga0075367_102100552 280
87 3300006852 Ga0075433_10049682 Ga0075433_100496822 280
88 3300009098 Ga0105245_10000130 Ga0105245_1000013030 280
89 3300009176 Ga0105242_10079007 Ga0105242_100790072 280
90 3300009551 Ga0105238_10000055 Ga0105238_1000005568 280
91 3300009553 Ga0105249_10000143 Ga0105249_1000014322 280
92 3300010375 Ga0105239_10559488 Ga0105239_105594882 280
93 3300011119 Ga0105246_10428262 Ga0105246_104282621 280
94 3300013104 Ga0157370_10005384 Ga0157370_100053847 280
95 3300013296 Ga0157374_10005318 Ga0157374_100053185 280
96 3300013296 Ga0157374_10088352 Ga0157374_100883522 280
97 3300014326 Ga0157380_10002353 Ga0157380_100023534 280
98 3300014968 Ga0157379_10039546 Ga0157379_100395462 280
99 3300025893 Ga0207682_10005118 Ga0207682_100051185 280
100 3300025899 Ga0207642_10000002 Ga0207642_10000002596 280
101 3300025905 Ga0207685_10000028 Ga0207685_1000002874 280
102 3300025912 Ga0207707_10016527 Ga0207707_100165274 280
103 3300025912 Ga0207707_10220205 Ga0207707_102202052 280
104 3300025915 Ga0207693_10312266 Ga0207693_103122662 280
105 3300025916 Ga0207663_10000714 Ga0207663_1000071415 280
106 3300025917 Ga0207660_10152637 Ga0207660_101526373 280
107 3300025921 Ga0207652_10000827 Ga0207652_1000082713 280
108 3300025924 Ga0207694_10000063 Ga0207694_1000006373 280
109 3300025927 Ga0207687_10000032 Ga0207687_1000003270 280
110 3300025927 Ga0207687_10000073 Ga0207687_1000007376 280
111 3300025932 Ga0207690_10035629 Ga0207690_100356291 280
112 3300025933 Ga0207706_10000250 Ga0207706_1000025051 280
113 3300025934 Ga0207686_10120701 Ga0207686_101207012 280
114 3300025937 Ga0207669_10000026 Ga0207669_1000002656 280
115 3300025944 Ga0207661_10002261 Ga0207661_100022616 280
116 3300025944 Ga0207661_10038644 Ga0207661_100386444 280
117 3300025960 Ga0207651_10002447 Ga0207651_100024476 280
118 3300025961 Ga0207712_10000058 Ga0207712_1000005873 280
119 3300026035 Ga0207703_10000103 Ga0207703_1000010375 280
120 3300026035 Ga0207703_10000287 Ga0207703_1000028710 280
121 3300026067 Ga0207678_10148868 Ga0207678_101488682 280
122 3300026088 Ga0207641_10000016 Ga0207641_10000016235 280
123 3300026089 Ga0207648_10000960 Ga0207648_1000096011 280
124 3300028379 Ga0268266_10000056 Ga0268266_10000056217 280
125 3300028381 Ga0268264_10004866 Ga0268264_100048669 280
126 3300035117 Ga0373953_0128638 Ga0373953_0128638_94_936 280
127 3300035172 Ga0373955_0316061 Ga0373955_0316061_81_926 280
128 3300035398 Ga0316574_0286661 Ga0316574_0286661_21_866 280
129 3300041512 Ga0451853_0774009 Ga0451853_0774009_752_1597 280
130 3300044694 Ga0466963_0000008 Ga0466963_0000008_11662_12507 280
131 3300044694 Ga0466963_0017476 Ga0466963_0017476_2230_3075 280
132 3300045976 Ga0466967_0049105 Ga0466967_0049105_281_1126 280
133 3300046454 Ga0495592_0000261 Ga0495592_0000261_19321_20166 280
134 3300046455 Ga0495603_0001120 Ga0495603_0001120_10516_11361 280
135 3300046455 Ga0495603_0024158 Ga0495603_0024158_166_1011 280
136 3300046461 Ga0495641_0000312 Ga0495641_0000312_23727_24572 280
137 3300046463 Ga0495653_0036589 Ga0495653_0036589_2128_2970 280
138 3300046473 Ga0495582_0000001 Ga0495582_0000001_121071_121916 280
139 3300046476 Ga0495662_0000071 Ga0495662_0000071_15512_16357 280
140 3300046514 Ga0495618_0000014 Ga0495618_0000014_159393_160292 280
141 3300046515 Ga0495620_0000139 Ga0495620_0000139_15765_16610 280
142 3300046516 Ga0495628_0038848 Ga0495628_0038848_2022_2864 280
143 3300046516 Ga0495628_0152847 Ga0495628_0152847_418_1263 280
144 3300046517 Ga0495630_0001844 Ga0495630_0001844_2803_3648 280
145 3300046523 Ga0495644_0000377 Ga0495644_0000377_3860_4705 280
146 3300046535 Ga0495586_0019076 Ga0495586_0019076_934_1779 280
147 3300046615 Ga0495656_0001564 Ga0495656_0001564_4621_5472 280
148 3300046642 Ga0495634_0000293 Ga0495634_0000293_40204_41049 280
149 3300046642 Ga0495634_0071352 Ga0495634_0071352_753_1598 280
150 3300046675 Ga0495657_0029983 Ga0495657_0029983_219_1064 280
151 3300046678 Ga0495599_0009974 Ga0495599_0009974_2061_2906 280
152 3300046681 Ga0495647_0000001 Ga0495647_0000001_153577_154422 280
153 3300046681 Ga0495647_0000851 Ga0495647_0000851_5203_6048 280
154 3300046683 Ga0495658_0000002 Ga0495658_0000002_244677_245522 280
155 3300046683 Ga0495658_0200772 Ga0495658_0200772_49_894 280
156 3300046684 Ga0495669_0000779 Ga0495669_0000779_10514_11359 280
