F305337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 199 | 136 | 192 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100012605|Ga0070683_1000126054 |
| Length | 240 |
| Sequence | MHHHVDPHTSARRDTQGAVIEPRIILLEDDDELRSIVGRGLREEGFAVSMAGSAAELVRQVDAGDFDALIIDIGLPDADGRDVVQALRARGIGTPVIFLTARDALPDRLAGFASGGDDYLTKPFHFAELVARLQALIKRGGSETAIEAGGLRLDPRSHDASCGSRNVKLTPTEFRILARLGAAPGDAVRRRDLVRAAWPHGAIVHDNTLDVYIARLRRKLATLPNTPGIVTMHGVGYSLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 2 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 3 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 4 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 5 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 6 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 94 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 95 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 96 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 104 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 115 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 116 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 118 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 119 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 120 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 123 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 124 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 125 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 126 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 127 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 136 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.98 |
| Metatranscriptomes | 0.5 |
| Isolates | 3.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 19.6 |
| Rhizosphere | 75.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10083378 | 3300003322 | Bacteria | 3899 |
| 2 | Ga0070658_10071380 | 3300005327 | Bacteria | 2844 |
| 3 | Ga0070683_100006811 | 3300005329 | Bacteria | 9602 |
| 4 | Ga0070683_100012605 | 3300005329 | Bacteria | 7350 |
| 5 | Ga0070683_100414103 | 3300005329 | Bacteria | 1285 |
| 6 | Ga0070690_100340825 | 3300005330 | Bacteria | 1085 |
| 7 | Ga0070666_10481279 | 3300005335 | Bacteria | 899 |
| 8 | Ga0070680_100041038 | 3300005336 | Bacteria | 3751 |
| 9 | Ga0070682_100010956 | 3300005337 | Bacteria | 5167 |
| 10 | Ga0068868_100341321 | 3300005338 | Bacteria | 1281 |
| 11 | Ga0070661_100031500 | 3300005344 | Bacteria | 3836 |
| 12 | Ga0070668_100093266 | 3300005347 | Bacteria | 2376 |
| 13 | Ga0070669_100295287 | 3300005353 | Bacteria | 1302 |
| 14 | Ga0070671_100209740 | 3300005355 | Bacteria | 1652 |
| 15 | Ga0070674_100502852 | 3300005356 | Bacteria | 1010 |
| 16 | Ga0070688_100431629 | 3300005365 | Bacteria | 981 |
| 17 | Ga0070659_100038160 | 3300005366 | Bacteria | 3746 |
| 18 | Ga0070705_100467357 | 3300005440 | Bacteria | 950 |
| 19 | Ga0070694_100326820 | 3300005444 | Bacteria | 1182 |
| 20 | Ga0070678_100094187 | 3300005456 | Bacteria | 2305 |
| 21 | Ga0070678_100755817 | 3300005456 | Bacteria | 880 |
| 22 | Ga0070681_10014437 | 3300005458 | Bacteria | 7862 |
| 23 | Ga0070685_10402967 | 3300005466 | Bacteria | 948 |
| 24 | Ga0070706_100320413 | 3300005467 | Bacteria | 1446 |
| 25 | Ga0070706_100413787 | 3300005467 | Bacteria | 1255 |
| 26 | Ga0070698_100456160 | 3300005471 | Bacteria | 1214 |
| 27 | Ga0070699_100047600 | 3300005518 | Bacteria | 3710 |
| 28 | Ga0070679_100003690 | 3300005530 | Bacteria | 14024 |
| 29 | Ga0070684_100005728 | 3300005535 | Bacteria | 9545 |
| 30 | Ga0070684_100010364 | 3300005535 | Bacteria | 7380 |
| 31 | Ga0070684_100275079 | 3300005535 | Bacteria | 1542 |
