F304560

General Info

Members Datasets Scaffolds Average Seq Length
198 143 396 226

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10036336|Ga0207639_100363363
Length 246
Sequence MDTTRSERRCAMTDSSVKQPLIVPSVLPADFARLGDEVVELCEAGVDRIQWDVMDGVFVPNLTFGADVIAASRPHSTVGFEAHLMVVNPDELLARYVDAGCELIIVHAEACTHLHRTLGHIRDLGARSAVALNPHTPAEAVQHVLSETDLILAMTVNPGFGGQAYIPSMEAKIRRLRTMIDESGLPIELEVDGGITDKTIAGAAAAGADVFISGSWMYSYPDGKSAAVKQLRTTALENARHAEATL

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
4 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
60 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
72 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
73 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
74 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
75 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2643221576 Nocardioides sp. Root614 Isolate Unclassified
137 2643221590 Nocardioides sp. Root682 Isolate Unclassified
138 2643221692 Nocardia sp. Root136 Isolate Unclassified
139 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
140 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
141 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
142 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
143 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 4.55
Rhizosphere 69.7
Stem 0
Stem Tuber 0.51
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10036336 3300026041 Bacteria 3650
2 Ga0070689_100906900 3300005340 Bacteria 780
3 Ga0070705_100006047 3300005440 Bacteria 5922
4 Ga0070678_100259443 3300005456 Bacteria 1461
5 Ga0070681_10005776 3300005458 Bacteria 11967
6 Ga0070706_100230676 3300005467 Bacteria 1728
7 Ga0070706_100337778 3300005467 Bacteria 1404
8 Ga0070707_100005560 3300005468 Bacteria 11772
9 Ga0070698_100000727 3300005471 Bacteria 35372
10 Ga0070698_100186763 3300005471 Bacteria 2010
11 Ga0070699_100774967 3300005518 Bacteria 877
12 Ga0070697_100072979 3300005536 Bacteria 2817
13 Ga0068853_100027722 3300005539 Bacteria 4761
14 Ga0070696_100102054 3300005546 Bacteria 2057
15 Ga0070704_100045406 3300005549 Bacteria 3057
16 Ga0068855_100610457 3300005563 Bacteria 1175
17 Ga0068859_100215645 3300005617 Bacteria 2007
18 Ga0081455_10000773 3300005937 Bacteria 41270
19 Ga0081455_10041314 3300005937 Bacteria 4057
20 Ga0075365_10008083 3300006038 Bacteria 5942
21 Ga0075363_100006923 3300006048 Bacteria 5186
22 Ga0075364_10025207 3300006051 Bacteria 3784
23 Ga0075364_10280271 3300006051 Bacteria 1134
24 Ga0075362_10009865 3300006177 Bacteria 3709
25 Ga0075362_10076297 3300006177 Bacteria 1538
26 Ga0075367_10144139 3300006178 Bacteria 1476
27 Ga0075369_10000174 3300006186 Bacteria 18341
28 Ga0075369_10042997 3300006186 Bacteria 1937
29 Ga0075370_10021746 3300006353 Bacteria 3515
30 Ga0075370_10032809 3300006353 Bacteria 2904
31 Ga0075370_10065644 3300006353 Bacteria 2070
32 Ga0097620_100215653 3300006931 Bacteria 2007
33 Ga0105245_10001301 3300009098 Bacteria 22534
34 Ga0105245_10006160 3300009098 Bacteria 10555
35 Ga0105248_10405523 3300009177 Bacteria 1535
36 Ga0105237_10631111 3300009545 Bacteria 1078
37 Ga0105249_10190032 3300009553 Bacteria 2004
38 Ga0105249_11019411 3300009553 Bacteria 897
39 Ga0105239_10229421 3300010375 Bacteria 2083
40 Ga0157378_10275253 3300013297 Bacteria 1620
41 Ga0157378_10293857 3300013297 Bacteria 1570