157 3300046689 Ga0495613_0076918 Ga0495613_0076918_884_1729 280
158 3300046690 Ga0495624_0000724 Ga0495624_0000724_12700_13545 280
159 3300046691 Ga0495670_0012182 Ga0495670_0012182_1951_2796 280
160 3300046694 Ga0495649_0005501 Ga0495649_0005501_5967_6812 280
161 3300046809 Ga0495600_0000420 Ga0495600_0000420_836_1735 280
162 3300046809 Ga0495600_0086832 Ga0495600_0086832_642_1487 280
163 3300047317 Ga0495604_0046063 Ga0495604_0046063_1224_2069 280
164 3300047322 Ga0495680_0000241 Ga0495680_0000241_42211_43056 280
165 3300047322 Ga0495680_0005092 Ga0495680_0005092_9371_10216 280
166 3300047673 Ga0495593_0058082 Ga0495593_0058082_1105_1950 280
167 3300048088 Ga0495602_0098244 Ga0495602_0098244_611_1468 280
168 3300048903 Ga0496100_0000013 Ga0496100_0000013_110883_111728 280
169 3300048904 Ga0496101_0000035 Ga0496101_0000035_110883_111728 280
170 3300048909 Ga0496106_0000062 Ga0496106_0000062_19415_20260 280
171 3300048910 Ga0496107_0000020 Ga0496107_0000020_82032_82877 280
172 3300048911 Ga0496108_0000006 Ga0496108_0000006_295204_296049 280
173 3300048911 Ga0496108_0000055 Ga0496108_0000055_123998_124840 280
174 3300048911 Ga0496108_0019061 Ga0496108_0019061_2891_3736 280
175 3300048912 Ga0496109_0000009 Ga0496109_0000009_62292_63137 280
176 3300048912 Ga0496109_0000043 Ga0496109_0000043_129373_130215 280
177 3300048912 Ga0496109_0481517 Ga0496109_0481517_118_960 280
178 3300048913 Ga0496110_0019787 Ga0496110_0019787_4110_4955 280
179 3300048915 Ga0496112_0000025 Ga0496112_0000025_67424_68269 280
180 3300048915 Ga0496112_0506670 Ga0496112_0506670_252_1094 280
181 3300048916 Ga0496113_0008602 Ga0496113_0008602_1713_2558 280
182 3300048916 Ga0496113_0010725 Ga0496113_0010725_4741_5583 280
183 3300048928 Ga0496125_0064283 Ga0496125_0064283_2016_2861 280
184 3300049571 Ga0501034_0027919 Ga0501034_0027919_2663_3505 280
185 3300049579 Ga0501043_0345709 Ga0501043_0345709_97_939 280
186 3300049581 Ga0501047_0063594 Ga0501047_0063594_2358_3200 280
187 3300049586 Ga0501070_0058602 Ga0501070_0058602_1007_1867 280
188 3300049591 Ga0501075_0001540 Ga0501075_0001540_5562_6425 280
189 3300049742 Ga0501080_0039572 Ga0501080_0039572_2679_3539 280
190 3300049744 Ga0501083_0167614 Ga0501083_0167614_338_1198 280
191 3300049823 Ga0501044_0069060 Ga0501044_0069060_517_1359 280
192 3300050490 nmdc:mga03n38_143128_c1 nmdc:mga03n38_143128_c1_324_1169 280
193 3300050492 nmdc:mga0yw44_164848_c1 nmdc:mga0yw44_164848_c1_476_1348 280
194 3300050494 nmdc:mga06z11_196344_c1 nmdc:mga06z11_196344_c1_181_1026 280
195 3300050515 nmdc:mga0a205_113_c1 nmdc:mga0a205_113_c1_3496_4338 280
196 3300053078 Ga0495612_0004920 Ga0495612_0004920_3370_4215 280
197 3300053084 Ga0495595_0107448 Ga0495595_0107448_144_986 280
198 3300053085 Ga0495619_0010813 Ga0495619_0010813_136_990 280
199 3300053123 Ga0500614_000152 Ga0500614_000152_12952_13797 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

5

126

0.93

PF01678

DAP_epimerase

Diaminopimelate epimerase

151

264

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.9429 1 269
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.9249 1 276
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.9247 1 269
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9236 1 266
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.9198 1 269
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9269 146 256 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9253 131 251 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9188 3 111 3.10.310.10
2q9jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8995 1 107 3.10.310.10
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8929 3 119 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7K0RYG3-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9878 1 278 GO:0005829
GO:0008837
GO:0009089
AF-A0A7V9LHP2-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9837 70 278 GO:0005829
GO:0008837
GO:0009089
AF-A0A7K0RYG3-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9773 1 278 GO:0005829
GO:0008837
GO:0009089
AF-A0A6B3KCV1-F1-model_v4 deleted 0.9727 101 226
AF-A0A7V9CFL2-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9705 1 244 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
93.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map