| 32 | Ga0070695_100226090 | 3300005545 | Bacteria | 1350 |
| 33 | Ga0070665_100220690 | 3300005548 | Bacteria | 1896 |
| 34 | Ga0070665_100469997 | 3300005548 | Bacteria | 1268 |
| 35 | Ga0070704_100036281 | 3300005549 | Bacteria | 3359 |
| 36 | Ga0070704_100251911 | 3300005549 | Bacteria | 1451 |
| 37 | Ga0070704_100468368 | 3300005549 | Bacteria | 1088 |
| 38 | Ga0070664_100036600 | 3300005564 | Bacteria | 4123 |
| 39 | Ga0070664_100267929 | 3300005564 | Bacteria | 1538 |
| 40 | Ga0068857_100013926 | 3300005577 | Bacteria | 7000 |
| 41 | Ga0068854_100189472 | 3300005578 | Bacteria | 1611 |
| 42 | Ga0068854_100845006 | 3300005578 | Bacteria | 801 |
| 43 | Ga0070702_100089391 | 3300005615 | Bacteria | 1864 |
| 44 | Ga0070702_100166912 | 3300005615 | Bacteria | 1428 |
| 45 | Ga0070702_100333768 | 3300005615 | Bacteria | 1061 |
| 46 | Ga0068852_100195985 | 3300005616 | Bacteria | 1909 |
| 47 | Ga0068859_100603206 | 3300005617 | Bacteria | 1191 |
| 48 | Ga0068864_100800405 | 3300005618 | Bacteria | 926 |
| 49 | Ga0068866_10092659 | 3300005718 | Bacteria | 1649 |
| 50 | Ga0068866_10166239 | 3300005718 | Bacteria | 1291 |
| 51 | Ga0068851_10367601 | 3300005834 | Bacteria | 840 |
| 52 | Ga0068858_100636524 | 3300005842 | Bacteria | 1036 |
| 53 | Ga0070717_10001126 | 3300006028 | Bacteria | 18082 |
| 54 | Ga0070716_100129471 | 3300006173 | Bacteria | 1593 |
| 55 | Ga0075433_10031625 | 3300006852 | Bacteria | 4525 |
| 56 | Ga0075433_10150419 | 3300006852 | Bacteria | 2071 |
| 57 | Ga0075433_10186739 | 3300006852 | Bacteria | 1844 |
| 58 | Ga0075434_100000917 | 3300006871 | Bacteria | 23637 |
| 59 | Ga0075434_100001960 | 3300006871 | Bacteria | 17843 |
| 60 | Ga0075434_100005318 | 3300006871 | Bacteria | 11710 |
| 61 | Ga0068865_100155368 | 3300006881 | Bacteria | 1740 |
| 62 | Ga0075436_100110550 | 3300006914 | Bacteria | 1918 |
| 63 | Ga0097620_100603149 | 3300006931 | Bacteria | 1191 |
| 64 | Ga0075435_100014811 | 3300007076 | Bacteria | 5845 |
| 65 | Ga0111539_10045561 | 3300009094 | Bacteria | 5249 |
| 66 | Ga0111539_10079107 | 3300009094 | Bacteria | 3867 |
| 67 | Ga0105245_10225767 | 3300009098 | Bacteria | 1809 |
| 68 | Ga0105245_10292065 | 3300009098 | Bacteria | 1597 |
| 69 | Ga0105245_10537252 | 3300009098 | Bacteria | 1190 |
| 70 | Ga0105245_10673078 | 3300009098 | Bacteria | 1066 |
| 71 | Ga0114129_11324151 | 3300009147 | Bacteria | 892 |
| 72 | Ga0105243_10170215 | 3300009148 | Bacteria | 1886 |
| 73 | Ga0105243_10499743 | 3300009148 | Bacteria | 1152 |
| 74 | Ga0105242_11054098 | 3300009176 | Bacteria | 824 |
| 75 | Ga0105238_10453462 | 3300009551 | Bacteria | 1279 |
| 76 | Ga0105249_10323617 | 3300009553 | Bacteria | 1554 |
| 77 | Ga0105239_10272889 | 3300010375 | Bacteria | 1902 |
| 78 | Ga0105239_10525468 | 3300010375 | Bacteria | 1346 |
| 79 | Ga0105246_10273970 | 3300011119 | Bacteria | 1350 |
| 80 | Ga0105246_10518656 | 3300011119 | Bacteria | 1015 |
| 81 | Ga0157370_10052475 | 3300013104 | Bacteria | 3893 |
| 82 | Ga0157370_10194279 | 3300013104 | Bacteria | 1884 |
| 83 | Ga0157369_10026536 | 3300013105 | Bacteria | 6425 |
| 84 | Ga0163162_10855478 | 3300013306 | Bacteria | 1024 |
| 85 | Ga0157372_10028469 | 3300013307 | Bacteria | 6098 |
| 86 | Ga0157372_10887952 | 3300013307 | Bacteria | 1034 |
| 87 | Ga0157375_10568467 | 3300013308 | Bacteria | 1294 |
| 88 | Ga0163163_10552615 | 3300014325 | Bacteria | 1214 |
| 89 | Ga0157377_10005953 | 3300014745 | Bacteria | 5775 |
| 90 | Ga0157376_10213998 | 3300014969 | Bacteria | 1781 |
| 91 | Ga0206353_10777530 | 3300020082 | Bacteria | 2458 |
| 92 | Ga0213876_10068994 | 3300021384 | Bacteria | 1867 |
| 93 | Ga0207642_10287512 | 3300025899 | Bacteria | 948 |