42 Ga0163162_10005025 3300013306 Bacteria 12742
43 Ga0163162_10872621 3300013306 Bacteria 1014
44 Ga0157375_11349953 3300013308 Bacteria 839
45 Ga0157376_10813248 3300014969 Bacteria 948
46 Ga0163161_10053912 3300017792 Bacteria 2917
47 Ga0207642_10210977 3300025899 Bacteria 1079
48 Ga0207684_10215168 3300025910 Bacteria 1658
49 Ga0207707_10013752 3300025912 Bacteria 7057
50 Ga0207707_10105968 3300025912 Bacteria 2457
51 Ga0207646_10149706 3300025922 Bacteria 2104
52 Ga0207687_10003974 3300025927 Bacteria 9907
53 Ga0207687_10015500 3300025927 Bacteria 4998
54 Ga0207706_10234672 3300025933 Bacteria 1604
55 Ga0207686_10085156 3300025934 Bacteria 2073
56 Ga0207711_10409228 3300025941 Bacteria 1261
57 Ga0207712_10446141 3300025961 Bacteria 1096
58 Ga0207677_10321610 3300026023 Bacteria 1286
59 Ga0207675_100194780 3300026118 Bacteria 1945
60 Ga0207698_10356524 3300026142 Bacteria 1383
61 Ga0209813_10011763 3300027866 Bacteria 2296
62 Ga0268264_10469731 3300028381 Bacteria 1222
63 Ga0316182_1313394 3300030745 Bacteria 2316
64 Ga0307408_100298687 3300031548 Bacteria 1348
65 Ga0316579_10030550 3300031691 Bacteria 2463
66 Ga0316576_10026156 3300031727 Bacteria 4092
67 Ga0316576_10124021 3300031727 Bacteria 1941
68 Ga0316578_10049698 3300031728 Bacteria 2451
69 Ga0316577_10099507 3300031733 Bacteria 1629
70 Ga0307409_100892853 3300031995 Bacteria 902
71 Ga0373948_0035430 3300034817 Bacteria 1024
72 Ga0373932_0000132 3300035112 Bacteria 21153
73 Ga0373956_0097580 3300035119 Bacteria 1360
74 Ga0373942_0109426 3300035207 Bacteria 853
75 Ga0316574_0034770 3300035398 Bacteria 3075
76 Ga0316574_0075787 3300035398 Bacteria 2131
77 Ga0373931_0000001 3300035691 Bacteria 634029
78 Ga0373931_0000104 3300035691 Bacteria 38471
79 Ga0316584_0031064 3300036712 Bacteria 3949
80 Ga0316584_0052693 3300036712 Bacteria 3043
81 Ga0316584_0105339 3300036712 Bacteria 2110
82 Ga0395900_0854978 3300037418 Bacteria 835
83 Ga0395898_0014341 3300037466 Bacteria 8145
84 Ga0436360_0157523 3300039438 Bacteria 1648
85 Ga0439465_0071470 3300041413 Bacteria 1164
86 Ga0451833_0161631 3300041491 Bacteria 1783
87 Ga0451833_1068678 3300041491 Bacteria 1009
88 Ga0451837_0174592 3300041494 Bacteria 7919
89 Ga0451839_0304274 3300041496 Bacteria 3118
90 Ga0451843_0477135 3300041509 Bacteria 2291
91 Ga0451843_0615740 3300041509 Bacteria 3116
92 Ga0439445_0045855 3300042004 Bacteria 1171
93 Ga0439445_0098407 3300042004 Bacteria 828
94 Ga0439432_005264 3300042006 Bacteria 4669
95 Ga0439452_007668 3300042010 Bacteria 3297
96 Ga0439434_0054392 3300042435 Bacteria 1245
97 Ga0450918_003946 3300042531 Bacteria 2724
98 Ga0466963_0032537 3300044694 Bacteria 3378
99 Ga0466963_0340367 3300044694 Bacteria 1056
100 Ga0466968_0085052 3300044735 Bacteria 1395
101 Ga0466960_0206426 3300044901 Bacteria 1075
102 Ga0466967_0040189 3300045976 Bacteria 4026
103 Ga0466967_0545644 3300045976 Bacteria 1141
104 Ga0495582_0171902 3300046473 Bacteria 1234
105 Ga0495582_0288951 3300046473 Bacteria 942
106 Ga0495639_0019270 3300046475 Bacteria 2977
107 Ga0495583_0057388 3300046506 Bacteria 1751
108 Ga0495648_0008720 3300046524 Bacteria 7942
109 Ga0495640_0040843 3300046533 Bacteria 3246
110 Ga0495668_0011318 3300046616 Bacteria 5350
111 Ga0495634_0013565 3300046642 Bacteria 5886
112 Ga0495613_0003491 3300046689 Bacteria 11765
113 Ga0495672_0002584 3300047320 Bacteria 16441
114 Ga0495672_0003907 3300047320 Bacteria 12510
115 Ga0495680_0087765 3300047322 Bacteria 2339
116 Ga0495673_0019428 3300047469 Bacteria 3403
117 Ga0495686_0015968 3300047472 Bacteria 5104
118 Ga0495614_0025004 3300048089 Bacteria 2577
119 Ga0496101_0020525 3300048904 Bacteria 4525
120 Ga0496102_0019027 3300048905 Bacteria 6043
121 Ga0496102_0035125 3300048905 Bacteria 4511
122 Ga0496102_0277198 3300048905 Bacteria 1581
123 Ga0496104_0087990 3300048907 Bacteria 2967
124 Ga0496107_0119159 3300048910 Bacteria 1944
125 Ga0496112_0040297 3300048915 Bacteria 4567
126 Ga0496114_0280775 3300048917 Bacteria 1468
127 Ga0496114_1001027 3300048917 Bacteria 719
128 Ga0496122_0012626 3300048925 Bacteria 8377
129 Ga0496126_0005077 3300048929 Bacteria 15266
130 Ga0496126_0140949 3300048929 Bacteria 2075
131 Ga0496126_0290819 3300048929 Bacteria 1351
132 Ga0501031_0030107 3300049568 Bacteria 3539
133 Ga0501032_0047436 3300049569 Bacteria 2900
134 Ga0501032_0170309 3300049569 Bacteria 1428
135 Ga0501033_0036648 3300049570 Bacteria 3674
136 Ga0501034_0044258 3300049571 Bacteria 4503
137 Ga0501034_0606357 3300049571 Bacteria 1000
138 Ga0501034_0686321 3300049571 Bacteria 923
139 Ga0501036_0079586 3300049572 Bacteria 2771
140 Ga0501037_0011913 3300049573 Bacteria 6406
141 Ga0501037_0156564 3300049573 Bacteria 1626
142 Ga0501038_0013226 3300049574 Bacteria 7527
143 Ga0501038_0243495 3300049574 Bacteria 1427
144 Ga0501038_0336044 3300049574 Bacteria 1179
145 Ga0501039_0029368 3300049575 Bacteria 4234
146 Ga0501043_0010981 3300049579 Bacteria 7095
147 Ga0501043_0279548 3300049579 Bacteria 1280
148 Ga0501043_0497717 3300049579 Bacteria 911
149 Ga0501046_0513073 3300049580 Bacteria 858
150 Ga0501068_0069501 3300049584 Bacteria 2147
151 Ga0501068_0529929 3300049584 Bacteria 765
152 Ga0501070_0006081 3300049586 Bacteria 10285
153 Ga0501071_0042527 3300049587 Bacteria 3256
154 Ga0501071_0101062 3300049587 Bacteria 2126
155 Ga0501072_0039277 3300049588 Bacteria 3716
156 Ga0501072_0194969 3300049588 Bacteria 1615
157 Ga0501075_0185520 3300049591 Bacteria 1587
158 Ga0501076_0043013 3300049592 Bacteria 3558
159 Ga0501076_0230142 3300049592 Bacteria 1515
160 Ga0501079_0040727 3300049741 Bacteria 3585
161 Ga0501079_0233660 3300049741 Bacteria 1436
162 Ga0501080_0054460 3300049742 Bacteria 3725
163 Ga0501081_0377966 3300049743 Bacteria 1046
164 Ga0501081_0566464 3300049743 Bacteria 849
165 Ga0501083_0148529 3300049744 Bacteria 1535
166 Ga0501044_0001716 3300049823 Bacteria 25671
167 Ga0501044_0211079 3300049823 Bacteria 1896
168 nmdc:mga03683_62415_c1 3300050489 Bacteria 1578
169 nmdc:mga03n38_8442_c1 3300050490 Bacteria 3698
170 nmdc:mga00v17_39604_c1 3300050491 Bacteria 2823
171 nmdc:mga00v17_422085_c1 3300050491 Bacteria 866
172 nmdc:mga00v17_4477_c1 3300050491 Bacteria 7272
173 nmdc:mga00v17_582514_c1 3300050491 Bacteria 722
174 nmdc:mga0yw44_1532_c1 3300050492 Bacteria 9236
175 nmdc:mga0yw44_19985_c1 3300050492 Bacteria 3706
176 nmdc:mga0yw44_28672_c1 3300050492 Bacteria 3205
177 nmdc:mga0yw44_41970_c1 3300050492 Bacteria 2726
178 nmdc:mga06z11_88259_c1 3300050494 Bacteria 1679
179 nmdc:mga06z11_96149_c1 3300050494 Bacteria 1617
180 nmdc:mga04h51_26052_c1 3300050495 Bacteria 1805
181 nmdc:mga07m45_56113_c1 3300050496 Bacteria 2226
