F305068

General Info

Members Datasets Scaffolds Average Seq Length
198 132 396 446

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_83593_c1|nmdc:mga05p37_83593_c1_296_1852
Length 506
Sequence MSVNVRLRKIVRQTPAGLKVAANCSWNCILERLLYAKELVMSETNNQRTKRLEDAMREVSDPNKGGAAVLTIGLGYLASRSRAQRPDDRSLNQSQQRFDLQISENAKQMMEQGKQIFRYDTFGDEAYWTDKLKLHHAIQGSKFGGVGPGVSPKTALAVGLKVDMDALPADLVEKIKKGEVNLDDPATTLALIKLNSVLGVKGTFNQDGSLKAVGLSCAVCHSTVDDAFAPGIGHRLDGWPNQDLNVGAIVSLAPDLSVLTNLLRVDEPTVKKVLASWGPGKFDAELNLDGKAFRPDGKPAATLIPPAFGMAGVNLHTWGGGWGTVTYWNAFVGNLELQGQGTFFDARLNDPKKYPVAARAGFGNKRSGTDMVTEKLAALQFYQLAIPPPTPPEGSFDRAAATRGEMVFKGKANCTQCHAPPLFTEPGWNAHKASEIGIDDFQANRAPDNSYRTTPLRGLFAHMKRGFYHDGRFATLLDVVNHYDQFKRLNLTDKEKRDLVEYLKSL

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 1.01
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_83593_c1 3300050507 Bacteria 3933
2 JGI25406J46586_10001864 3300003203 Bacteria 9896
3 Ga0065712_10081697 3300005290 Bacteria 2981
4 Ga0065707_10004233 3300005295 Bacteria 4984
5 Ga0070658_10047659 3300005327 Bacteria 3467
6 Ga0070683_100073591 3300005329 Unclassified 3190
7 Ga0070690_100041957 3300005330 Bacteria 2897
8 Ga0070690_100098526 3300005330 Unclassified 1935
9 Ga0068868_100060163 3300005338 Bacteria 3006
10 Ga0070689_100024295 3300005340 Bacteria 4544
11 Ga0070689_100156420 3300005340 Bacteria 1840
12 Ga0070669_100083969 3300005353 Bacteria 2375
13 Ga0070673_100029403 3300005364 Bacteria 4097
14 Ga0070673_100210890 3300005364 Bacteria 1677
15 Ga0070667_100082786 3300005367 Bacteria 2748
16 Ga0070709_10002229 3300005434 Bacteria 10505
17 Ga0070709_10028043 3300005434 Unclassified 3355
18 Ga0070710_10036746 3300005437 Bacteria 2679
19 Ga0070694_100035361 3300005444 Bacteria 3302
20 Ga0070708_100049683 3300005445 Bacteria 3711
21 Ga0068867_100021867 3300005459 Bacteria 4567
22 Ga0070685_10001407 3300005466 Bacteria 12606
23 Ga0070706_100003013 3300005467 Bacteria 16684
24 Ga0070706_100201868 3300005467 Bacteria 1857
25 Ga0070707_100009625 3300005468 Bacteria 8979
26 Ga0070707_100097154 3300005468 Bacteria 2853
27 Ga0070698_100237414 3300005471 Bacteria 1756
28 Ga0070699_100000043 3300005518 Bacteria 127213
29 Ga0070699_100002162 3300005518 Bacteria 17781
30 Ga0070684_100150288 3300005535 Unclassified 2109
31 Ga0070697_100080724 3300005536 Bacteria 2679
32 Ga0070695_100002083 3300005545 Bacteria 11440
33 Ga0070696_100116595 3300005546 Bacteria 1929
34 Ga0070665_100000114 3300005548 Bacteria 151271
35 Ga0070665_100019042 3300005548 Bacteria 6886
36 Ga0070665_100019286 3300005548 Bacteria 6843
37 Ga0068855_100003957 3300005563 Bacteria 18090
38 Ga0068857_100181604 3300005577 Bacteria 1915
39 Ga0068854_100102251 3300005578 Bacteria 2150
40 Ga0070702_100052938 3300005615 Bacteria 2330
41 Ga0070702_100084332 3300005615 Bacteria 1910
42 Ga0068859_100067883 3300005617 Bacteria 3601
43 Ga0068859_100107852 3300005617 Bacteria 2846
44 Ga0068859_100175812 3300005617 Unclassified 2222
45 Ga0068864_100056599 3300005618 Bacteria 3388
46 Ga0068863_100061494 3300005841 Bacteria 3551
47 Ga0068862_100057408 3300005844 Bacteria 3338
48 Ga0068862_100087084 3300005844 Bacteria 2716
49 Ga0081455_10003570 3300005937 Bacteria 17854
50 Ga0081455_10039569 3300005937 Bacteria 4166
51 Ga0081540_1061558 3300005983 Bacteria 1788
52 Ga0081539_10000914 3300005985 Bacteria 55819
53 Ga0081539_10001424 3300005985 Bacteria 41114
54 Ga0081539_10001576 3300005985 Bacteria 37698
55 Ga0081539_10015027 3300005985 Bacteria 5670
56 Ga0081539_10026001 3300005985 Unclassified 3749
57 Ga0075364_10122132 3300006051 Bacteria 1744
58 Ga0070716_100044072 3300006173 Unclassified 2498
59 Ga0097621_100002665 3300006237 Bacteria 12215
60 Ga0097621_100099399 3300006237 Bacteria 2445
61 Ga0068871_100012449 3300006358 Bacteria 6272
62 Ga0068871_100080287 3300006358 Bacteria 2700
63 Ga0075431_100030059 3300006847 Bacteria 5595
64 Ga0075431_100137324 3300006847 Unclassified 2521
65 Ga0075433_10069878 3300006852 Bacteria 3085
66 Ga0075434_100019007 3300006871 Bacteria 6642
67 Ga0075434_100083487 3300006871 Bacteria 3192
68 Ga0068865_100007538 3300006881 Bacteria 6696
69 Ga0068865_100010601 3300006881 Bacteria 5744
70 Ga0068865_100023156 3300006881 Bacteria 4063
71 Ga0075436_100000225 3300006914 Bacteria 35159
72 Ga0075436_100043522 3300006914 Bacteria 3096
73 Ga0097620_100067883 3300006931 Bacteria 3601
74 Ga0097620_100107842 3300006931 Bacteria 2846
75 Ga0097620_100175823 3300006931 Unclassified 2222
76 Ga0075435_100000091 3300007076 Bacteria 48294
77 Ga0105245_10001085 3300009098 Bacteria 24657
78 Ga0114129_10002168 3300009147 Bacteria 27047
79 Ga0114129_10010872 3300009147 Bacteria 12968
80 Ga0114129_10032845 3300009147 Bacteria 7332
81 Ga0114129_10125804 3300009147 Bacteria 3524
82 Ga0114129_10152696 3300009147 Unclassified 3159
83 Ga0105243_10002047 3300009148 Bacteria 17091
84 Ga0105242_10005394 3300009176 Bacteria 9890
85 Ga0105242_10097694 3300009176 Bacteria 2483
86 Ga0105248_10018871 3300009177 Bacteria 7626
87 Ga0105248_10101381 3300009177 Bacteria 3245
88 Ga0105248_10281926 3300009177 Bacteria 1871
89 Ga0105238_10041457 3300009551 Unclassified 4662
90 Ga0157369_10000396 3300013105 Bacteria 58117
91 Ga0157374_10011232 3300013296 Bacteria 7746
92 Ga0157374_10074671 3300013296 Bacteria 3202
93 Ga0157378_10042505 3300013297 Bacteria 4034
94 Ga0157378_10078795 3300013297 Bacteria 2973
95 Ga0157378_10097360 3300013297 Bacteria 2681
96 Ga0163162_10001652 3300013306 Bacteria 20901
97 Ga0163162_10018621 3300013306 Bacteria 6803
98 Ga0157372_10187385 3300013307 Unclassified 2396
99 Ga0157372_10210978 3300013307 Bacteria 2251
100 Ga0163163_10006849 3300014325 Bacteria 10004
101 Ga0163163_10121083 3300014325 Unclassified 2651
102 Ga0157376_10036506 3300014969 Bacteria 3982
103 Ga0163161_10000868 3300017792 Bacteria 23540
104 Ga0207697_10015545 3300025315 Bacteria 3143
105 Ga0207642_10001617 3300025899 Bacteria 6933
106 Ga0207680_10074287 3300025903 Bacteria 2116
107 Ga0207643_10067212 3300025908 Bacteria 2057
108 Ga0207705_10156059 3300025909 Bacteria 1712
109 Ga0207684_10016727 3300025910 Bacteria 6297
110 Ga0207684_10029795 3300025910 Bacteria 4646
111 Ga0207707_10065262 3300025912 Unclassified 3171
112 Ga0207646_10031472 3300025922 Unclassified 4803
113 Ga0207646_10097718 3300025922 Unclassified 2630
114 Ga0207646_10117130 3300025922 Bacteria 2393
115 Ga0207694_10058610 3300025924 Unclassified 2995
116 Ga0207687_10000581 3300025927 Bacteria 24670
117 Ga0207706_10021496 3300025933 Bacteria 5795
118 Ga0207686_10006465 3300025934 Bacteria 6307
119 Ga0207665_10011472 3300025939 Bacteria 5820
120 Ga0207665_10160319 3300025939 Bacteria 1617
121 Ga0207691_10011901 3300025940 Bacteria 8349
122 Ga0207711_10233392 3300025941 Bacteria 1685
123 Ga0207689_10006356 3300025942 Bacteria 10463
124 Ga0207689_10263827 3300025942 Bacteria 1425
125 Ga0207661_10100715 3300025944 Unclassified 2425
126 Ga0207679_10063687 3300025945 Bacteria 2753
127 Ga0207667_10003088 3300025949 Bacteria 20634
128 Ga0207712_10028477 3300025961 Bacteria 3737
129 Ga0207640_10054948 3300025981 Bacteria 2606
130 Ga0207658_10228980 3300025986 Bacteria 1568
131 Ga0207675_100047144 3300026118 Bacteria 4024
132 Ga0207683_10007870 3300026121 Bacteria 9119
133 Ga0207698_10078734 3300026142 Unclassified 2648
134 Ga0268266_10001490 3300028379 Bacteria 27748
135 Ga0268266_10015680 3300028379 Bacteria 6492
136 Ga0268265_10020352 3300028380 Bacteria 4630
137 Ga0268265_10054495 3300028380 Bacteria 3035
138 Ga0268265_10065070 3300028380 Bacteria 2812
139 Ga0268265_10105783 3300028380 Bacteria 2284
140 Ga0307408_100007431 3300031548 Bacteria 7249
141 Ga0307413_10017136 3300031824 Bacteria 3767
142 Ga0307407_10035214 3300031903 Bacteria 2748
143 Ga0307409_100041638 3300031995 Bacteria 3432
144 Ga0307416_100007243 3300032002 Bacteria 7029
145 Ga0307415_100041928 3300032126 Bacteria 3042
146 Ga0373961_0001198 3300035241 Bacteria 7988
147 Ga0373925_0110280 3300037068 Bacteria 2125
148 Ga0395900_0048846 3300037418 Bacteria 4358
149 Ga0395905_0009686 3300037471 Bacteria 9404
150 Ga0395905_0013138 3300037471 Bacteria 7949
151 Ga0453683_0075118 3300044673 Bacteria 2116
152 Ga0451576_0003940 3300045051 Bacteria 19807
153 Ga0495629_0000010 3300046459 Bacteria 340114
154 Ga0495580_0020831 3300046472 Bacteria 4847
155 Ga0495580_0080825 3300046472 Bacteria 2265
156 Ga0495599_0065716 3300046678 Bacteria 2266
157 Ga0495672_0061193 3300047320 Unclassified 2171
158 Ga0496110_0021582 3300048913 Bacteria 5456
159 Ga0496114_0028255 3300048917 Bacteria 4601
160 Ga0501033_0036915 3300049570 Bacteria 3660
161 Ga0501036_0064727 3300049572 Bacteria 3094
162 Ga0501038_0072026 3300049574 Bacteria 2929
163 Ga0501040_0027123 3300049576 Bacteria 3855
164 Ga0501046_0014829 3300049580 Bacteria 6561
165 Ga0501046_0161641 3300049580 Bacteria 1684
166 Ga0501048_0019170 3300049582 Bacteria 5022
167 Ga0501071_0017422 3300049587 Bacteria 4953
168 Ga0501071_0033895 3300049587 Bacteria 3630
169 Ga0501072_0005659 3300049588 Bacteria 9514
170 Ga0501072_0169979 3300049588 Bacteria 1739
171 Ga0501076_0019659 3300049592 Bacteria 5164
172 Ga0501076_0029723 3300049592 Bacteria 4251
173 Ga0501077_0015780 3300049593 Bacteria 4758
174 Ga0501079_0003039 3300049741 Bacteria 12280
175 Ga0501081_0017754 3300049743 Bacteria 4715
176 Ga0501081_0059646 3300049743 Bacteria 2642
177 Ga0501083_0059218 3300049744 Bacteria 2562
178 Ga0501035_0019022 3300049822 Bacteria 6322
179 Ga0501045_0019986 3300049824 Bacteria 4780
180 Ga0501045_0020115 3300049824 Bacteria 4766
181 nmdc:mga0yw44_33082_c1 3300050492 Bacteria 3018
182 nmdc:mga05p37_2277_c1 3300050507 Bacteria 22372
183 nmdc:mga05p37_22963_c1 3300050507 Bacteria 7566
184 nmdc:mga05p37_27924_c1 3300050507 Bacteria 5391
185 nmdc:mga05p37_32447_c1 3300050507 Bacteria 6386
186 nmdc:mga08y16_200537_c1 3300050511 Bacteria 2068
187 nmdc:mga08y16_39791_c1 3300050511 Bacteria 4931
188 nmdc:mga0n895_2_c1 3300050512 Bacteria 145967
189 nmdc:mga0n895_47621_c1 3300050512 Bacteria 4192
190 nmdc:mga0n895_69455_c1 3300050512 Bacteria 3490
191 nmdc:mga0rr50_24291_c1 3300050513 Bacteria 4196
192 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
193 nmdc:mga08x19_152111_c1 3300050514 Bacteria 1568
194 nmdc:mga08x19_174_c1 3300050514 Bacteria 52388
195 Ga0495601_0003020 3300053077 Bacteria 9592
196 Ga0495619_0006330 3300053085 Bacteria 7509
197 Ga0501084_0005703 3300054114 Bacteria 10231
198 Ga0590077_003782 3300059426 Bacteria 3121
199 nmdc:mga05p37_83593_c1
200 JGI25406J46586_10001864
201 Ga0065712_10081697
202 Ga0065707_10004233
203 Ga0070658_10047659
204 Ga0070683_100073591
205 Ga0070690_100041957
206 Ga0070690_100098526
207 Ga0068868_100060163
208 Ga0070689_100024295
209 Ga0070689_100156420
210 Ga0070669_100083969
211 Ga0070673_100029403
212 Ga0070673_100210890
213 Ga0070667_100082786
214 Ga0070709_10002229
215 Ga0070709_10028043
216 Ga0070710_10036746
217 Ga0070694_100035361
218 Ga0070708_100049683
219 Ga0068867_100021867
220 Ga0070685_10001407
221 Ga0070706_100003013
222 Ga0070706_100201868
223 Ga0070707_100009625
224 Ga0070707_100097154
225 Ga0070698_100237414
226 Ga0070699_100000043
227 Ga0070699_100002162
228 Ga0070684_100150288
229 Ga0070697_100080724
230 Ga0070695_100002083
231 Ga0070696_100116595
232 Ga0070665_100000114
233 Ga0070665_100019042
234 Ga0070665_100019286
235 Ga0068855_100003957
236 Ga0068857_100181604
237 Ga0068854_100102251
238 Ga0070702_100052938
239 Ga0070702_100084332
240 Ga0068859_100067883
241 Ga0068859_100107852
242 Ga0068859_100175812
243 Ga0068864_100056599
244 Ga0068863_100061494
245 Ga0068862_100057408
246 Ga0068862_100087084
247 Ga0081455_10003570
248 Ga0081455_10039569
249 Ga0081540_1061558
250 Ga0081539_10000914
251 Ga0081539_10001424
252 Ga0081539_10001576
253 Ga0081539_10015027
254 Ga0081539_10026001
255 Ga0075364_10122132
256 Ga0070716_100044072
257 Ga0097621_100002665
258 Ga0097621_100099399
259 Ga0068871_100012449
260 Ga0068871_100080287
261 Ga0075431_100030059
262 Ga0075431_100137324
263 Ga0075433_10069878
264 Ga0075434_100019007
265 Ga0075434_100083487
266 Ga0068865_100007538
267 Ga0068865_100010601
268 Ga0068865_100023156
269 Ga0075436_100000225
270 Ga0075436_100043522
271 Ga0097620_100067883
272 Ga0097620_100107842
273 Ga0097620_100175823
274 Ga0075435_100000091
275 Ga0105245_10001085
276 Ga0114129_10002168
277 Ga0114129_10010872
278 Ga0114129_10032845
279 Ga0114129_10125804
280 Ga0114129_10152696
281 Ga0105243_10002047
282 Ga0105242_10005394
283 Ga0105242_10097694
284 Ga0105248_10018871
285 Ga0105248_10101381
286 Ga0105248_10281926
287 Ga0105238_10041457
288 Ga0157369_10000396
289 Ga0157374_10011232
290 Ga0157374_10074671
291 Ga0157378_10042505
292 Ga0157378_10078795
293 Ga0157378_10097360
294 Ga0163162_10001652
295 Ga0163162_10018621
296 Ga0157372_10187385
297 Ga0157372_10210978
298 Ga0163163_10006849
299 Ga0163163_10121083
300 Ga0157376_10036506
301 Ga0163161_10000868
302 Ga0207697_10015545
303 Ga0207642_10001617
304 Ga0207680_10074287
305 Ga0207643_10067212
306 Ga0207705_10156059
307 Ga0207684_10016727
308 Ga0207684_10029795
309 Ga0207707_10065262
310 Ga0207646_10031472
311 Ga0207646_10097718
312 Ga0207646_10117130
313 Ga0207694_10058610
314 Ga0207687_10000581
315 Ga0207706_10021496
316 Ga0207686_10006465
317 Ga0207665_10011472
318 Ga0207665_10160319
319 Ga0207691_10011901
320 Ga0207711_10233392
321 Ga0207689_10006356
322 Ga0207689_10263827
323 Ga0207661_10100715
324 Ga0207679_10063687
325 Ga0207667_10003088
326 Ga0207712_10028477
327 Ga0207640_10054948
328 Ga0207658_10228980
329 Ga0207675_100047144
330 Ga0207683_10007870
331 Ga0207698_10078734
332 Ga0268266_10001490
333 Ga0268266_10015680
334 Ga0268265_10020352
335 Ga0268265_10054495
336 Ga0268265_10065070
337 Ga0268265_10105783
338 Ga0307408_100007431
339 Ga0307413_10017136
340 Ga0307407_10035214
341 Ga0307409_100041638
342 Ga0307416_100007243
343 Ga0307415_100041928
344 Ga0373961_0001198
345 Ga0373925_0110280
346 Ga0395900_0048846
347 Ga0395905_0009686
348 Ga0395905_0013138
349 Ga0453683_0075118
350 Ga0451576_0003940
351 Ga0495629_0000010
352 Ga0495580_0020831
353 Ga0495580_0080825
354 Ga0495599_0065716
355 Ga0495672_0061193
356 Ga0496110_0021582
357 Ga0496114_0028255
358 Ga0501033_0036915
359 Ga0501036_0064727
360 Ga0501038_0072026
361 Ga0501040_0027123
362 Ga0501046_0014829
363 Ga0501046_0161641
364 Ga0501048_0019170
365 Ga0501071_0017422
366 Ga0501071_0033895
367 Ga0501072_0005659
368 Ga0501072_0169979
369 Ga0501076_0019659
370 Ga0501076_0029723
371 Ga0501077_0015780
372 Ga0501079_0003039
373 Ga0501081_0017754
374 Ga0501081_0059646
375 Ga0501083_0059218
376 Ga0501035_0019022
377 Ga0501045_0019986
378 Ga0501045_0020115
379 nmdc:mga0yw44_33082_c1
380 nmdc:mga05p37_2277_c1
381 nmdc:mga05p37_22963_c1
382 nmdc:mga05p37_27924_c1
383 nmdc:mga05p37_32447_c1
384 nmdc:mga08y16_200537_c1
385 nmdc:mga08y16_39791_c1
386 nmdc:mga0n895_2_c1
387 nmdc:mga0n895_47621_c1
388 nmdc:mga0n895_69455_c1
389 nmdc:mga0rr50_24291_c1
390 nmdc:mga0rr50_4_c1
391 nmdc:mga08x19_152111_c1
392 nmdc:mga08x19_174_c1
393 Ga0495601_0003020
394 Ga0495619_0006330
395 Ga0501084_0005703
396 Ga0590077_003782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o5c-assembly2.cif.gz_D cytochrome c peroxidase bccp of shewanella oneidensis 0.5953 232 461
3o5c-assembly2.cif.gz_C cytochrome c peroxidase bccp of shewanella oneidensis 0.595 232 461
3sjl-assembly1.cif.gz_B crystal structure of the p107s-maug/pre-methylamine dehydrogenase complex 0.5938 258 461
6e1c-assembly2.cif.gz_B crystal structure of a maug-like protein associated with microbial copper homeostasis 0.5711 243 462
5c2w-assembly1.cif.gz_F kuenenia stuttgartiensis hydrazine synthase pressurized with 20 bar xenon 0.5703 247 462
ID Description Score Start End Superfamily
6fu3B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6727 353 461 1.10.760.10
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6346 345 461 1.10.760.10
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.4981 345 461 1.10.760.10
6fu3B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.4799 353 461 1.10.760.10
6cunA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.4006 348 460 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2V9HHE6-F1-model_v4 Cytochrome c domain-containing protein 0.9863 342 462 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A7V9KNR0-F1-model_v4 Cytochrome c domain-containing protein 0.9856 287 462 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A536W948-F1-model_v4 Cytochrome c domain-containing protein 0.9855 217 462 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A525VJ72-F1-model_v4 Cytochrome c 0.9846 387 462 GO:0009055
GO:0020037
AF-A0A142YCL3-F1-model_v4 Cytochrome c domain-containing protein 0.9824 52 462 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Map