| 94 | Ga0207643_10141588 | 3300025908 | Bacteria | 1437 |
| 95 | Ga0207705_10165048 | 3300025909 | Bacteria | 1665 |
| 96 | Ga0207684_10092343 | 3300025910 | Bacteria | 2580 |
| 97 | Ga0207693_10250343 | 3300025915 | Bacteria | 1390 |
| 98 | Ga0207660_10054268 | 3300025917 | Bacteria | 2859 |
| 99 | Ga0207652_10019791 | 3300025921 | Bacteria | 5541 |
| 100 | Ga0207694_10376371 | 3300025924 | Bacteria | 1178 |
| 101 | Ga0207687_10604711 | 3300025927 | Bacteria | 924 |
| 102 | Ga0207687_10799444 | 3300025927 | Bacteria | 804 |
| 103 | Ga0207664_10400872 | 3300025929 | Bacteria | 1220 |
| 104 | Ga0207690_10144300 | 3300025932 | Bacteria | 1758 |
| 105 | Ga0207686_10257977 | 3300025934 | Bacteria | 1277 |
| 106 | Ga0207709_10417677 | 3300025935 | Bacteria | 1029 |
| 107 | Ga0207665_10151875 | 3300025939 | Bacteria | 1659 |
| 108 | Ga0207661_10002945 | 3300025944 | Bacteria | 11781 |
| 109 | Ga0207661_10011267 | 3300025944 | Bacteria | 6471 |
| 110 | Ga0207661_10567429 | 3300025944 | Bacteria | 1040 |
| 111 | Ga0207703_10275208 | 3300026035 | Bacteria | 1527 |
| 112 | Ga0207674_10022132 | 3300026116 | Bacteria | 6833 |
| 113 | Ga0207683_10180017 | 3300026121 | Bacteria | 1916 |
| 114 | Ga0207698_10518144 | 3300026142 | Bacteria | 1163 |
| 115 | Ga0207698_10612097 | 3300026142 | Bacteria | 1075 |
| 116 | Ga0207428_10228937 | 3300027907 | Bacteria | 1391 |
| 117 | Ga0268266_10291952 | 3300028379 | Bacteria | 1519 |
| 118 | Ga0316575_10094954 | 3300031665 | Bacteria | 1210 |
| 119 | Ga0316576_10004898 | 3300031727 | Bacteria | 8098 |
| 120 | Ga0373962_0015298 | 3300035242 | Bacteria | 1966 |
| 121 | Ga0316574_0149946 | 3300035398 | Bacteria | 1503 |
| 122 | Ga0373937_1000609 | 3300036401 | Bacteria | 785 |
| 123 | Ga0316584_0387471 | 3300036712 | Bacteria | 998 |
| 124 | Ga0395900_0106645 | 3300037418 | Bacteria | 2878 |
| 125 | Ga0395900_0344041 | 3300037418 | Bacteria | 1466 |
| 126 | Ga0395898_0004999 | 3300037466 | Bacteria | 14384 |
| 127 | Ga0395898_0027056 | 3300037466 | Bacteria | 5762 |
| 128 | Ga0395901_0073289 | 3300038443 | Bacteria | 3571 |
| 129 | Ga0395901_0150872 | 3300038443 | Bacteria | 2442 |
| 130 | Ga0436365_0909604 | 3300039437 | Bacteria | 38171 |
| 131 | Ga0451853_3065457 | 3300041512 | Bacteria | 9061 |
| 132 | Ga0466961_0277658 | 3300044693 | Bacteria | 1026 |
| 133 | Ga0466967_0010095 | 3300045976 | Bacteria | 7058 |
| 134 | Ga0466967_0958261 | 3300045976 | Bacteria | 851 |
| 135 | Ga0495603_0037289 | 3300046455 | Bacteria | 2917 |
| 136 | Ga0495582_0091210 | 3300046473 | Bacteria | 1699 |
| 137 | Ga0495599_0575736 | 3300046678 | Bacteria | 657 |
| 138 | Ga0495649_0276626 | 3300046694 | Bacteria | 858 |
| 139 | Ga0495676_0336868 | 3300047321 | Bacteria | 1011 |
| 140 | Ga0495685_001853 | 3300047447 | Bacteria | 6540 |
| 141 | Ga0496100_0014549 | 3300048903 | Bacteria | 4570 |
| 142 | Ga0496100_0017228 | 3300048903 | Bacteria | 4261 |
| 143 | Ga0496101_0011343 | 3300048904 | Bacteria | 5910 |
| 144 | Ga0496101_0030662 | 3300048904 | Bacteria | 3773 |
| 145 | Ga0496101_0280397 | 3300048904 | Bacteria | 1302 |
| 146 | Ga0496101_0423996 | 3300048904 | Bacteria | 1049 |
| 147 | Ga0496102_0005015 | 3300048905 | Bacteria | 11209 |
| 148 | Ga0496102_0030353 | 3300048905 | Bacteria | 4838 |
| 149 | Ga0496102_0185471 | 3300048905 | Bacteria | 1961 |
| 150 | Ga0496102_0817133 | 3300048905 | Bacteria | 854 |
| 151 | Ga0496103_0412042 | 3300048906 | Bacteria | 868 |
| 152 | Ga0496104_0226412 | 3300048907 | Bacteria | 1782 |
| 153 | Ga0496104_0523421 | 3300048907 | Bacteria | 1097 |
| 154 | Ga0496105_0145225 | 3300048908 | Bacteria | 1951 |