182 nmdc:mga07m45_70161_c1 3300050496 Bacteria 1993
183 nmdc:mga0sz30_11295_c1 3300050516 Bacteria 3445
184 Ga0500635_0069582 3300053080 Bacteria 1245
185 Ga0500635_0073680 3300053080 Bacteria 1215
186 Ga0495619_0329578 3300053085 Bacteria 1057
187 Ga0500616_0003117 3300053153 Bacteria 12957
188 Ga0500645_025668 3300053730 Bacteria 1797
189 Ga0501082_0016529 3300060353 Bacteria 6352
190 Ga0530510_0031042 3300061734 Bacteria 3840
191 2643893327 2643221576 Bacteria 5214352
192 2643962376 2643221590 Bacteria 5214697
193 2644512941 2643221692 Bacteria 7282860
194 2738705418 2738541274 Bacteria 6909446
195 2739332205 2738543028 Bacteria 6917070
196 2899370668 2899370129 Bacteria 6781179
197 2902797429 2902792274 Bacteria 7270173
198 2902812393 2902810491 Bacteria 6794147
199 Ga0207639_10036336
200 Ga0070689_100906900
201 Ga0070705_100006047
202 Ga0070678_100259443
203 Ga0070681_10005776
204 Ga0070706_100230676
205 Ga0070706_100337778
206 Ga0070707_100005560
207 Ga0070698_100000727
208 Ga0070698_100186763
209 Ga0070699_100774967
210 Ga0070697_100072979
211 Ga0068853_100027722
212 Ga0070696_100102054
213 Ga0070704_100045406
214 Ga0068855_100610457
215 Ga0068859_100215645
216 Ga0081455_10000773
217 Ga0081455_10041314
218 Ga0075365_10008083
219 Ga0075363_100006923
220 Ga0075364_10025207
221 Ga0075364_10280271
222 Ga0075362_10009865
223 Ga0075362_10076297
224 Ga0075367_10144139
225 Ga0075369_10000174
226 Ga0075369_10042997
227 Ga0075370_10021746
228 Ga0075370_10032809
229 Ga0075370_10065644
230 Ga0097620_100215653
231 Ga0105245_10001301
232 Ga0105245_10006160
233 Ga0105248_10405523
234 Ga0105237_10631111
235 Ga0105249_10190032
236 Ga0105249_11019411
237 Ga0105239_10229421
238 Ga0157378_10275253
239 Ga0157378_10293857
240 Ga0163162_10005025
241 Ga0163162_10872621
242 Ga0157375_11349953
243 Ga0157376_10813248
244 Ga0163161_10053912
245 Ga0207642_10210977
246 Ga0207684_10215168
247 Ga0207707_10013752
248 Ga0207707_10105968
249 Ga0207646_10149706
250 Ga0207687_10003974
251 Ga0207687_10015500
252 Ga0207706_10234672
253 Ga0207686_10085156
254 Ga0207711_10409228
255 Ga0207712_10446141
256 Ga0207677_10321610
257 Ga0207675_100194780
258 Ga0207698_10356524
259 Ga0209813_10011763
260 Ga0268264_10469731
261 Ga0316182_1313394
262 Ga0307408_100298687
263 Ga0316579_10030550
264 Ga0316576_10026156
265 Ga0316576_10124021
266 Ga0316578_10049698
267 Ga0316577_10099507
268 Ga0307409_100892853
269 Ga0373948_0035430
270 Ga0373932_0000132
271 Ga0373956_0097580
272 Ga0373942_0109426
273 Ga0316574_0034770
274 Ga0316574_0075787
275 Ga0373931_0000001
276 Ga0373931_0000104
277 Ga0316584_0031064
278 Ga0316584_0052693
279 Ga0316584_0105339
280 Ga0395900_0854978
281 Ga0395898_0014341
282 Ga0436360_0157523
283 Ga0439465_0071470
284 Ga0451833_0161631
285 Ga0451833_1068678
286 Ga0451837_0174592
287 Ga0451839_0304274
288 Ga0451843_0477135
289 Ga0451843_0615740
290 Ga0439445_0045855
291 Ga0439445_0098407
292 Ga0439432_005264
293 Ga0439452_007668
294 Ga0439434_0054392
295 Ga0450918_003946
296 Ga0466963_0032537
297 Ga0466963_0340367
298 Ga0466968_0085052
299 Ga0466960_0206426
300 Ga0466967_0040189
301 Ga0466967_0545644
302 Ga0495582_0171902
303 Ga0495582_0288951
304 Ga0495639_0019270
305 Ga0495583_0057388
306 Ga0495648_0008720
307 Ga0495640_0040843
308 Ga0495668_0011318
309 Ga0495634_0013565
310 Ga0495613_0003491
311 Ga0495672_0002584
312 Ga0495672_0003907
313 Ga0495680_0087765
314 Ga0495673_0019428
315 Ga0495686_0015968
316 Ga0495614_0025004
317 Ga0496101_0020525
318 Ga0496102_0019027
319 Ga0496102_0035125
320 Ga0496102_0277198
321 Ga0496104_0087990
322 Ga0496107_0119159
323 Ga0496112_0040297
324 Ga0496114_0280775
325 Ga0496114_1001027
326 Ga0496122_0012626
327 Ga0496126_0005077
328 Ga0496126_0140949
329 Ga0496126_0290819
330 Ga0501031_0030107
331 Ga0501032_0047436
332 Ga0501032_0170309
333 Ga0501033_0036648
334 Ga0501034_0044258
335 Ga0501034_0606357
336 Ga0501034_0686321
337 Ga0501036_0079586
338 Ga0501037_0011913
339 Ga0501037_0156564
340 Ga0501038_0013226
341 Ga0501038_0243495
342 Ga0501038_0336044
343 Ga0501039_0029368
344 Ga0501043_0010981
345 Ga0501043_0279548
346 Ga0501043_0497717
347 Ga0501046_0513073
348 Ga0501068_0069501
349 Ga0501068_0529929
350 Ga0501070_0006081
351 Ga0501071_0042527
352 Ga0501071_0101062
353 Ga0501072_0039277
354 Ga0501072_0194969
355 Ga0501075_0185520
356 Ga0501076_0043013
357 Ga0501076_0230142
358 Ga0501079_0040727
359 Ga0501079_0233660
360 Ga0501080_0054460
361 Ga0501081_0377966
362 Ga0501081_0566464
363 Ga0501083_0148529
364 Ga0501044_0001716
365 Ga0501044_0211079
366 nmdc:mga03683_62415_c1
367 nmdc:mga03n38_8442_c1
368 nmdc:mga00v17_39604_c1
369 nmdc:mga00v17_422085_c1
370 nmdc:mga00v17_4477_c1
371 nmdc:mga00v17_582514_c1
372 nmdc:mga0yw44_1532_c1
373 nmdc:mga0yw44_19985_c1
374 nmdc:mga0yw44_28672_c1
375 nmdc:mga0yw44_41970_c1
376 nmdc:mga06z11_88259_c1
377 nmdc:mga06z11_96149_c1
378 nmdc:mga04h51_26052_c1
379 nmdc:mga07m45_56113_c1
380 nmdc:mga07m45_70161_c1
381 nmdc:mga0sz30_11295_c1
382 Ga0500635_0069582
383 Ga0500635_0073680
384 Ga0495619_0329578
385 Ga0500616_0003117
386 Ga0500645_025668
387 Ga0501082_0016529
388 Ga0530510_0031042
389 2643893327
390 2643962376
391 2644512941
392 2738705418
393 2739332205
394 2899370668
395 2902797429
396 2902812393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

21

218

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.987 2 200
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9782 2 204
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9733 2 198
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9731 2 204
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9731 2 197
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9876 2 202 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9804 2 204 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9751 2 203 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9689 2 198 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9675 2 193 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0U4W401-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9929 2 197 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A6J7N4Z0-F1-model_v4 Unannotated protein 0.9919 36 203 GO:0005975
GO:0016857
AF-A0A1G6NA90-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9912 2 201 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A2W4NE53-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9911 2 198 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A829ZV42-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9911 2 201 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Map