F305337

General Info

Members Datasets Scaffolds Average Seq Length
199 136 192 222

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100012605|Ga0070683_1000126054
Length 240
Sequence MHHHVDPHTSARRDTQGAVIEPRIILLEDDDELRSIVGRGLREEGFAVSMAGSAAELVRQVDAGDFDALIIDIGLPDADGRDVVQALRARGIGTPVIFLTARDALPDRLAGFASGGDDYLTKPFHFAELVARLQALIKRGGSETAIEAGGLRLDPRSHDASCGSRNVKLTPTEFRILARLGAAPGDAVRRRDLVRAAWPHGAIVHDNTLDVYIARLRRKLATLPNTPGIVTMHGVGYSLR

Samples

Sample ID Description Type Environment
1 2643221585 Pelomonas sp. Root662 Isolate Unclassified
2 2643221656 Pelomonas sp. Root405 Isolate Unclassified
3 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
4 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
5 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
6 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
135 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
136 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0.5
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 19.6
Rhizosphere 75.88
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10083378 3300003322 Bacteria 3899
2 Ga0070658_10071380 3300005327 Bacteria 2844
3 Ga0070683_100006811 3300005329 Bacteria 9602
4 Ga0070683_100012605 3300005329 Bacteria 7350
5 Ga0070683_100414103 3300005329 Bacteria 1285
6 Ga0070690_100340825 3300005330 Bacteria 1085
7 Ga0070666_10481279 3300005335 Bacteria 899
8 Ga0070680_100041038 3300005336 Bacteria 3751
9 Ga0070682_100010956 3300005337 Bacteria 5167
10 Ga0068868_100341321 3300005338 Bacteria 1281
11 Ga0070661_100031500 3300005344 Bacteria 3836
12 Ga0070668_100093266 3300005347 Bacteria 2376
13 Ga0070669_100295287 3300005353 Bacteria 1302
14 Ga0070671_100209740 3300005355 Bacteria 1652
15 Ga0070674_100502852 3300005356 Bacteria 1010
16 Ga0070688_100431629 3300005365 Bacteria 981
17 Ga0070659_100038160 3300005366 Bacteria 3746
18 Ga0070705_100467357 3300005440 Bacteria 950
19 Ga0070694_100326820 3300005444 Bacteria 1182
20 Ga0070678_100094187 3300005456 Bacteria 2305
21 Ga0070678_100755817 3300005456 Bacteria 880
22 Ga0070681_10014437 3300005458 Bacteria 7862
23 Ga0070685_10402967 3300005466 Bacteria 948
24 Ga0070706_100320413 3300005467 Bacteria 1446
25 Ga0070706_100413787 3300005467 Bacteria 1255
26 Ga0070698_100456160 3300005471 Bacteria 1214
27 Ga0070699_100047600 3300005518 Bacteria 3710
28 Ga0070679_100003690 3300005530 Bacteria 14024
29 Ga0070684_100005728 3300005535 Bacteria 9545
30 Ga0070684_100010364 3300005535 Bacteria 7380
31 Ga0070684_100275079 3300005535 Bacteria 1542
32 Ga0070695_100226090 3300005545 Bacteria 1350
33 Ga0070665_100220690 3300005548 Bacteria 1896
34 Ga0070665_100469997 3300005548 Bacteria 1268
35 Ga0070704_100036281 3300005549 Bacteria 3359
36 Ga0070704_100251911 3300005549 Bacteria 1451
37 Ga0070704_100468368 3300005549 Bacteria 1088
38 Ga0070664_100036600 3300005564 Bacteria 4123
39 Ga0070664_100267929 3300005564 Bacteria 1538
40 Ga0068857_100013926 3300005577 Bacteria 7000
41 Ga0068854_100189472 3300005578 Bacteria 1611
42 Ga0068854_100845006 3300005578 Bacteria 801
43 Ga0070702_100089391 3300005615 Bacteria 1864
44 Ga0070702_100166912 3300005615 Bacteria 1428
45 Ga0070702_100333768 3300005615 Bacteria 1061
46 Ga0068852_100195985 3300005616 Bacteria 1909
47 Ga0068859_100603206 3300005617 Bacteria 1191
48 Ga0068864_100800405 3300005618 Bacteria 926
49 Ga0068866_10092659 3300005718 Bacteria 1649
50 Ga0068866_10166239 3300005718 Bacteria 1291
51 Ga0068851_10367601 3300005834 Bacteria 840
52 Ga0068858_100636524 3300005842 Bacteria 1036
53 Ga0070717_10001126 3300006028 Bacteria 18082
54 Ga0070716_100129471 3300006173 Bacteria 1593
55 Ga0075433_10031625 3300006852 Bacteria 4525
56 Ga0075433_10150419 3300006852 Bacteria 2071
57 Ga0075433_10186739 3300006852 Bacteria 1844
58 Ga0075434_100000917 3300006871 Bacteria 23637
59 Ga0075434_100001960 3300006871 Bacteria 17843
60 Ga0075434_100005318 3300006871 Bacteria 11710
61 Ga0068865_100155368 3300006881 Bacteria 1740
62 Ga0075436_100110550 3300006914 Bacteria 1918
63 Ga0097620_100603149 3300006931 Bacteria 1191
64 Ga0075435_100014811 3300007076 Bacteria 5845
65 Ga0111539_10045561 3300009094 Bacteria 5249
66 Ga0111539_10079107 3300009094 Bacteria 3867
67 Ga0105245_10225767 3300009098 Bacteria 1809
68 Ga0105245_10292065 3300009098 Bacteria 1597
69 Ga0105245_10537252 3300009098 Bacteria 1190
70 Ga0105245_10673078 3300009098 Bacteria 1066
71 Ga0114129_11324151 3300009147 Bacteria 892
72 Ga0105243_10170215 3300009148 Bacteria 1886
73 Ga0105243_10499743 3300009148 Bacteria 1152
74 Ga0105242_11054098 3300009176 Bacteria 824
75 Ga0105238_10453462 3300009551 Bacteria 1279
76 Ga0105249_10323617 3300009553 Bacteria 1554
77 Ga0105239_10272889 3300010375 Bacteria 1902
78 Ga0105239_10525468 3300010375 Bacteria 1346
79 Ga0105246_10273970 3300011119 Bacteria 1350
80 Ga0105246_10518656 3300011119 Bacteria 1015
81 Ga0157370_10052475 3300013104 Bacteria 3893
82 Ga0157370_10194279 3300013104 Bacteria 1884
83 Ga0157369_10026536 3300013105 Bacteria 6425
84 Ga0163162_10855478 3300013306 Bacteria 1024
85 Ga0157372_10028469 3300013307 Bacteria 6098
86 Ga0157372_10887952 3300013307 Bacteria 1034
87 Ga0157375_10568467 3300013308 Bacteria 1294
88 Ga0163163_10552615 3300014325 Bacteria 1214
89 Ga0157377_10005953 3300014745 Bacteria 5775
90 Ga0157376_10213998 3300014969 Bacteria 1781
91 Ga0206353_10777530 3300020082 Bacteria 2458
92 Ga0213876_10068994 3300021384 Bacteria 1867
93 Ga0207642_10287512 3300025899 Bacteria 948
94 Ga0207643_10141588 3300025908 Bacteria 1437
95 Ga0207705_10165048 3300025909 Bacteria 1665
96 Ga0207684_10092343 3300025910 Bacteria 2580
97 Ga0207693_10250343 3300025915 Bacteria 1390
98 Ga0207660_10054268 3300025917 Bacteria 2859
99 Ga0207652_10019791 3300025921 Bacteria 5541
100 Ga0207694_10376371 3300025924 Bacteria 1178
101 Ga0207687_10604711 3300025927 Bacteria 924
102 Ga0207687_10799444 3300025927 Bacteria 804
103 Ga0207664_10400872 3300025929 Bacteria 1220
104 Ga0207690_10144300 3300025932 Bacteria 1758
105 Ga0207686_10257977 3300025934 Bacteria 1277
106 Ga0207709_10417677 3300025935 Bacteria 1029
107 Ga0207665_10151875 3300025939 Bacteria 1659
108 Ga0207661_10002945 3300025944 Bacteria 11781
109 Ga0207661_10011267 3300025944 Bacteria 6471
110 Ga0207661_10567429 3300025944 Bacteria 1040
111 Ga0207703_10275208 3300026035 Bacteria 1527
112 Ga0207674_10022132 3300026116 Bacteria 6833
113 Ga0207683_10180017 3300026121 Bacteria 1916
114 Ga0207698_10518144 3300026142 Bacteria 1163
115 Ga0207698_10612097 3300026142 Bacteria 1075
116 Ga0207428_10228937 3300027907 Bacteria 1391
117 Ga0268266_10291952 3300028379 Bacteria 1519
118 Ga0316575_10094954 3300031665 Bacteria 1210
119 Ga0316576_10004898 3300031727 Bacteria 8098
120 Ga0373962_0015298 3300035242 Bacteria 1966
121 Ga0316574_0149946 3300035398 Bacteria 1503
122 Ga0373937_1000609 3300036401 Bacteria 785
123 Ga0316584_0387471 3300036712 Bacteria 998
124 Ga0395900_0106645 3300037418 Bacteria 2878
125 Ga0395900_0344041 3300037418 Bacteria 1466
126 Ga0395898_0004999 3300037466 Bacteria 14384
127 Ga0395898_0027056 3300037466 Bacteria 5762
128 Ga0395901_0073289 3300038443 Bacteria 3571
129 Ga0395901_0150872 3300038443 Bacteria 2442
130 Ga0436365_0909604 3300039437 Bacteria 38171
131 Ga0451853_3065457 3300041512 Bacteria 9061
132 Ga0466961_0277658 3300044693 Bacteria 1026
133 Ga0466967_0010095 3300045976 Bacteria 7058
134 Ga0466967_0958261 3300045976 Bacteria 851
135 Ga0495603_0037289 3300046455 Bacteria 2917
136 Ga0495582_0091210 3300046473 Bacteria 1699
137 Ga0495599_0575736 3300046678 Bacteria 657
138 Ga0495649_0276626 3300046694 Bacteria 858
139 Ga0495676_0336868 3300047321 Bacteria 1011
140 Ga0495685_001853 3300047447 Bacteria 6540
141 Ga0496100_0014549 3300048903 Bacteria 4570
142 Ga0496100_0017228 3300048903 Bacteria 4261
143 Ga0496101_0011343 3300048904 Bacteria 5910
144 Ga0496101_0030662 3300048904 Bacteria 3773
145 Ga0496101_0280397 3300048904 Bacteria 1302
146 Ga0496101_0423996 3300048904 Bacteria 1049
147 Ga0496102_0005015 3300048905 Bacteria 11209
148 Ga0496102_0030353 3300048905 Bacteria 4838
149 Ga0496102_0185471 3300048905 Bacteria 1961
150 Ga0496102_0817133 3300048905 Bacteria 854
151 Ga0496103_0412042 3300048906 Bacteria 868
152 Ga0496104_0226412 3300048907 Bacteria 1782
153 Ga0496104_0523421 3300048907 Bacteria 1097
154 Ga0496105_0145225 3300048908 Bacteria 1951
155 Ga0496105_0288777 3300048908 Bacteria 1321
156 Ga0496106_0000253 3300048909 Bacteria 37605
157 Ga0496106_0007033 3300048909 Bacteria 8310
158 Ga0496107_0004575 3300048910 Bacteria 9377
159 Ga0496107_0605163 3300048910 Bacteria 810
160 Ga0496108_0042391 3300048911 Bacteria 3799
161 Ga0496108_0049807 3300048911 Bacteria 3504
162 Ga0496109_0026532 3300048912 Bacteria 5167
163 Ga0496109_0063860 3300048912 Bacteria 3368
164 Ga0496109_0201689 3300048912 Bacteria 1870
165 Ga0496109_0246013 3300048912 Bacteria 1684
166 Ga0496109_0343896 3300048912 Bacteria 1409
167 Ga0496109_0362500 3300048912 Bacteria 1369
168 Ga0496110_0049718 3300048913 Bacteria 3679
169 Ga0496110_0232378 3300048913 Bacteria 1677
170 Ga0496111_0105415 3300048914 Bacteria 2074
171 Ga0496112_0122828 3300048915 Bacteria 2567
172 Ga0496112_0129556 3300048915 Bacteria 2494
173 Ga0496113_0036977 3300048916 Bacteria 3580
174 Ga0496114_0001863 3300048917 Bacteria 15983
175 Ga0496114_0018714 3300048917 Bacteria 5604
176 Ga0496114_0304965 3300048917 Bacteria 1406
177 Ga0496114_0332978 3300048917 Bacteria 1342
178 Ga0496114_0579877 3300048917 Bacteria 990
179 Ga0496115_0475643 3300048918 Bacteria 1006
180 Ga0501034_0099644 3300049571 Bacteria 2900
181 nmdc:mga08y16_79132_c1 3300050511 Bacteria 3426
182 nmdc:mga08y16_91933_c1 3300050511 Bacteria 3162
183 nmdc:mga0n895_41300_c1 3300050512 Bacteria 4483
184 nmdc:mga0n895_5290_c1 3300050512 Bacteria 10750
185 nmdc:mga0n895_85344_c1 3300050512 Bacteria 3152
186 nmdc:mga0rr50_1211806_c1 3300050513 Bacteria 641
187 nmdc:mga0rr50_41961_c1 3300050513 Bacteria 3338
188 nmdc:mga08x19_99045_c1 3300050514 Bacteria 1932
189 nmdc:mga0a205_15299_c1 3300050515 Bacteria 7168
190 nmdc:mga0a205_39384_c1 3300050515 Bacteria 4549
191 Ga0495655_0063600 3300053083 Bacteria 1013
192 Ga0500568_0010550 3300053139 Bacteria 4318

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0575736 Ga0495599_0575736_68_643 190
2 3300050513 nmdc:mga0rr50_1211806_c1 nmdc:mga0rr50_1211806_c1_14_616 199
3 3300005467 Ga0070706_100320413 Ga0070706_1003204132 203
4 3300025910 Ga0207684_10092343 Ga0207684_100923432 203
5 3300037418 Ga0395900_0106645 Ga0395900_0106645_857_1522 205
6 3300037466 Ga0395898_0004999 Ga0395898_0004999_1257_1922 205
7 3300038443 Ga0395901_0073289 Ga0395901_0073289_1948_2613 205
8 3300006028 Ga0070717_10001126 Ga0070717_100011269 207
9 3300048906 Ga0496103_0412042 Ga0496103_0412042_50_718 207
10 3300048911 Ga0496108_0049807 Ga0496108_0049807_1601_2269 207
11 3300020082 Ga0206353_10777530 Ga0206353_107775303 211
12 iso_pu_bacteria 2643221585 2643934015 214
13 iso_pu_bacteria 2643221656 2644315502 214
14 3300047321 Ga0495676_0336868 Ga0495676_0336868_202_852 215
15 3300027907 Ga0207428_10228937 Ga0207428_102289373 216
16 iso_pu_bacteria 2784746768 2785373865 216
17 iso_pu_bacteria 2877676314 2877677051 216
18 iso_pu_bacteria 2912723979 2912730942 216
19 iso_pu_bacteria 8056829672 8056834788 216
20 3300005327 Ga0070658_10071380 Ga0070658_100713801 217
21 3300025909 Ga0207705_10165048 Ga0207705_101650482 217
22 iso_pu_bacteria 2799112218 2799185678 217
23 3300037418 Ga0395900_0344041 Ga0395900_0344041_326_985 218
24 3300038443 Ga0395901_0150872 Ga0395901_0150872_417_1076 218
25 3300044693 Ga0466961_0277658 Ga0466961_0277658_156_821 218
26 3300005329 Ga0070683_100414103 Ga0070683_1004141031 219
27 3300005330 Ga0070690_100340825 Ga0070690_1003408251 219
28 3300005335 Ga0070666_10481279 Ga0070666_104812791 219
29 3300005338 Ga0068868_100341321 Ga0068868_1003413212 219
30 3300005347 Ga0070668_100093266 Ga0070668_1000932662 219
31 3300005353 Ga0070669_100295287 Ga0070669_1002952872 219
32 3300005355 Ga0070671_100209740 Ga0070671_1002097402 219
33 3300005440 Ga0070705_100467357 Ga0070705_1004673572 219
34 3300005444 Ga0070694_100326820 Ga0070694_1003268202 219
35 3300005456 Ga0070678_100094187 Ga0070678_1000941873 219
36 3300005471 Ga0070698_100456160 Ga0070698_1004561602 219
37 3300005545 Ga0070695_100226090 Ga0070695_1002260902 219
38 3300005548 Ga0070665_100469997 Ga0070665_1004699972 219
39 3300005549 Ga0070704_100251911 Ga0070704_1002519112 219
40 3300005615 Ga0070702_100089391 Ga0070702_1000893912 219
41 3300005615 Ga0070702_100333768 Ga0070702_1003337682 219
42 3300005842 Ga0068858_100636524 Ga0068858_1006365242 219
43 3300006173 Ga0070716_100129471 Ga0070716_1001294712 219
44 3300006852 Ga0075433_10031625 Ga0075433_100316252 219
45 3300006852 Ga0075433_10150419 Ga0075433_101504192 219
46 3300006852 Ga0075433_10186739 Ga0075433_101867392 219
47 3300006871 Ga0075434_100000917 Ga0075434_10000091722 219
48 3300006871 Ga0075434_100001960 Ga0075434_1000019604 219
49 3300006871 Ga0075434_100005318 Ga0075434_1000053187 219
50 3300006881 Ga0068865_100155368 Ga0068865_1001553682 219
51 3300006914 Ga0075436_100110550 Ga0075436_1001105502 219
52 3300007076 Ga0075435_100014811 Ga0075435_1000148112 219
53 3300009094 Ga0111539_10079107 Ga0111539_100791072 219
54 3300009098 Ga0105245_10292065 Ga0105245_102920652 219
55 3300009098 Ga0105245_10537252 Ga0105245_105372521 219
56 3300009147 Ga0114129_11324151 Ga0114129_113241511 219
57 3300009553 Ga0105249_10323617 Ga0105249_103236172 219
58 3300013104 Ga0157370_10052475 Ga0157370_100524754 219
59 3300013306 Ga0163162_10855478 Ga0163162_108554781 219
60 3300013307 Ga0157372_10887952 Ga0157372_108879522 219
61 3300025899 Ga0207642_10287512 Ga0207642_102875122 219
62 3300025934 Ga0207686_10257977 Ga0207686_102579772 219
63 3300025939 Ga0207665_10151875 Ga0207665_101518752 219
64 3300025944 Ga0207661_10567429 Ga0207661_105674292 219
65 3300026035 Ga0207703_10275208 Ga0207703_102752082 219
66 3300028379 Ga0268266_10291952 Ga0268266_102919522 219
67 3300035242 Ga0373962_0015298 Ga0373962_0015298_204_869 219
68 3300048903 Ga0496100_0014549 Ga0496100_0014549_534_1199 219
69 3300048903 Ga0496100_0017228 Ga0496100_0017228_2459_3121 219
70 3300048904 Ga0496101_0011343 Ga0496101_0011343_2520_3182 219
71 3300048904 Ga0496101_0030662 Ga0496101_0030662_788_1453 219
72 3300048905 Ga0496102_0005015 Ga0496102_0005015_7881_8543 219
73 3300048905 Ga0496102_0030353 Ga0496102_0030353_669_1334 219
74 3300048905 Ga0496102_0185471 Ga0496102_0185471_1149_1814 219
75 3300048907 Ga0496104_0226412 Ga0496104_0226412_108_773 219
76 3300048907 Ga0496104_0523421 Ga0496104_0523421_360_1025 219
77 3300048908 Ga0496105_0145225 Ga0496105_0145225_1221_1886 219
78 3300048909 Ga0496106_0000253 Ga0496106_0000253_16783_17445 219
79 3300048909 Ga0496106_0007033 Ga0496106_0007033_3358_4023 219
80 3300048910 Ga0496107_0004575 Ga0496107_0004575_3106_3768 219
81 3300048912 Ga0496109_0063860 Ga0496109_0063860_2673_3338 219
82 3300048915 Ga0496112_0129556 Ga0496112_0129556_1523_2188 219
83 3300048917 Ga0496114_0001863 Ga0496114_0001863_10924_11586 219
84 3300048917 Ga0496114_0018714 Ga0496114_0018714_3506_4171 219
85 3300048917 Ga0496114_0579877 Ga0496114_0579877_46_711 219
86 3300048918 Ga0496115_0475643 Ga0496115_0475643_307_972 219
87 3300050511 nmdc:mga08y16_91933_c1 nmdc:mga08y16_91933_c1_2281_2946 219
88 3300050512 nmdc:mga0n895_41300_c1 nmdc:mga0n895_41300_c1_2408_3073 219
89 3300050512 nmdc:mga0n895_85344_c1 nmdc:mga0n895_85344_c1_400_1065 219
90 3300050513 nmdc:mga0rr50_41961_c1 nmdc:mga0rr50_41961_c1_2071_2736 219
91 3300050514 nmdc:mga08x19_99045_c1 nmdc:mga08x19_99045_c1_1137_1802 219
92 3300050515 nmdc:mga0a205_15299_c1 nmdc:mga0a205_15299_c1_4826_5491 219
93 3300053139 Ga0500568_0010550 Ga0500568_0010550_1294_1974 219
94 3300003322 rootL2_10083378 rootL2_100833783 220
95 3300005329 Ga0070683_100006811 Ga0070683_1000068116 220
96 3300005329 Ga0070683_100012605 Ga0070683_1000126054 220
97 3300005336 Ga0070680_100041038 Ga0070680_1000410382 220
98 3300005337 Ga0070682_100010956 Ga0070682_1000109566 220
99 3300005344 Ga0070661_100031500 Ga0070661_1000315002 220
100 3300005356 Ga0070674_100502852 Ga0070674_1005028521 220
101 3300005365 Ga0070688_100431629 Ga0070688_1004316291 220
102 3300005366 Ga0070659_100038160 Ga0070659_1000381602 220
103 3300005456 Ga0070678_100755817 Ga0070678_1007558171 220
104 3300005458 Ga0070681_10014437 Ga0070681_100144375 220
105 3300005466 Ga0070685_10402967 Ga0070685_104029672 220
106 3300005467 Ga0070706_100413787 Ga0070706_1004137872 220
107 3300005518 Ga0070699_100047600 Ga0070699_1000476004 220
108 3300005530 Ga0070679_100003690 Ga0070679_1000036903 220
109 3300005535 Ga0070684_100005728 Ga0070684_1000057289 220
110 3300005535 Ga0070684_100010364 Ga0070684_1000103645 220
111 3300005535 Ga0070684_100275079 Ga0070684_1002750792 220
112 3300005548 Ga0070665_100220690 Ga0070665_1002206901 220
113 3300005549 Ga0070704_100036281 Ga0070704_1000362813 220
114 3300005549 Ga0070704_100468368 Ga0070704_1004683682 220
115 3300005564 Ga0070664_100036600 Ga0070664_1000366002 220
116 3300005564 Ga0070664_100267929 Ga0070664_1002679292 220
117 3300005577 Ga0068857_100013926 Ga0068857_1000139266 220
118 3300005578 Ga0068854_100189472 Ga0068854_1001894722 220
119 3300005578 Ga0068854_100845006 Ga0068854_1008450062 220
120 3300005615 Ga0070702_100166912 Ga0070702_1001669122 220
121 3300005616 Ga0068852_100195985 Ga0068852_1001959852 220
122 3300005617 Ga0068859_100603206 Ga0068859_1006032062 220
123 3300005618 Ga0068864_100800405 Ga0068864_1008004051 220
124 3300005718 Ga0068866_10092659 Ga0068866_100926592 220
125 3300005718 Ga0068866_10166239 Ga0068866_101662392 220
126 3300005834 Ga0068851_10367601 Ga0068851_103676012 220
127 3300006931 Ga0097620_100603149 Ga0097620_1006031492 220
128 3300009094 Ga0111539_10045561 Ga0111539_100455614 220
129 3300009098 Ga0105245_10225767 Ga0105245_102257671 220
130 3300009098 Ga0105245_10673078 Ga0105245_106730781 220
131 3300009148 Ga0105243_10170215 Ga0105243_101702151 220
132 3300009148 Ga0105243_10499743 Ga0105243_104997432 220
133 3300009176 Ga0105242_11054098 Ga0105242_110540981 220
134 3300009551 Ga0105238_10453462 Ga0105238_104534622 220
135 3300010375 Ga0105239_10272889 Ga0105239_102728892 220
136 3300010375 Ga0105239_10525468 Ga0105239_105254682 220
137 3300011119 Ga0105246_10273970 Ga0105246_102739702 220
138 3300011119 Ga0105246_10518656 Ga0105246_105186561 220
139 3300013104 Ga0157370_10194279 Ga0157370_101942792 220
140 3300013105 Ga0157369_10026536 Ga0157369_100265366 220
141 3300013307 Ga0157372_10028469 Ga0157372_100284693 220
142 3300013308 Ga0157375_10568467 Ga0157375_105684672 220
143 3300014325 Ga0163163_10552615 Ga0163163_105526152 220
144 3300014745 Ga0157377_10005953 Ga0157377_100059536 220
145 3300014969 Ga0157376_10213998 Ga0157376_102139982 220
146 3300021384 Ga0213876_10068994 Ga0213876_100689942 220
147 3300025908 Ga0207643_10141588 Ga0207643_101415882 220
148 3300025915 Ga0207693_10250343 Ga0207693_102503432 220
149 3300025917 Ga0207660_10054268 Ga0207660_100542682 220
150 3300025921 Ga0207652_10019791 Ga0207652_100197914 220
151 3300025924 Ga0207694_10376371 Ga0207694_103763712 220
152 3300025927 Ga0207687_10604711 Ga0207687_106047112 220
153 3300025927 Ga0207687_10799444 Ga0207687_107994441 220
154 3300025929 Ga0207664_10400872 Ga0207664_104008722 220
155 3300025932 Ga0207690_10144300 Ga0207690_101443002 220
156 3300025935 Ga0207709_10417677 Ga0207709_104176772 220
157 3300025944 Ga0207661_10002945 Ga0207661_100029457 220
158 3300025944 Ga0207661_10011267 Ga0207661_100112676 220
159 3300026116 Ga0207674_10022132 Ga0207674_100221326 220
160 3300026121 Ga0207683_10180017 Ga0207683_101800171 220
161 3300026142 Ga0207698_10518144 Ga0207698_105181442 220
162 3300026142 Ga0207698_10612097 Ga0207698_106120972 220
163 3300031665 Ga0316575_10094954 Ga0316575_100949541 220
164 3300031727 Ga0316576_10004898 Ga0316576_100048984 220
165 3300035398 Ga0316574_0149946 Ga0316574_0149946_664_1389 220
166 3300036401 Ga0373937_1000609 Ga0373937_1000609_17_688 220
167 3300036712 Ga0316584_0387471 Ga0316584_0387471_230_898 220
168 3300037466 Ga0395898_0027056 Ga0395898_0027056_1544_2206 220
169 3300039437 Ga0436365_0909604 Ga0436365_0909604_28857_29525 220
170 3300041512 Ga0451853_3065457 Ga0451853_3065457_8088_8750 220
171 3300045976 Ga0466967_0010095 Ga0466967_0010095_479_1147 220
172 3300045976 Ga0466967_0958261 Ga0466967_0958261_19_681 220
173 3300046455 Ga0495603_0037289 Ga0495603_0037289_2088_2756 220
174 3300046473 Ga0495582_0091210 Ga0495582_0091210_863_1531 220
175 3300046694 Ga0495649_0276626 Ga0495649_0276626_36_698 220
176 3300047447 Ga0495685_001853 Ga0495685_001853_1027_1689 220
177 3300048904 Ga0496101_0280397 Ga0496101_0280397_115_783 220
178 3300048904 Ga0496101_0423996 Ga0496101_0423996_86_754 220
179 3300048905 Ga0496102_0817133 Ga0496102_0817133_71_739 220
180 3300048908 Ga0496105_0288777 Ga0496105_0288777_403_1071 220
181 3300048910 Ga0496107_0605163 Ga0496107_0605163_69_740 220
182 3300048911 Ga0496108_0042391 Ga0496108_0042391_250_918 220
183 3300048912 Ga0496109_0026532 Ga0496109_0026532_2987_3655 220
184 3300048912 Ga0496109_0201689 Ga0496109_0201689_690_1358 220
185 3300048912 Ga0496109_0246013 Ga0496109_0246013_622_1290 220
186 3300048912 Ga0496109_0343896 Ga0496109_0343896_461_1129 220
187 3300048912 Ga0496109_0362500 Ga0496109_0362500_333_1001 220
188 3300048913 Ga0496110_0049718 Ga0496110_0049718_851_1519 220
189 3300048913 Ga0496110_0232378 Ga0496110_0232378_479_1147 220
190 3300048914 Ga0496111_0105415 Ga0496111_0105415_1344_2012 220
191 3300048915 Ga0496112_0122828 Ga0496112_0122828_1836_2504 220
192 3300048916 Ga0496113_0036977 Ga0496113_0036977_56_724 220
193 3300048917 Ga0496114_0304965 Ga0496114_0304965_81_749 220
194 3300048917 Ga0496114_0332978 Ga0496114_0332978_129_797 220
195 3300049571 Ga0501034_0099644 Ga0501034_0099644_540_1217 220
196 3300050511 nmdc:mga08y16_79132_c1 nmdc:mga08y16_79132_c1_1606_2274 220
197 3300050512 nmdc:mga0n895_5290_c1 nmdc:mga0n895_5290_c1_6239_6907 220
198 3300050515 nmdc:mga0a205_39384_c1 nmdc:mga0a205_39384_c1_1279_1947 220
199 3300053083 Ga0495655_0063600 Ga0495655_0063600_70_735 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

134

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uhk-assembly2.cif.gz_A crystal structure of the receiver domain of cpxr from e. coli (phosphorylated) 0.9656 4 120
4uhj-assembly1.cif.gz_A crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form) 0.9627 4 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9597 4 119
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9596 4 119
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9587 4 119
ID Description Score Start End Superfamily
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9675 1 119 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9625 3 81 3.40.50.2300
af_P0AE88_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9614 4 83 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9612 1 81 3.40.50.2300
af_Q2G2G2_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9588 3 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A448V449-F1-model_v4 Transcriptional regulatory protein AfsQ1 0.9698 2 119 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-K2B8M8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9678 2 120 GO:0000155
AF-A0A3C0Z4C2-F1-model_v4 DNA-binding response regulator 0.9675 4 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2H0DSN6-F1-model_v4 DNA-binding response regulator 0.9667 1 120 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A0G1YX15-F1-model_v4 PAS domain S-box 0.9659 1 120 GO:0000160

Feature Viewer

pLDDT pTM Quality
88.1 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map