| 155 | Ga0496105_0288777 | 3300048908 | Bacteria | 1321 |
| 156 | Ga0496106_0000253 | 3300048909 | Bacteria | 37605 |
| 157 | Ga0496106_0007033 | 3300048909 | Bacteria | 8310 |
| 158 | Ga0496107_0004575 | 3300048910 | Bacteria | 9377 |
| 159 | Ga0496107_0605163 | 3300048910 | Bacteria | 810 |
| 160 | Ga0496108_0042391 | 3300048911 | Bacteria | 3799 |
| 161 | Ga0496108_0049807 | 3300048911 | Bacteria | 3504 |
| 162 | Ga0496109_0026532 | 3300048912 | Bacteria | 5167 |
| 163 | Ga0496109_0063860 | 3300048912 | Bacteria | 3368 |
| 164 | Ga0496109_0201689 | 3300048912 | Bacteria | 1870 |
| 165 | Ga0496109_0246013 | 3300048912 | Bacteria | 1684 |
| 166 | Ga0496109_0343896 | 3300048912 | Bacteria | 1409 |
| 167 | Ga0496109_0362500 | 3300048912 | Bacteria | 1369 |
| 168 | Ga0496110_0049718 | 3300048913 | Bacteria | 3679 |
| 169 | Ga0496110_0232378 | 3300048913 | Bacteria | 1677 |
| 170 | Ga0496111_0105415 | 3300048914 | Bacteria | 2074 |
| 171 | Ga0496112_0122828 | 3300048915 | Bacteria | 2567 |
| 172 | Ga0496112_0129556 | 3300048915 | Bacteria | 2494 |
| 173 | Ga0496113_0036977 | 3300048916 | Bacteria | 3580 |
| 174 | Ga0496114_0001863 | 3300048917 | Bacteria | 15983 |
| 175 | Ga0496114_0018714 | 3300048917 | Bacteria | 5604 |
| 176 | Ga0496114_0304965 | 3300048917 | Bacteria | 1406 |
| 177 | Ga0496114_0332978 | 3300048917 | Bacteria | 1342 |
| 178 | Ga0496114_0579877 | 3300048917 | Bacteria | 990 |
| 179 | Ga0496115_0475643 | 3300048918 | Bacteria | 1006 |
| 180 | Ga0501034_0099644 | 3300049571 | Bacteria | 2900 |
| 181 | nmdc:mga08y16_79132_c1 | 3300050511 | Bacteria | 3426 |
| 182 | nmdc:mga08y16_91933_c1 | 3300050511 | Bacteria | 3162 |
| 183 | nmdc:mga0n895_41300_c1 | 3300050512 | Bacteria | 4483 |
| 184 | nmdc:mga0n895_5290_c1 | 3300050512 | Bacteria | 10750 |
| 185 | nmdc:mga0n895_85344_c1 | 3300050512 | Bacteria | 3152 |
| 186 | nmdc:mga0rr50_1211806_c1 | 3300050513 | Bacteria | 641 |
| 187 | nmdc:mga0rr50_41961_c1 | 3300050513 | Bacteria | 3338 |
| 188 | nmdc:mga08x19_99045_c1 | 3300050514 | Bacteria | 1932 |
| 189 | nmdc:mga0a205_15299_c1 | 3300050515 | Bacteria | 7168 |
| 190 | nmdc:mga0a205_39384_c1 | 3300050515 | Bacteria | 4549 |
| 191 | Ga0495655_0063600 | 3300053083 | Bacteria | 1013 |
| 192 | Ga0500568_0010550 | 3300053139 | Bacteria | 4318 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046678 | Ga0495599_0575736 | Ga0495599_0575736_68_643 | 190 |
| 2 | 3300050513 | nmdc:mga0rr50_1211806_c1 | nmdc:mga0rr50_1211806_c1_14_616 | 199 |
| 3 | 3300005467 | Ga0070706_100320413 | Ga0070706_1003204132 | 203 |
| 4 | 3300025910 | Ga0207684_10092343 | Ga0207684_100923432 | 203 |
| 5 | 3300037418 | Ga0395900_0106645 | Ga0395900_0106645_857_1522 | 205 |
| 6 | 3300037466 | Ga0395898_0004999 | Ga0395898_0004999_1257_1922 | 205 |
| 7 | 3300038443 | Ga0395901_0073289 | Ga0395901_0073289_1948_2613 | 205 |
| 8 | 3300006028 | Ga0070717_10001126 | Ga0070717_100011269 | 207 |
| 9 | 3300048906 | Ga0496103_0412042 | Ga0496103_0412042_50_718 | 207 |
| 10 | 3300048911 | Ga0496108_0049807 | Ga0496108_0049807_1601_2269 | 207 |
| 11 | 3300020082 | Ga0206353_10777530 | Ga0206353_107775303 | 211 |
| 12 | iso_pu_bacteria | 2643221585 | 2643934015 | 214 |
| 13 | iso_pu_bacteria | 2643221656 | 2644315502 | 214 |
| 14 | 3300047321 | Ga0495676_0336868 | Ga0495676_0336868_202_852 | 215 |
| 15 | 3300027907 | Ga0207428_10228937 | Ga0207428_102289373 | 216 |
| 16 | iso_pu_bacteria | 2784746768 | 2785373865 | 216 |
| 17 | iso_pu_bacteria | 2877676314 | 2877677051 | 216 |
| 18 | iso_pu_bacteria | 2912723979 | 2912730942 | 216 |
| 19 | iso_pu_bacteria | 8056829672 | 8056834788 | 216 |
| 20 | 3300005327 | Ga0070658_10071380 | Ga0070658_100713801 | 217 |
| 21 | 3300025909 | Ga0207705_10165048 | Ga0207705_101650482 | 217 |
| 22 | iso_pu_bacteria | 2799112218 | 2799185678 | 217 |
| 23 | 3300037418 | Ga0395900_0344041 | Ga0395900_0344041_326_985 | 218 |
| 24 | 3300038443 | Ga0395901_0150872 | Ga0395901_0150872_417_1076 | 218 |
| 25 | 3300044693 | Ga0466961_0277658 | Ga0466961_0277658_156_821 | 218 |
| 26 | 3300005329 | Ga0070683_100414103 | Ga0070683_1004141031 | 219 |
| 27 | 3300005330 | Ga0070690_100340825 | Ga0070690_1003408251 | 219 |
| 28 | 3300005335 | Ga0070666_10481279 | Ga0070666_104812791 | 219 |
| 29 | 3300005338 | Ga0068868_100341321 | Ga0068868_1003413212 | 219 |
| 30 | 3300005347 | Ga0070668_100093266 | Ga0070668_1000932662 | 219 |
| 31 | 3300005353 | Ga0070669_100295287 | Ga0070669_1002952872 | 219 |
| 32 | 3300005355 | Ga0070671_100209740 | Ga0070671_1002097402 | 219 |
| 33 | 3300005440 | Ga0070705_100467357 | Ga0070705_1004673572 | 219 |
| 34 | 3300005444 | Ga0070694_100326820 | Ga0070694_1003268202 | 219 |
| 35 | 3300005456 | Ga0070678_100094187 | Ga0070678_1000941873 | 219 |
| 36 | 3300005471 | Ga0070698_100456160 | Ga0070698_1004561602 | 219 |
| 37 | 3300005545 | Ga0070695_100226090 | Ga0070695_1002260902 | 219 |
| 38 | 3300005548 | Ga0070665_100469997 | Ga0070665_1004699972 | 219 |
| 39 | 3300005549 | Ga0070704_100251911 | Ga0070704_1002519112 | 219 |
| 40 | 3300005615 | Ga0070702_100089391 | Ga0070702_1000893912 | 219 |
| 41 | 3300005615 | Ga0070702_100333768 | Ga0070702_1003337682 | 219 |
| 42 | 3300005842 | Ga0068858_100636524 | Ga0068858_1006365242 | 219 |
| 43 | 3300006173 | Ga0070716_100129471 | Ga0070716_1001294712 | 219 |
| 44 | 3300006852 | Ga0075433_10031625 | Ga0075433_100316252 | 219 |
| 45 | 3300006852 | Ga0075433_10150419 | Ga0075433_101504192 | 219 |
| 46 | 3300006852 | Ga0075433_10186739 | Ga0075433_101867392 | 219 |
| 47 | 3300006871 | Ga0075434_100000917 | Ga0075434_10000091722 | 219 |
| 48 | 3300006871 | Ga0075434_100001960 | Ga0075434_1000019604 | 219 |
| 49 | 3300006871 | Ga0075434_100005318 | Ga0075434_1000053187 | 219 |
| 50 | 3300006881 | Ga0068865_100155368 | Ga0068865_1001553682 | 219 |
| 51 | 3300006914 | Ga0075436_100110550 | Ga0075436_1001105502 | 219 |
| 52 | 3300007076 | Ga0075435_100014811 | Ga0075435_1000148112 | 219 |
| 53 | 3300009094 | Ga0111539_10079107 | Ga0111539_100791072 | 219 |
| 54 | 3300009098 | Ga0105245_10292065 | Ga0105245_102920652 | 219 |
| 55 | 3300009098 | Ga0105245_10537252 | Ga0105245_105372521 | 219 |
| 56 | 3300009147 | Ga0114129_11324151 | Ga0114129_113241511 | 219 |
| 57 | 3300009553 | Ga0105249_10323617 | Ga0105249_103236172 | 219 |
| 58 | 3300013104 | Ga0157370_10052475 | Ga0157370_100524754 | 219 |
| 59 | 3300013306 | Ga0163162_10855478 | Ga0163162_108554781 | 219 |
| 60 | 3300013307 | Ga0157372_10887952 | Ga0157372_108879522 | 219 |
| 61 | 3300025899 | Ga0207642_10287512 | Ga0207642_102875122 | 219 |
| 62 | 3300025934 | Ga0207686_10257977 | Ga0207686_102579772 | 219 |
| 63 | 3300025939 | Ga0207665_10151875 | Ga0207665_101518752 | 219 |
| 64 | 3300025944 | Ga0207661_10567429 | Ga0207661_105674292 | 219 |
| 65 | 3300026035 | Ga0207703_10275208 | Ga0207703_102752082 | 219 |
| 66 | 3300028379 | Ga0268266_10291952 | Ga0268266_102919522 | 219 |
| 67 | 3300035242 | Ga0373962_0015298 | Ga0373962_0015298_204_869 | 219 |
| 68 | 3300048903 | Ga0496100_0014549 | Ga0496100_0014549_534_1199 | 219 |
| 69 | 3300048903 | Ga0496100_0017228 | Ga0496100_0017228_2459_3121 | 219 |
| 70 | 3300048904 | Ga0496101_0011343 | Ga0496101_0011343_2520_3182 | 219 |
| 71 | 3300048904 | Ga0496101_0030662 | Ga0496101_0030662_788_1453 | 219 |
| 72 | 3300048905 | Ga0496102_0005015 | Ga0496102_0005015_7881_8543 | 219 |
| 73 | 3300048905 | Ga0496102_0030353 | Ga0496102_0030353_669_1334 | 219 |
| 74 | 3300048905 | Ga0496102_0185471 | Ga0496102_0185471_1149_1814 | 219 |
| 75 | 3300048907 | Ga0496104_0226412 | Ga0496104_0226412_108_773 | 219 |
| 76 | 3300048907 | Ga0496104_0523421 | Ga0496104_0523421_360_1025 | 219 |
| 77 | 3300048908 | Ga0496105_0145225 | Ga0496105_0145225_1221_1886 | 219 |
| 78 | 3300048909 | Ga0496106_0000253 | Ga0496106_0000253_16783_17445 | 219 |
| 79 | 3300048909 | Ga0496106_0007033 | Ga0496106_0007033_3358_4023 | 219 |
| 80 | 3300048910 | Ga0496107_0004575 | Ga0496107_0004575_3106_3768 | 219 |
| 81 | 3300048912 | Ga0496109_0063860 | Ga0496109_0063860_2673_3338 | 219 |
| 82 | 3300048915 | Ga0496112_0129556 | Ga0496112_0129556_1523_2188 | 219 |
| 83 | 3300048917 | Ga0496114_0001863 | Ga0496114_0001863_10924_11586 | 219 |
| 84 | 3300048917 | Ga0496114_0018714 | Ga0496114_0018714_3506_4171 | 219 |
| 85 | 3300048917 | Ga0496114_0579877 | Ga0496114_0579877_46_711 | 219 |
| 86 | 3300048918 | Ga0496115_0475643 | Ga0496115_0475643_307_972 | 219 |
| 87 | 3300050511 | nmdc:mga08y16_91933_c1 | nmdc:mga08y16_91933_c1_2281_2946 | 219 |
| 88 | 3300050512 | nmdc:mga0n895_41300_c1 | nmdc:mga0n895_41300_c1_2408_3073 | 219 |
| 89 | 3300050512 | nmdc:mga0n895_85344_c1 | nmdc:mga0n895_85344_c1_400_1065 | 219 |
| 90 | 3300050513 | nmdc:mga0rr50_41961_c1 | nmdc:mga0rr50_41961_c1_2071_2736 | 219 |
| 91 | 3300050514 | nmdc:mga08x19_99045_c1 | nmdc:mga08x19_99045_c1_1137_1802 | 219 |
| 92 | 3300050515 | nmdc:mga0a205_15299_c1 | nmdc:mga0a205_15299_c1_4826_5491 | 219 |
| 93 | 3300053139 | Ga0500568_0010550 | Ga0500568_0010550_1294_1974 | 219 |
| 94 | 3300003322 | rootL2_10083378 | rootL2_100833783 | 220 |
| 95 | 3300005329 | Ga0070683_100006811 | Ga0070683_1000068116 | 220 |
| 96 | 3300005329 | Ga0070683_100012605 | Ga0070683_1000126054 | 220 |
| 97 | 3300005336 | Ga0070680_100041038 | Ga0070680_1000410382 | 220 |
| 98 | 3300005337 | Ga0070682_100010956 | Ga0070682_1000109566 | 220 |
| 99 | 3300005344 | Ga0070661_100031500 | Ga0070661_1000315002 | 220 |
| 100 | 3300005356 | Ga0070674_100502852 | Ga0070674_1005028521 | 220 |
| 101 | 3300005365 | Ga0070688_100431629 | Ga0070688_1004316291 | 220 |
| 102 | 3300005366 | Ga0070659_100038160 | Ga0070659_1000381602 | 220 |
| 103 | 3300005456 | Ga0070678_100755817 | Ga0070678_1007558171 | 220 |
| 104 | 3300005458 | Ga0070681_10014437 | Ga0070681_100144375 | 220 |
| 105 | 3300005466 | Ga0070685_10402967 | Ga0070685_104029672 | 220 |
| 106 | 3300005467 | Ga0070706_100413787 | Ga0070706_1004137872 | 220 |
| 107 | 3300005518 | Ga0070699_100047600 | Ga0070699_1000476004 | 220 |
| 108 | 3300005530 | Ga0070679_100003690 | Ga0070679_1000036903 | 220 |
| 109 | 3300005535 | Ga0070684_100005728 | Ga0070684_1000057289 | 220 |
| 110 | 3300005535 | Ga0070684_100010364 | Ga0070684_1000103645 | 220 |
| 111 | 3300005535 | Ga0070684_100275079 | Ga0070684_1002750792 | 220 |
| 112 | 3300005548 | Ga0070665_100220690 | Ga0070665_1002206901 | 220 |
| 113 | 3300005549 | Ga0070704_100036281 | Ga0070704_1000362813 | 220 |
| 114 | 3300005549 | Ga0070704_100468368 | Ga0070704_1004683682 | 220 |
| 115 | 3300005564 | Ga0070664_100036600 | Ga0070664_1000366002 | 220 |
| 116 | 3300005564 | Ga0070664_100267929 | Ga0070664_1002679292 | 220 |
| 117 | 3300005577 | Ga0068857_100013926 | Ga0068857_1000139266 | 220 |
| 118 | 3300005578 | Ga0068854_100189472 | Ga0068854_1001894722 | 220 |
| 119 | 3300005578 | Ga0068854_100845006 | Ga0068854_1008450062 | 220 |
| 120 | 3300005615 | Ga0070702_100166912 | Ga0070702_1001669122 | 220 |
| 121 | 3300005616 | Ga0068852_100195985 | Ga0068852_1001959852 | 220 |
| 122 | 3300005617 | Ga0068859_100603206 | Ga0068859_1006032062 | 220 |
| 123 | 3300005618 | Ga0068864_100800405 | Ga0068864_1008004051 | 220 |
| 124 | 3300005718 | Ga0068866_10092659 | Ga0068866_100926592 | 220 |
| 125 | 3300005718 | Ga0068866_10166239 | Ga0068866_101662392 | 220 |
| 126 | 3300005834 | Ga0068851_10367601 | Ga0068851_103676012 | 220 |
| 127 | 3300006931 | Ga0097620_100603149 | Ga0097620_1006031492 | 220 |
| 128 | 3300009094 | Ga0111539_10045561 | Ga0111539_100455614 | 220 |
| 129 | 3300009098 | Ga0105245_10225767 | Ga0105245_102257671 | 220 |
| 130 | 3300009098 | Ga0105245_10673078 | Ga0105245_106730781 | 220 |
| 131 | 3300009148 | Ga0105243_10170215 | Ga0105243_101702151 | 220 |
| 132 | 3300009148 | Ga0105243_10499743 | Ga0105243_104997432 | 220 |
| 133 | 3300009176 | Ga0105242_11054098 | Ga0105242_110540981 | 220 |
| 134 | 3300009551 | Ga0105238_10453462 | Ga0105238_104534622 | 220 |
| 135 | 3300010375 | Ga0105239_10272889 | Ga0105239_102728892 | 220 |
| 136 | 3300010375 | Ga0105239_10525468 | Ga0105239_105254682 | 220 |
| 137 | 3300011119 | Ga0105246_10273970 | Ga0105246_102739702 | 220 |
| 138 | 3300011119 | Ga0105246_10518656 | Ga0105246_105186561 | 220 |
| 139 | 3300013104 | Ga0157370_10194279 | Ga0157370_101942792 | 220 |
| 140 | 3300013105 | Ga0157369_10026536 | Ga0157369_100265366 | 220 |
| 141 | 3300013307 | Ga0157372_10028469 | Ga0157372_100284693 | 220 |
| 142 | 3300013308 | Ga0157375_10568467 | Ga0157375_105684672 | 220 |
| 143 | 3300014325 | Ga0163163_10552615 | Ga0163163_105526152 | 220 |
| 144 | 3300014745 | Ga0157377_10005953 | Ga0157377_100059536 | 220 |
| 145 | 3300014969 | Ga0157376_10213998 | Ga0157376_102139982 | 220 |
| 146 | 3300021384 | Ga0213876_10068994 | Ga0213876_100689942 | 220 |
| 147 | 3300025908 | Ga0207643_10141588 | Ga0207643_101415882 | 220 |
| 148 | 3300025915 | Ga0207693_10250343 | Ga0207693_102503432 | 220 |
| 149 | 3300025917 | Ga0207660_10054268 | Ga0207660_100542682 | 220 |
| 150 | 3300025921 | Ga0207652_10019791 | Ga0207652_100197914 | 220 |
| 151 | 3300025924 | Ga0207694_10376371 | Ga0207694_103763712 | 220 |
| 152 | 3300025927 | Ga0207687_10604711 | Ga0207687_106047112 | 220 |
| 153 | 3300025927 | Ga0207687_10799444 | Ga0207687_107994441 | 220 |
| 154 | 3300025929 | Ga0207664_10400872 | Ga0207664_104008722 | 220 |
| 155 | 3300025932 | Ga0207690_10144300 | Ga0207690_101443002 | 220 |
| 156 | 3300025935 | Ga0207709_10417677 | Ga0207709_104176772 | 220 |
| 157 | 3300025944 | Ga0207661_10002945 | Ga0207661_100029457 | 220 |
| 158 | 3300025944 | Ga0207661_10011267 | Ga0207661_100112676 | 220 |
| 159 | 3300026116 | Ga0207674_10022132 | Ga0207674_100221326 | 220 |
| 160 | 3300026121 | Ga0207683_10180017 | Ga0207683_101800171 | 220 |
| 161 | 3300026142 | Ga0207698_10518144 | Ga0207698_105181442 | 220 |
| 162 | 3300026142 | Ga0207698_10612097 | Ga0207698_106120972 | 220 |
| 163 | 3300031665 | Ga0316575_10094954 | Ga0316575_100949541 | 220 |
| 164 | 3300031727 | Ga0316576_10004898 | Ga0316576_100048984 | 220 |
| 165 | 3300035398 | Ga0316574_0149946 | Ga0316574_0149946_664_1389 | 220 |
| 166 | 3300036401 | Ga0373937_1000609 | Ga0373937_1000609_17_688 | 220 |
| 167 | 3300036712 | Ga0316584_0387471 | Ga0316584_0387471_230_898 | 220 |
| 168 | 3300037466 | Ga0395898_0027056 | Ga0395898_0027056_1544_2206 | 220 |
| 169 | 3300039437 | Ga0436365_0909604 | Ga0436365_0909604_28857_29525 | 220 |
| 170 | 3300041512 | Ga0451853_3065457 | Ga0451853_3065457_8088_8750 | 220 |
| 171 | 3300045976 | Ga0466967_0010095 | Ga0466967_0010095_479_1147 | 220 |
| 172 | 3300045976 | Ga0466967_0958261 | Ga0466967_0958261_19_681 | 220 |
| 173 | 3300046455 | Ga0495603_0037289 | Ga0495603_0037289_2088_2756 | 220 |
| 174 | 3300046473 | Ga0495582_0091210 | Ga0495582_0091210_863_1531 | 220 |
| 175 | 3300046694 | Ga0495649_0276626 | Ga0495649_0276626_36_698 | 220 |
| 176 | 3300047447 | Ga0495685_001853 | Ga0495685_001853_1027_1689 | 220 |
| 177 | 3300048904 | Ga0496101_0280397 | Ga0496101_0280397_115_783 | 220 |
| 178 | 3300048904 | Ga0496101_0423996 | Ga0496101_0423996_86_754 | 220 |
| 179 | 3300048905 | Ga0496102_0817133 | Ga0496102_0817133_71_739 | 220 |
| 180 | 3300048908 | Ga0496105_0288777 | Ga0496105_0288777_403_1071 | 220 |
| 181 | 3300048910 | Ga0496107_0605163 | Ga0496107_0605163_69_740 | 220 |
| 182 | 3300048911 | Ga0496108_0042391 | Ga0496108_0042391_250_918 | 220 |
| 183 | 3300048912 | Ga0496109_0026532 | Ga0496109_0026532_2987_3655 | 220 |
| 184 | 3300048912 | Ga0496109_0201689 | Ga0496109_0201689_690_1358 | 220 |
| 185 | 3300048912 | Ga0496109_0246013 | Ga0496109_0246013_622_1290 | 220 |
| 186 | 3300048912 | Ga0496109_0343896 | Ga0496109_0343896_461_1129 | 220 |
| 187 | 3300048912 | Ga0496109_0362500 | Ga0496109_0362500_333_1001 | 220 |
| 188 | 3300048913 | Ga0496110_0049718 | Ga0496110_0049718_851_1519 | 220 |
| 189 | 3300048913 | Ga0496110_0232378 | Ga0496110_0232378_479_1147 | 220 |
| 190 | 3300048914 | Ga0496111_0105415 | Ga0496111_0105415_1344_2012 | 220 |
| 191 | 3300048915 | Ga0496112_0122828 | Ga0496112_0122828_1836_2504 | 220 |
| 192 | 3300048916 | Ga0496113_0036977 | Ga0496113_0036977_56_724 | 220 |
| 193 | 3300048917 | Ga0496114_0304965 | Ga0496114_0304965_81_749 | 220 |
| 194 | 3300048917 | Ga0496114_0332978 | Ga0496114_0332978_129_797 | 220 |
| 195 | 3300049571 | Ga0501034_0099644 | Ga0501034_0099644_540_1217 | 220 |
| 196 | 3300050511 | nmdc:mga08y16_79132_c1 | nmdc:mga08y16_79132_c1_1606_2274 | 220 |
| 197 | 3300050512 | nmdc:mga0n895_5290_c1 | nmdc:mga0n895_5290_c1_6239_6907 | 220 |
| 198 | 3300050515 | nmdc:mga0a205_39384_c1 | nmdc:mga0a205_39384_c1_1279_1947 | 220 |
| 199 | 3300053083 | Ga0495655_0063600 | Ga0495655_0063600_70_735 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4uhk-assembly2.cif.gz_A | crystal structure of the receiver domain of cpxr from e. coli (phosphorylated) | 0.9656 | 4 | 120 |
| 4uhj-assembly1.cif.gz_A | crystal structure of the receiver domain of cpxr from e. coli (orthorhombic form) | 0.9627 | 4 | 120 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9597 | 4 | 119 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9596 | 4 | 119 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9587 | 4 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9675 | 1 | 119 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9625 | 3 | 81 | 3.40.50.2300 |
| af_P0AE88_2_83_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9614 | 4 | 83 | 3.40.50.2300 |
| af_P0AFJ5_1_84_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9612 | 1 | 81 | 3.40.50.2300 |
| af_Q2G2G2_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9588 | 3 | 81 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A448V449-F1-model_v4 | Transcriptional regulatory protein AfsQ1 | 0.9698 | 2 | 119 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-K2B8M8-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9678 | 2 | 120 |
GO:0000155
|
| AF-A0A3C0Z4C2-F1-model_v4 | DNA-binding response regulator | 0.9675 | 4 | 120 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2H0DSN6-F1-model_v4 | DNA-binding response regulator | 0.9667 | 1 | 120 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A0G1YX15-F1-model_v4 | PAS domain S-box | 0.9659 | 1 | 120 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar