F305419
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 153 | 199 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100238162|Ga0070669_1002381622 |
| Length | 282 |
| Sequence | LSLPFQKWQALGNDYLIVEQDRLPFDLSPERIRRLCSPHFGCHSDGVLLLSPSTKDSFVARLRIFNPDGSEAELSGNGARQAILYLRRQGWTDEDVFSIETAAGEIRPTIIDERTCAVEMGRARLQSPDFPSGNGDGRGTLTVDSRTFDFQHINVGNPQCVIEVGEELEQLDLGTLGPPIERHELFPNRTNVAFIRIDSSNAVTARIFERGVGETLSSGTGACASALTALLRGAHSPVTVKLEGGELVVEADEQLNVRLTGWAEPVFEGELSAELVSALEQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 90 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 93 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 94 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 95 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 129 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 133 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 134 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 145 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 146 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 147 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 0 |
| Rhizoplane | 8.54 |
| Rhizosphere | 86.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003501 | 3300001977 | Bacteria | 2475 |
| 2 | JGI24748J21848_1002276 | 3300002074 | Bacteria | 2154 |
| 3 | JGI24034J26672_10000334 | 3300002239 | Bacteria | 6057 |
| 4 | Ga0070676_10088607 | 3300005328 | Bacteria | 1891 |
| 5 | Ga0070683_100038090 | 3300005329 | Bacteria | 4405 |
| 6 | Ga0070677_10000008 | 3300005333 | Bacteria | 74027 |
| 7 | Ga0070682_100000090 | 3300005337 | Bacteria | 82642 |
| 8 | Ga0070660_100005003 | 3300005339 | Bacteria | 9165 |
| 9 | Ga0070687_100057350 | 3300005343 | Bacteria | 2042 |
| 10 | Ga0070692_10094681 | 3300005345 | Bacteria | 1628 |
| 11 | Ga0070668_100042597 | 3300005347 | Bacteria | 3480 |
| 12 | Ga0070669_100238162 | 3300005353 | Bacteria | 1445 |
| 13 | Ga0070669_100250878 | 3300005353 | Bacteria | 1409 |
| 14 | Ga0070675_100030032 | 3300005354 | Bacteria | 4386 |
| 15 | Ga0070674_100000023 | 3300005356 | Bacteria | 84887 |
| 16 | Ga0070673_100003692 | 3300005364 | Bacteria | 9586 |
| 17 | Ga0070659_100000300 | 3300005366 | Bacteria | 38760 |
| 18 | Ga0070711_100018148 | 3300005439 | Bacteria | 4488 |
| 19 | Ga0070700_100006906 | 3300005441 | Bacteria | 6096 |
| 20 | Ga0070694_100074694 | 3300005444 | Bacteria | 2343 |
| 21 | Ga0070663_100014802 | 3300005455 | Bacteria | 5015 |
| 22 | Ga0070663_100115389 | 3300005455 | Bacteria | 2023 |
| 23 | Ga0070662_100000061 | 3300005457 | Bacteria | 58911 |
| 24 | Ga0070662_100002066 | 3300005457 | Bacteria | 12312 |
| 25 | Ga0070681_10011832 | 3300005458 | Bacteria | 8651 |
| 26 | Ga0070681_10287008 | 3300005458 | Bacteria | 1556 |
| 27 | Ga0068867_100001394 | 3300005459 | Bacteria | 16721 |
| 28 | Ga0070685_10046229 | 3300005466 | Bacteria | 2498 |
| 29 | Ga0070679_100000818 | 3300005530 | Bacteria | 26995 |
| 30 | Ga0070684_100005151 | 3300005535 | Bacteria | 9994 |
| 31 | Ga0070684_100026700 | 3300005535 | Bacteria | 4867 |
| 32 | Ga0070684_100253176 | 3300005535 | Bacteria | 1610 |
| 33 | Ga0070693_100000087 | 3300005547 | Bacteria | 39196 |
| 34 | Ga0070664_100057838 | 3300005564 | Bacteria | 3297 |
| 35 | Ga0068854_100071400 | 3300005578 | Bacteria | 2540 |
| 36 | Ga0068864_100341180 | 3300005618 | Bacteria | 1412 |
| 37 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 38 | Ga0068861_100046942 | 3300005719 | Bacteria | 3258 |
| 39 | Ga0068870_10065854 | 3300005840 | Bacteria | 1961 |
| 40 | Ga0068858_100000097 | 3300005842 | Bacteria | 91503 |
| 41 | Ga0068858_100000142 | 3300005842 | Bacteria | 75787 |
| 42 | Ga0068860_100009272 | 3300005843 | Bacteria | 9786 |
| 43 | Ga0081455_10023152 | 3300005937 | Bacteria | 5784 |
| 44 | Ga0081540_1004933 | 3300005983 | Bacteria | 10038 |
| 45 | Ga0081540_1024720 | 3300005983 | Bacteria | 3478 |
| 46 | Ga0075365_10013880 | 3300006038 | Bacteria | 4832 |
| 47 | Ga0070715_10000021 | 3300006163 | Bacteria | 119283 |
| 48 | Ga0075367_10016185 | 3300006178 | Bacteria | 4070 |
| 49 | Ga0075367_10210055 | 3300006178 | Bacteria | 1217 |
| 50 | Ga0075433_10000055 | 3300006852 | Bacteria | 48950 |
| 51 | Ga0075433_10049682 | 3300006852 | Bacteria | 3649 |
| 52 | Ga0111539_10264986 | 3300009094 | Bacteria | 2000 |
| 53 | Ga0105245_10000130 | 3300009098 | Bacteria | 72166 |
| 54 | Ga0105243_10009649 | 3300009148 | Bacteria | 7348 |
| 55 | Ga0105242_10079007 | 3300009176 | Bacteria | 2747 |
| 56 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 57 | Ga0105249_10000143 | 3300009553 | Bacteria | 92539 |
| 58 | Ga0105239_10559488 | 3300010375 | Bacteria | 1303 |
| 59 | Ga0105246_10428262 | 3300011119 | Bacteria | 1106 |
| 60 | Ga0105246_10613754 | 3300011119 | Bacteria | 942 |
| 61 | Ga0157370_10005384 | 3300013104 | Bacteria | 14369 |
| 62 | Ga0157374_10005318 | 3300013296 | Bacteria | 10814 |
| 63 | Ga0157374_10088352 | 3300013296 | Bacteria | 2952 |
| 64 | Ga0157372_10111130 | 3300013307 | Bacteria | 3139 |
| 65 | Ga0157375_10014759 | 3300013308 | Bacteria | 6982 |
| 66 | Ga0157380_10002353 | 3300014326 | Bacteria | 12707 |
| 67 | Ga0157379_10039546 | 3300014968 | Bacteria | 4208 |
| 68 | Ga0207682_10005118 | 3300025893 | Bacteria | 5371 |
| 69 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 70 | Ga0207685_10000028 | 3300025905 | Bacteria | 97935 |
| 71 | Ga0207707_10016527 | 3300025912 | Bacteria | 6434 |
| 72 | Ga0207707_10220205 | 3300025912 | Bacteria | 1652 |
| 73 | Ga0207693_10312266 | 3300025915 | Bacteria | 1231 |
| 74 | Ga0207663_10000714 | 3300025916 | Bacteria | 14787 |
| 75 | Ga0207660_10152637 | 3300025917 | Bacteria | 1776 |
| 76 | Ga0207657_10010599 | 3300025919 | Bacteria | 9186 |
| 77 | Ga0207652_10000827 | 3300025921 | Bacteria | 29489 |
| 78 | Ga0207681_10147487 | 3300025923 | Bacteria | 1759 |
| 79 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 80 | Ga0207659_10007072 | 3300025926 | Bacteria | 6888 |
| 81 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 82 | Ga0207687_10000073 | 3300025927 | Bacteria | 73917 |
| 83 | Ga0207690_10035629 | 3300025932 | Bacteria | 3217 |
| 84 | Ga0207706_10000250 | 3300025933 | Bacteria | 58868 |
| 85 | Ga0207706_10034868 | 3300025933 | Bacteria | 4477 |
| 86 | Ga0207686_10120701 | 3300025934 | Bacteria | 1784 |
| 87 | Ga0207709_10005702 | 3300025935 | Bacteria | 7033 |
| 88 | Ga0207669_10000026 | 3300025937 | Bacteria | 92199 |
| 89 | Ga0207704_10192667 | 3300025938 | Bacteria | 1484 |
| 90 | Ga0207689_10143440 | 3300025942 | Bacteria | 1968 |
| 91 | Ga0207661_10002261 | 3300025944 | Bacteria | 13276 |
| 92 | Ga0207661_10038644 | 3300025944 | Bacteria | 3742 |
| 93 | Ga0207679_10036597 | 3300025945 | Bacteria | 3482 |
| 94 | Ga0207651_10002447 | 3300025960 | Bacteria | 8882 |
| 95 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 96 | Ga0207703_10000103 | 3300026035 | Bacteria | 99918 |
| 97 | Ga0207703_10000287 | 3300026035 | Bacteria | 55757 |
| 98 | Ga0207678_10014891 | 3300026067 | Bacteria | 6840 |
| 99 | Ga0207678_10148868 | 3300026067 | Bacteria | 1998 |
| 100 | Ga0207708_10000292 | 3300026075 | Bacteria | 39342 |
| 101 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 102 | Ga0207648_10000960 | 3300026089 | Bacteria | 32619 |
| 103 | Ga0207648_10036679 | 3300026089 | Bacteria | 4319 |
| 104 | Ga0207674_10220257 | 3300026116 | Bacteria | 1846 |
| 105 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 106 | Ga0268264_10004866 | 3300028381 | Bacteria | 11380 |
| 107 | Ga0268264_10356264 | 3300028381 | Bacteria | 1394 |
| 108 | Ga0373953_0128638 | 3300035117 | Bacteria | 1079 |
| 109 | Ga0373955_0316061 | 3300035172 | Bacteria | 943 |
| 110 | Ga0316574_0286661 | 3300035398 | Unclassified | 1048 |
| 111 | Ga0395901_0354824 | 3300038443 | Bacteria | 1513 |
| 112 | Ga0451853_0774009 | 3300041512 | Bacteria | 2758 |
| 113 | Ga0466963_0000008 | 3300044694 | Bacteria | 74916 |
| 114 | Ga0466963_0017476 | 3300044694 | Bacteria | 4471 |
| 115 | Ga0466967_0049105 | 3300045976 | Bacteria | 3689 |
| 116 | Ga0466967_0451743 | 3300045976 | Bacteria | 1256 |
| 117 | Ga0495592_0000261 | 3300046454 | Bacteria | 44965 |
| 118 | Ga0495603_0000098 | 3300046455 | Bacteria | 40307 |
| 119 | Ga0495603_0001120 | 3300046455 | Bacteria | 15587 |
| 120 | Ga0495603_0024158 | 3300046455 | Bacteria | 3675 |
| 121 | Ga0495641_0000312 | 3300046461 | Bacteria | 39169 |
| 122 | Ga0495653_0036589 | 3300046463 | Bacteria | 3865 |
| 123 | Ga0495653_0053070 | 3300046463 | Bacteria | 3103 |
| 124 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 125 | Ga0495662_0000071 | 3300046476 | Bacteria | 35579 |
| 126 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 127 | Ga0495620_0000139 | 3300046515 | Bacteria | 59244 |
| 128 | Ga0495628_0038848 | 3300046516 | Bacteria | 3808 |
| 129 | Ga0495628_0152847 | 3300046516 | Bacteria | 1757 |
| 130 | Ga0495630_0001794 | 3300046517 | Bacteria | 14978 |
| 131 | Ga0495630_0001844 | 3300046517 | Bacteria | 14793 |
| 132 | Ga0495630_0316283 | 3300046517 | Bacteria | 1193 |
| 133 | Ga0495644_0000377 | 3300046523 | Bacteria | 20229 |
| 134 | Ga0495586_0019076 | 3300046535 | Bacteria | 3650 |
| 135 | Ga0495656_0001564 | 3300046615 | Bacteria | 7486 |
| 136 | Ga0495634_0000293 | 3300046642 | Bacteria | 47827 |
| 137 | Ga0495634_0071352 | 3300046642 | Bacteria | 2287 |
| 138 | Ga0495635_0000076 | 3300046663 | Bacteria | 61665 |
| 139 | Ga0495657_0029983 | 3300046675 | Bacteria | 3812 |
| 140 | Ga0495657_0042227 | 3300046675 | Bacteria | 3115 |
| 141 | Ga0495599_0009974 | 3300046678 | Bacteria | 5815 |
| 142 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 143 | Ga0495647_0000851 | 3300046681 | Bacteria | 9140 |
| 144 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 145 | Ga0495658_0200772 | 3300046683 | Bacteria | 1243 |
| 146 | Ga0495669_0000779 | 3300046684 | Bacteria | 13635 |
| 147 | Ga0495613_0076918 | 3300046689 | Bacteria | 2428 |
| 148 | Ga0495624_0000724 | 3300046690 | Bacteria | 25913 |
| 149 | Ga0495670_0012182 | 3300046691 | Bacteria | 4227 |
| 150 | Ga0495649_0005501 | 3300046694 | Bacteria | 8035 |
| 151 | Ga0495600_0000420 | 3300046809 | Bacteria | 21910 |
| 152 | Ga0495600_0086832 | 3300046809 | Bacteria | 2041 |
| 153 | Ga0495604_0000050 | 3300047317 | Bacteria | 108094 |
| 154 | Ga0495604_0046063 | 3300047317 | Bacteria | 3401 |
| 155 | Ga0495680_0000241 | 3300047322 | Bacteria | 60168 |
| 156 | Ga0495680_0005092 | 3300047322 | Bacteria | 12403 |
| 157 | Ga0495673_0130505 | 3300047469 | Bacteria | 988 |
| 158 | Ga0495593_0058082 | 3300047673 | Bacteria | 2030 |
| 159 | Ga0495602_0098244 | 3300048088 | Bacteria | 2410 |
| 160 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 161 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 162 | Ga0496106_0000062 | 3300048909 | Bacteria | 85769 |
| 163 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 164 | Ga0496107_0029056 | 3300048910 | Bacteria | 3931 |
| 165 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 166 | Ga0496108_0000055 | 3300048911 | Bacteria | 125202 |
| 167 | Ga0496108_0019061 | 3300048911 | Bacteria | 5628 |
| 168 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 169 | Ga0496109_0000043 | 3300048912 | Bacteria | 134649 |
| 170 | Ga0496109_0012056 | 3300048912 | Bacteria | 7446 |
| 171 | Ga0496109_0481517 | 3300048912 | Bacteria | 1172 |
| 172 | Ga0496110_0019787 | 3300048913 | Bacteria | 5671 |
| 173 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 174 | Ga0496112_0506670 | 3300048915 | Bacteria | 1142 |
| 175 | Ga0496113_0008602 | 3300048916 | Bacteria | 6656 |
| 176 | Ga0496113_0010725 | 3300048916 | Bacteria | 6072 |
| 177 | Ga0496125_0064283 | 3300048928 | Bacteria | 2917 |
| 178 | Ga0501034_0027919 | 3300049571 | Bacteria | 5739 |
| 179 | Ga0501043_0345709 | 3300049579 | Unclassified | 1131 |
| 180 | Ga0501047_0063594 | 3300049581 | Bacteria | 3560 |
| 181 | Ga0501070_0058602 | 3300049586 | Bacteria | 3192 |
| 182 | Ga0501072_0506409 | 3300049588 | Bacteria | 955 |
| 183 | Ga0501075_0001540 | 3300049591 | Bacteria | 15041 |
| 184 | Ga0501080_0039572 | 3300049742 | Bacteria | 4400 |
| 185 | Ga0501083_0167614 | 3300049744 | Bacteria | 1436 |
| 186 | Ga0501044_0069060 | 3300049823 | Bacteria | 3598 |
| 187 | nmdc:mga03n38_143128_c1 | 3300050490 | Bacteria | 1196 |
| 188 | nmdc:mga0yw44_164848_c1 | 3300050492 | Bacteria | 1452 |
| 189 | nmdc:mga06z11_11271_c1 | 3300050494 | Bacteria | 3849 |
| 190 | nmdc:mga06z11_196344_c1 | 3300050494 | Bacteria | 1170 |
| 191 | nmdc:mga08y16_119659_c1 | 3300050511 | Bacteria | 2741 |
| 192 | nmdc:mga0a205_113_c1 | 3300050515 | Bacteria | 30301 |
| 193 | nmdc:mga0a205_1740_c1 | 3300050515 | Bacteria | 18824 |
| 194 | Ga0495601_0011517 | 3300053077 | Bacteria | 5296 |
| 195 | Ga0495612_0004920 | 3300053078 | Bacteria | 5526 |
| 196 | Ga0495595_0107448 | 3300053084 | Bacteria | 1351 |
| 197 | Ga0495619_0000084 | 3300053085 | Bacteria | 70164 |
| 198 | Ga0495619_0010813 | 3300053085 | Bacteria | 5744 |
| 199 | Ga0500614_000152 | 3300053123 | Bacteria | 17444 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10613754 | Ga0105246_106137542 | 243 |
| 2 | 3300047469 | Ga0495673_0130505 | Ga0495673_0130505_216_974 | 251 |
| 3 | 3300049588 | Ga0501072_0506409 | Ga0501072_0506409_145_918 | 251 |
| 4 | 3300005353 | Ga0070669_100250878 | Ga0070669_1002508782 | 263 |
| 5 | 3300025923 | Ga0207681_10147487 | Ga0207681_101474872 | 263 |
| 6 | 3300045976 | Ga0466967_0451743 | Ga0466967_0451743_346_1188 | 270 |
| 7 | 3300046663 | Ga0495635_0000076 | Ga0495635_0000076_49905_50738 | 276 |
| 8 | 3300005339 | Ga0070660_100005003 | Ga0070660_1000050039 | 279 |
| 9 | 3300005343 | Ga0070687_100057350 | Ga0070687_1000573503 | 279 |
| 10 | 3300005345 | Ga0070692_10094681 | Ga0070692_100946811 | 279 |
| 11 | 3300005347 | Ga0070668_100042597 | Ga0070668_1000425974 | 279 |
| 12 | 3300005353 | Ga0070669_100238162 | Ga0070669_1002381622 | 279 |
| 13 | 3300005354 | Ga0070675_100030032 | Ga0070675_1000300324 | 279 |
| 14 | 3300005366 | Ga0070659_100000300 | Ga0070659_10000030022 | 279 |
| 15 | 3300005441 | Ga0070700_100006906 | Ga0070700_1000069062 | 279 |
| 16 | 3300005444 | Ga0070694_100074694 | Ga0070694_1000746943 | 279 |
| 17 | 3300005455 | Ga0070663_100014802 | Ga0070663_1000148025 | 279 |
| 18 | 3300005457 | Ga0070662_100002066 | Ga0070662_1000020664 | 279 |
| 19 | 3300005466 | Ga0070685_10046229 | Ga0070685_100462293 | 279 |
| 20 | 3300005578 | Ga0068854_100071400 | Ga0068854_1000714003 | 279 |
| 21 | 3300005618 | Ga0068864_100341180 | Ga0068864_1003411802 | 279 |
| 22 | 3300005719 | Ga0068861_100046942 | Ga0068861_1000469422 | 279 |
| 23 | 3300005840 | Ga0068870_10065854 | Ga0068870_100658542 | 279 |
| 24 | 3300006178 | Ga0075367_10016185 | Ga0075367_100161853 | 279 |
| 25 | 3300006852 | Ga0075433_10000055 | Ga0075433_1000005540 | 279 |
| 26 | 3300009094 | Ga0111539_10264986 | Ga0111539_102649862 | 279 |
| 27 | 3300009148 | Ga0105243_10009649 | Ga0105243_100096493 | 279 |
| 28 | 3300013307 | Ga0157372_10111130 | Ga0157372_101111303 | 279 |
| 29 | 3300013308 | Ga0157375_10014759 | Ga0157375_100147593 | 279 |
| 30 | 3300025919 | Ga0207657_10010599 | Ga0207657_100105999 | 279 |
| 31 | 3300025926 | Ga0207659_10007072 | Ga0207659_100070727 | 279 |
| 32 | 3300025933 | Ga0207706_10034868 | Ga0207706_100348684 | 279 |
| 33 | 3300025935 | Ga0207709_10005702 | Ga0207709_100057026 | 279 |
| 34 | 3300025938 | Ga0207704_10192667 | Ga0207704_101926672 | 279 |
| 35 | 3300025942 | Ga0207689_10143440 | Ga0207689_101434402 | 279 |
| 36 | 3300025945 | Ga0207679_10036597 | Ga0207679_100365972 | 279 |
| 37 | 3300026067 | Ga0207678_10014891 | Ga0207678_100148916 | 279 |
| 38 | 3300026075 | Ga0207708_10000292 | Ga0207708_1000029222 | 279 |
| 39 | 3300026089 | Ga0207648_10036679 | Ga0207648_100366795 | 279 |
| 40 | 3300026116 | Ga0207674_10220257 | Ga0207674_102202572 | 279 |
| 41 | 3300028381 | Ga0268264_10356264 | Ga0268264_103562642 | 279 |
| 42 | 3300038443 | Ga0395901_0354824 | Ga0395901_0354824_139_978 | 279 |
| 43 | 3300046455 | Ga0495603_0000098 | Ga0495603_0000098_6155_6994 | 279 |
| 44 | 3300046463 | Ga0495653_0053070 | Ga0495653_0053070_738_1577 | 279 |
| 45 | 3300046517 | Ga0495630_0001794 | Ga0495630_0001794_12487_13335 | 279 |
| 46 | 3300046517 | Ga0495630_0316283 | Ga0495630_0316283_61_909 | 279 |
| 47 | 3300046675 | Ga0495657_0042227 | Ga0495657_0042227_808_1656 | 279 |
| 48 | 3300047317 | Ga0495604_0000050 | Ga0495604_0000050_35565_36404 | 279 |
| 49 | 3300048910 | Ga0496107_0029056 | Ga0496107_0029056_2316_3158 | 279 |
| 50 | 3300048912 | Ga0496109_0012056 | Ga0496109_0012056_5308_6150 | 279 |
| 51 | 3300050494 | nmdc:mga06z11_11271_c1 | nmdc:mga06z11_11271_c1_1009_1851 | 279 |
| 52 | 3300050511 | nmdc:mga08y16_119659_c1 | nmdc:mga08y16_119659_c1_1626_2468 | 279 |
| 53 | 3300050515 | nmdc:mga0a205_1740_c1 | nmdc:mga0a205_1740_c1_14979_15818 | 279 |
| 54 | 3300053077 | Ga0495601_0011517 | Ga0495601_0011517_3141_3989 | 279 |
| 55 | 3300053085 | Ga0495619_0000084 | Ga0495619_0000084_3821_4660 | 279 |
| 56 | 3300001977 | JGI24746J21847_1003501 | JGI24746J21847_10035013 | 280 |
| 57 | 3300002074 | JGI24748J21848_1002276 | JGI24748J21848_10022762 | 280 |
| 58 | 3300002239 | JGI24034J26672_10000334 | JGI24034J26672_100003345 | 280 |
| 59 | 3300005328 | Ga0070676_10088607 | Ga0070676_100886072 | 280 |
| 60 | 3300005329 | Ga0070683_100038090 | Ga0070683_1000380904 | 280 |
| 61 | 3300005333 | Ga0070677_10000008 | Ga0070677_1000000829 | 280 |
| 62 | 3300005337 | Ga0070682_100000090 | Ga0070682_10000009048 | 280 |
| 63 | 3300005356 | Ga0070674_100000023 | Ga0070674_10000002349 | 280 |
| 64 | 3300005364 | Ga0070673_100003692 | Ga0070673_1000036927 | 280 |
| 65 | 3300005439 | Ga0070711_100018148 | Ga0070711_1000181484 | 280 |
| 66 | 3300005455 | Ga0070663_100115389 | Ga0070663_1001153892 | 280 |
| 67 | 3300005457 | Ga0070662_100000061 | Ga0070662_10000006114 | 280 |
| 68 | 3300005458 | Ga0070681_10011832 | Ga0070681_100118325 | 280 |
| 69 | 3300005458 | Ga0070681_10287008 | Ga0070681_102870081 | 280 |
| 70 | 3300005459 | Ga0068867_100001394 | Ga0068867_10000139412 | 280 |
| 71 | 3300005530 | Ga0070679_100000818 | Ga0070679_10000081814 | 280 |
| 72 | 3300005535 | Ga0070684_100005151 | Ga0070684_1000051516 | 280 |
| 73 | 3300005535 | Ga0070684_100026700 | Ga0070684_1000267005 | 280 |
| 74 | 3300005535 | Ga0070684_100253176 | Ga0070684_1002531762 | 280 |
| 75 | 3300005547 | Ga0070693_100000087 | Ga0070693_10000008733 | 280 |
| 76 | 3300005564 | Ga0070664_100057838 | Ga0070664_1000578383 | 280 |
| 77 | 3300005718 | Ga0068866_10000008 | Ga0068866_1000000873 | 280 |
| 78 | 3300005842 | Ga0068858_100000097 | Ga0068858_10000009764 | 280 |
| 79 | 3300005842 | Ga0068858_100000142 | Ga0068858_10000014216 | 280 |
| 80 | 3300005843 | Ga0068860_100009272 | Ga0068860_1000092723 | 280 |
| 81 | 3300005937 | Ga0081455_10023152 | Ga0081455_100231523 | 280 |
| 82 | 3300005983 | Ga0081540_1004933 | Ga0081540_10049337 | 280 |
| 83 | 3300005983 | Ga0081540_1024720 | Ga0081540_10247202 | 280 |
| 84 | 3300006038 | Ga0075365_10013880 | Ga0075365_100138805 | 280 |
| 85 | 3300006163 | Ga0070715_10000021 | Ga0070715_1000002151 | 280 |
| 86 | 3300006178 | Ga0075367_10210055 | Ga0075367_102100552 | 280 |
| 87 | 3300006852 | Ga0075433_10049682 | Ga0075433_100496822 | 280 |
| 88 | 3300009098 | Ga0105245_10000130 | Ga0105245_1000013030 | 280 |
| 89 | 3300009176 | Ga0105242_10079007 | Ga0105242_100790072 | 280 |
| 90 | 3300009551 | Ga0105238_10000055 | Ga0105238_1000005568 | 280 |
| 91 | 3300009553 | Ga0105249_10000143 | Ga0105249_1000014322 | 280 |
| 92 | 3300010375 | Ga0105239_10559488 | Ga0105239_105594882 | 280 |
| 93 | 3300011119 | Ga0105246_10428262 | Ga0105246_104282621 | 280 |
| 94 | 3300013104 | Ga0157370_10005384 | Ga0157370_100053847 | 280 |
| 95 | 3300013296 | Ga0157374_10005318 | Ga0157374_100053185 | 280 |
| 96 | 3300013296 | Ga0157374_10088352 | Ga0157374_100883522 | 280 |
| 97 | 3300014326 | Ga0157380_10002353 | Ga0157380_100023534 | 280 |
| 98 | 3300014968 | Ga0157379_10039546 | Ga0157379_100395462 | 280 |
| 99 | 3300025893 | Ga0207682_10005118 | Ga0207682_100051185 | 280 |
| 100 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002596 | 280 |
| 101 | 3300025905 | Ga0207685_10000028 | Ga0207685_1000002874 | 280 |
| 102 | 3300025912 | Ga0207707_10016527 | Ga0207707_100165274 | 280 |
| 103 | 3300025912 | Ga0207707_10220205 | Ga0207707_102202052 | 280 |
| 104 | 3300025915 | Ga0207693_10312266 | Ga0207693_103122662 | 280 |
| 105 | 3300025916 | Ga0207663_10000714 | Ga0207663_1000071415 | 280 |
| 106 | 3300025917 | Ga0207660_10152637 | Ga0207660_101526373 | 280 |
| 107 | 3300025921 | Ga0207652_10000827 | Ga0207652_1000082713 | 280 |
| 108 | 3300025924 | Ga0207694_10000063 | Ga0207694_1000006373 | 280 |
| 109 | 3300025927 | Ga0207687_10000032 | Ga0207687_1000003270 | 280 |
| 110 | 3300025927 | Ga0207687_10000073 | Ga0207687_1000007376 | 280 |
| 111 | 3300025932 | Ga0207690_10035629 | Ga0207690_100356291 | 280 |
| 112 | 3300025933 | Ga0207706_10000250 | Ga0207706_1000025051 | 280 |
| 113 | 3300025934 | Ga0207686_10120701 | Ga0207686_101207012 | 280 |
| 114 | 3300025937 | Ga0207669_10000026 | Ga0207669_1000002656 | 280 |
| 115 | 3300025944 | Ga0207661_10002261 | Ga0207661_100022616 | 280 |
| 116 | 3300025944 | Ga0207661_10038644 | Ga0207661_100386444 | 280 |
| 117 | 3300025960 | Ga0207651_10002447 | Ga0207651_100024476 | 280 |
| 118 | 3300025961 | Ga0207712_10000058 | Ga0207712_1000005873 | 280 |
| 119 | 3300026035 | Ga0207703_10000103 | Ga0207703_1000010375 | 280 |
| 120 | 3300026035 | Ga0207703_10000287 | Ga0207703_1000028710 | 280 |
| 121 | 3300026067 | Ga0207678_10148868 | Ga0207678_101488682 | 280 |
| 122 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016235 | 280 |
| 123 | 3300026089 | Ga0207648_10000960 | Ga0207648_1000096011 | 280 |
| 124 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056217 | 280 |
| 125 | 3300028381 | Ga0268264_10004866 | Ga0268264_100048669 | 280 |
| 126 | 3300035117 | Ga0373953_0128638 | Ga0373953_0128638_94_936 | 280 |
| 127 | 3300035172 | Ga0373955_0316061 | Ga0373955_0316061_81_926 | 280 |
| 128 | 3300035398 | Ga0316574_0286661 | Ga0316574_0286661_21_866 | 280 |
| 129 | 3300041512 | Ga0451853_0774009 | Ga0451853_0774009_752_1597 | 280 |
| 130 | 3300044694 | Ga0466963_0000008 | Ga0466963_0000008_11662_12507 | 280 |
| 131 | 3300044694 | Ga0466963_0017476 | Ga0466963_0017476_2230_3075 | 280 |
| 132 | 3300045976 | Ga0466967_0049105 | Ga0466967_0049105_281_1126 | 280 |
| 133 | 3300046454 | Ga0495592_0000261 | Ga0495592_0000261_19321_20166 | 280 |
| 134 | 3300046455 | Ga0495603_0001120 | Ga0495603_0001120_10516_11361 | 280 |
| 135 | 3300046455 | Ga0495603_0024158 | Ga0495603_0024158_166_1011 | 280 |
| 136 | 3300046461 | Ga0495641_0000312 | Ga0495641_0000312_23727_24572 | 280 |
| 137 | 3300046463 | Ga0495653_0036589 | Ga0495653_0036589_2128_2970 | 280 |
| 138 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_121071_121916 | 280 |
| 139 | 3300046476 | Ga0495662_0000071 | Ga0495662_0000071_15512_16357 | 280 |
| 140 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_159393_160292 | 280 |
| 141 | 3300046515 | Ga0495620_0000139 | Ga0495620_0000139_15765_16610 | 280 |
| 142 | 3300046516 | Ga0495628_0038848 | Ga0495628_0038848_2022_2864 | 280 |
| 143 | 3300046516 | Ga0495628_0152847 | Ga0495628_0152847_418_1263 | 280 |
| 144 | 3300046517 | Ga0495630_0001844 | Ga0495630_0001844_2803_3648 | 280 |
| 145 | 3300046523 | Ga0495644_0000377 | Ga0495644_0000377_3860_4705 | 280 |
| 146 | 3300046535 | Ga0495586_0019076 | Ga0495586_0019076_934_1779 | 280 |
| 147 | 3300046615 | Ga0495656_0001564 | Ga0495656_0001564_4621_5472 | 280 |
| 148 | 3300046642 | Ga0495634_0000293 | Ga0495634_0000293_40204_41049 | 280 |
| 149 | 3300046642 | Ga0495634_0071352 | Ga0495634_0071352_753_1598 | 280 |
| 150 | 3300046675 | Ga0495657_0029983 | Ga0495657_0029983_219_1064 | 280 |
| 151 | 3300046678 | Ga0495599_0009974 | Ga0495599_0009974_2061_2906 | 280 |
| 152 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_153577_154422 | 280 |
| 153 | 3300046681 | Ga0495647_0000851 | Ga0495647_0000851_5203_6048 | 280 |
| 154 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_244677_245522 | 280 |
| 155 | 3300046683 | Ga0495658_0200772 | Ga0495658_0200772_49_894 | 280 |
| 156 | 3300046684 | Ga0495669_0000779 | Ga0495669_0000779_10514_11359 | 280 |
| 157 | 3300046689 | Ga0495613_0076918 | Ga0495613_0076918_884_1729 | 280 |
| 158 | 3300046690 | Ga0495624_0000724 | Ga0495624_0000724_12700_13545 | 280 |
| 159 | 3300046691 | Ga0495670_0012182 | Ga0495670_0012182_1951_2796 | 280 |
| 160 | 3300046694 | Ga0495649_0005501 | Ga0495649_0005501_5967_6812 | 280 |
| 161 | 3300046809 | Ga0495600_0000420 | Ga0495600_0000420_836_1735 | 280 |
| 162 | 3300046809 | Ga0495600_0086832 | Ga0495600_0086832_642_1487 | 280 |
| 163 | 3300047317 | Ga0495604_0046063 | Ga0495604_0046063_1224_2069 | 280 |
| 164 | 3300047322 | Ga0495680_0000241 | Ga0495680_0000241_42211_43056 | 280 |
| 165 | 3300047322 | Ga0495680_0005092 | Ga0495680_0005092_9371_10216 | 280 |
| 166 | 3300047673 | Ga0495593_0058082 | Ga0495593_0058082_1105_1950 | 280 |
| 167 | 3300048088 | Ga0495602_0098244 | Ga0495602_0098244_611_1468 | 280 |
| 168 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_110883_111728 | 280 |
| 169 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_110883_111728 | 280 |
| 170 | 3300048909 | Ga0496106_0000062 | Ga0496106_0000062_19415_20260 | 280 |
| 171 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_82032_82877 | 280 |
| 172 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_295204_296049 | 280 |
| 173 | 3300048911 | Ga0496108_0000055 | Ga0496108_0000055_123998_124840 | 280 |
| 174 | 3300048911 | Ga0496108_0019061 | Ga0496108_0019061_2891_3736 | 280 |
| 175 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_62292_63137 | 280 |
| 176 | 3300048912 | Ga0496109_0000043 | Ga0496109_0000043_129373_130215 | 280 |
| 177 | 3300048912 | Ga0496109_0481517 | Ga0496109_0481517_118_960 | 280 |
| 178 | 3300048913 | Ga0496110_0019787 | Ga0496110_0019787_4110_4955 | 280 |
| 179 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_67424_68269 | 280 |
| 180 | 3300048915 | Ga0496112_0506670 | Ga0496112_0506670_252_1094 | 280 |
| 181 | 3300048916 | Ga0496113_0008602 | Ga0496113_0008602_1713_2558 | 280 |
| 182 | 3300048916 | Ga0496113_0010725 | Ga0496113_0010725_4741_5583 | 280 |
| 183 | 3300048928 | Ga0496125_0064283 | Ga0496125_0064283_2016_2861 | 280 |
| 184 | 3300049571 | Ga0501034_0027919 | Ga0501034_0027919_2663_3505 | 280 |
| 185 | 3300049579 | Ga0501043_0345709 | Ga0501043_0345709_97_939 | 280 |
| 186 | 3300049581 | Ga0501047_0063594 | Ga0501047_0063594_2358_3200 | 280 |
| 187 | 3300049586 | Ga0501070_0058602 | Ga0501070_0058602_1007_1867 | 280 |
| 188 | 3300049591 | Ga0501075_0001540 | Ga0501075_0001540_5562_6425 | 280 |
| 189 | 3300049742 | Ga0501080_0039572 | Ga0501080_0039572_2679_3539 | 280 |
| 190 | 3300049744 | Ga0501083_0167614 | Ga0501083_0167614_338_1198 | 280 |
| 191 | 3300049823 | Ga0501044_0069060 | Ga0501044_0069060_517_1359 | 280 |
| 192 | 3300050490 | nmdc:mga03n38_143128_c1 | nmdc:mga03n38_143128_c1_324_1169 | 280 |
| 193 | 3300050492 | nmdc:mga0yw44_164848_c1 | nmdc:mga0yw44_164848_c1_476_1348 | 280 |
| 194 | 3300050494 | nmdc:mga06z11_196344_c1 | nmdc:mga06z11_196344_c1_181_1026 | 280 |
| 195 | 3300050515 | nmdc:mga0a205_113_c1 | nmdc:mga0a205_113_c1_3496_4338 | 280 |
| 196 | 3300053078 | Ga0495612_0004920 | Ga0495612_0004920_3370_4215 | 280 |
| 197 | 3300053084 | Ga0495595_0107448 | Ga0495595_0107448_144_986 | 280 |
| 198 | 3300053085 | Ga0495619_0010813 | Ga0495619_0010813_136_990 | 280 |
| 199 | 3300053123 | Ga0500614_000152 | Ga0500614_000152_12952_13797 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d13-assembly1.cif.gz_A | crystal structure of e.coli rpph-dapf complex | 0.9429 | 1 | 269 |
| 5ha4-assembly1.cif.gz_A | structure of a diaminopimelate epimerase from acinetobacter baumannii | 0.9249 | 1 | 276 |
| 4ik0-assembly1.cif.gz_A | crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli | 0.9247 | 1 | 269 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.9236 | 1 | 266 |
| 6d13-assembly1.cif.gz_A | crystal structure of e.coli rpph-dapf complex | 0.9198 | 1 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9269 | 146 | 256 | 3.10.310.10 |
| af_C6T990_209_343_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9253 | 131 | 251 | 3.10.310.10 |
| af_P0A6K1_1_112_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9188 | 3 | 111 | 3.10.310.10 |
| 2q9jA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8995 | 1 | 107 | 3.10.310.10 |
| af_Q58519_1_127_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8929 | 3 | 119 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K0RYG3-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9878 | 1 | 278 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A7V9LHP2-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.9837 | 70 | 278 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A7K0RYG3-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9773 | 1 | 278 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A6B3KCV1-F1-model_v4 | deleted | 0.9727 | 101 | 226 |
|
| AF-A0A7V9CFL2-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.9705 | 1 | 244 |
GO:0005829
GO:0008837 GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar