F304145

General Info

Members Datasets Scaffolds Average Seq Length
198 116 396 173

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_101066804|Ga0070704_1010668041
Length 174
Sequence MKMPHVVFKGKVFSVSRDLSVEPGGVRATREVVRHPGSAVVIVQDQKRRLLLIRQYRFSAGQKIWEVVAGRIDPGERPLQAARRELAEEVSLGARTWTPLGAFYPSPGFVDEVMWLYLARNLYPASAQPDKDERISKRWFPPEQVGRLIRRGLIRDAKSALCYFLLQQRGFLGR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
71 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 24.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_101066804 3300005549 Unclassified 733
2 Ga0070683_100040266 3300005329 Bacteria 4295
3 Ga0070683_100174579 3300005329 Bacteria 2040
4 Ga0070670_101242039 3300005331 Bacteria 681
5 Ga0070666_10742935 3300005335 Unclassified 721
6 Ga0070680_100371541 3300005336 Bacteria 1217
7 Ga0070689_101338683 3300005340 Bacteria 646
8 Ga0070671_100069182 3300005355 Bacteria 2944
9 Ga0070674_101115385 3300005356 Unclassified 697
10 Ga0070673_100023640 3300005364 Bacteria 4493
11 Ga0070673_100466172 3300005364 Bacteria 1138
12 Ga0070667_100316145 3300005367 Bacteria 1408
13 Ga0070667_101292514 3300005367 Unclassified 683
14 Ga0070714_100000593 3300005435 Bacteria 25886
15 Ga0070713_100015462 3300005436 Bacteria 5709
16 Ga0070713_100018527 3300005436 Bacteria 5291
17 Ga0070713_100583285 3300005436 Unclassified 1061
18 Ga0070711_100071476 3300005439 Bacteria 2446
19 Ga0068867_100213492 3300005459 Bacteria 1551
20 Ga0070679_100318304 3300005530 Unclassified 1505
21 Ga0070684_100060548 3300005535 Bacteria 3312
22 Ga0070684_100093263 3300005535 Bacteria 2680
23 Ga0070672_100926761 3300005543 Unclassified 770
24 Ga0068857_100328944 3300005577 Unclassified 1412
25 Ga0068859_100411029 3300005617 Bacteria 1449
26 Ga0068859_100642950 3300005617 Unclassified 1153
27 Ga0068863_100532353 3300005841 Bacteria 1159
28 Ga0070717_10027790 3300006028 Bacteria 4523
29 Ga0070717_10089760 3300006028 Bacteria 2593
30 Ga0070717_10409579 3300006028 Bacteria 1219
31 Ga0070712_100054601 3300006175 Bacteria 2793
32 Ga0070712_100618129 3300006175 Unclassified 918
33 Ga0097621_100389577 3300006237 Bacteria 1246
34 Ga0097621_101342428 3300006237 Bacteria 676
35 Ga0068871_100195991 3300006358 Bacteria 1742
36 Ga0097620_100411082 3300006931 Bacteria 1449
37 Ga0097620_100642907 3300006931 Unclassified 1153
38 Ga0097620_101557036 3300006931 Bacteria 730
39 Ga0105240_10014314 3300009093 Bacteria 10834
40 Ga0105240_10099508 3300009093 Bacteria 3539
41 Ga0105245_10631542 3300009098 Bacteria 1100
42 Ga0105243_10938100 3300009148 Unclassified 864
43 Ga0105241_11283603 3300009174 Unclassified 697
44 Ga0105248_10147897 3300009177 Unclassified 2651
45 Ga0105248_10516122 3300009177 Bacteria 1347
46 Ga0105248_10521918 3300009177 Bacteria 1339
47 Ga0105237_10034282 3300009545 Bacteria 5141
48 Ga0105237_10112039 3300009545 Bacteria 2720
49 Ga0105238_10354308 3300009551 Bacteria 1457
50 Ga0105239_10031212 3300010375 Bacteria 5861
51 Ga0157370_10292683 3300013104 Unclassified 1504
52 Ga0157370_10387179 3300013104 Bacteria 1287
53 Ga0157370_10913775 3300013104 Bacteria 796
54 Ga0157369_10083573 3300013105 Bacteria 3414
55 Ga0157369_10193207 3300013105 Bacteria 2138
56 Ga0157374_10408979 3300013296 Bacteria 1354
57 Ga0157374_10432243 3300013296 Bacteria 1316
58 Ga0157374_10554758 3300013296 Bacteria 1157
59 Ga0157374_10641506 3300013296 Bacteria 1073
60 Ga0157374_11684022 3300013296 Bacteria 659
61 Ga0157378_10265295 3300013297 Unclassified 1649
62 Ga0157372_10130801 3300013307 Bacteria 2888
63 Ga0157372_11567372 3300013307 Bacteria 758
64 Ga0157375_10322955 3300013308 Bacteria 1708
65 Ga0157375_11624816 3300013308 Unclassified 764
66 Ga0163163_10124591 3300014325 Bacteria 2613
67 Ga0163163_10296494 3300014325 Bacteria 1669
68 Ga0163163_10505346 3300014325 Archaea 1271
69 Ga0157376_10040277 3300014969 Bacteria 3818
70 Ga0157376_10062284 3300014969 Bacteria 3138
71 Ga0157376_10435112 3300014969 Bacteria 1276
72 Ga0157376_11047591 3300014969 Unclassified 840
73 Ga0157376_11659126 3300014969 Unclassified 674
74 Ga0163161_11059311 3300017792 Unclassified 695
75 Ga0206352_10946066 3300020078 Bacteria 1526
76 Ga0213876_10045139 3300021384 Bacteria 2331
77 Ga0207695_10058084 3300025913 Bacteria 4017
78 Ga0207695_10360225 3300025913 Bacteria 1341
79 Ga0207671_10093500 3300025914 Bacteria 2268
80 Ga0207693_10286090 3300025915 Bacteria 1292
81 Ga0207694_10128695 3300025924 Bacteria 2028
82 Ga0207650_11037126 3300025925 Bacteria 698
83 Ga0207664_10033401 3300025929 Bacteria 3952
84 Ga0207644_10008290 3300025931 Bacteria 6809
85 Ga0207669_10862855 3300025937 Bacteria 754
86 Ga0207711_10121563 3300025941 Unclassified 2332
87 Ga0207711_10360139 3300025941 Bacteria 1347
88 Ga0207711_10548867 3300025941 Bacteria 1078
89 Ga0207661_10150077 3300025944 Bacteria 2014
90 Ga0207661_10278183 3300025944 Bacteria 1495
91 Ga0207667_11029594 3300025949 Bacteria 809
92 Ga0207651_10122735 3300025960 Bacteria 1973
93 Ga0207668_10505127 3300025972 Unclassified 1041
94 Ga0207641_10306394 3300026088 Unclassified 1502
95 Ga0207676_10320447 3300026095 Bacteria 1423
96 Ga0207674_10370996 3300026116 Bacteria 1383
97 Ga0207674_10637067 3300026116 Bacteria 1029
98 Ga0207683_10350078 3300026121 Bacteria 1356
99 Ga0268264_10204920 3300028381 Bacteria 1807
100 Ga0265323_10000463 3300028653 Bacteria 22976
101 Ga0265338_10857286 3300028800 Unclassified 620
102 Ga0265330_10055042 3300031235 Unclassified 1738
103 Ga0265331_10026347 3300031250 Bacteria 2924
104 Ga0265331_10113378 3300031250 Bacteria 1242
105 Ga0265316_10001027 3300031344 Bacteria 30229
106 Ga0265316_10013489 3300031344 Bacteria 7252
107 Ga0265316_10194059 3300031344 Bacteria 1507
108 Ga0265316_10199110 3300031344 Bacteria 1485
109 Ga0265316_10339975 3300031344 Bacteria 1088
110 Ga0265316_10354049 3300031344 Bacteria 1062
111 Ga0265316_10442880 3300031344 Bacteria 932
112 Ga0265314_10120152 3300031711 Unclassified 1655
113 Ga0265314_10144975 3300031711 Bacteria 1463
114 Ga0265342_10061376 3300031712 Unclassified 2215
115 Ga0373945_0229329 3300035116 Unclassified 779
116 Ga0373953_0288055 3300035117 Bacteria 716
117 Ga0373943_0077551 3300035170 Bacteria 1697
118 Ga0373935_0569061 3300035692 Unclassified 827
119 Ga0373927_0219770 3300035695 Unclassified 1248
120 Ga0373933_0033460 3300035724 Bacteria 2991
121 Ga0373947_0119485 3300035725 Bacteria 1673
122 Ga0373937_0002255 3300036401 Bacteria 16083
123 Ga0373937_0164580 3300036401 Bacteria 2080
124 Ga0373937_0281064 3300036401 Bacteria 1572
125 Ga0373925_0194525 3300037068 Bacteria 1610
126 Ga0373925_0241103 3300037068 Bacteria 1448
127 Ga0373925_0449227 3300037068 Bacteria 1055
128 Ga0373925_0536531 3300037068 Bacteria 962
129 Ga0373925_0631279 3300037068 Unclassified 883
130 Ga0395905_0332560 3300037471 Unclassified 1410
131 Ga0436364_1047976 3300037853 Bacteria 2791
132 Ga0436364_1087209 3300037853 Unclassified 2678
133 Ga0436364_1167736 3300037853 Bacteria 2484
134 Ga0436365_0131410 3300039437 Bacteria 2828
135 Ga0451853_3211640 3300041512 Unclassified 647
136 Ga0466963_0285035 3300044694 Bacteria 1161
137 Ga0453684_1004024 3300044712 Unclassified 887
138 Ga0466957_1066972 3300044842 Bacteria 582
139 Ga0466959_0199859 3300045049 Bacteria 1392
140 Ga0495592_0024261 3300046454 Bacteria 4611
141 Ga0495651_0009748 3300046462 Bacteria 7387
142 Ga0495651_0113607 3300046462 Bacteria 1999
143 Ga0495653_0332444 3300046463 Unclassified 982
144 Ga0495580_0016979 3300046472 Bacteria 5453
145 Ga0495580_0034000 3300046472 Bacteria 3671
146 Ga0495580_0080898 3300046472 Bacteria 2264
147 Ga0495580_0561149 3300046472 Unclassified 757
148 Ga0495582_0257710 3300046473 Unclassified 1001
149 Ga0495662_0047355 3300046476 Bacteria 2075
150 Ga0495664_0009680 3300046477 Bacteria 5397
151 Ga0495664_0391118 3300046477 Bacteria 835
152 Ga0495594_0098982 3300046499 Bacteria 1640
153 Ga0495594_0723733 3300046499 Bacteria 562
154 Ga0495608_0041738 3300046511 Bacteria 3069
155 Ga0495618_0034264 3300046514 Bacteria 3184
156 Ga0495618_0433893 3300046514 Bacteria 799
157 Ga0495630_0225985 3300046517 Unclassified 1429
158 Ga0495630_0863883 3300046517 Bacteria 690
159 Ga0495652_0016207 3300046529 Bacteria 6666
160 Ga0495652_0300598 3300046529 Bacteria 1167
161 Ga0495665_0206428 3300046531 Unclassified 1018
162 Ga0495640_0031866 3300046533 Bacteria 3760
163 Ga0495640_0135614 3300046533 Bacteria 1590
164 Ga0495645_0001354 3300046543 Bacteria 16571
165 Ga0495645_0098933 3300046543 Unclassified 2076
166 Ga0495667_0135561 3300046559 Bacteria 1587
167 Ga0495634_0116872 3300046642 Bacteria 1710
168 Ga0495635_0317868 3300046663 Unclassified 1042
169 Ga0495635_0403871 3300046663 Bacteria 907
170 Ga0495657_0216611 3300046675 Unclassified 1162
171 Ga0495599_0255016 3300046678 Bacteria 1067
172 Ga0495623_0006868 3300046679 Bacteria 7403
173 Ga0495623_0013858 3300046679 Bacteria 5227
174 Ga0495623_0222874 3300046679 Unclassified 1073
175 Ga0495604_0044356 3300047317 Bacteria 3475
176 Ga0495604_0273224 3300047317 Bacteria 1144
177 Ga0495604_0314527 3300047317 Bacteria 1048
178 Ga0495604_0385659 3300047317 Bacteria 925
179 Ga0495604_0563949 3300047317 Unclassified 733
180 Ga0495674_0015726 3300047319 Bacteria 7064
181 Ga0495674_0032614 3300047319 Bacteria 4724
182 Ga0495674_0058739 3300047319 Bacteria 3361
183 Ga0495674_0158367 3300047319 Bacteria 1896
184 Ga0495680_0324110 3300047322 Unclassified 1078
185 Ga0495675_0068155 3300047444 Bacteria 2248
186 Ga0495675_0150680 3300047444 Bacteria 1437
187 Ga0495675_0329990 3300047444 Bacteria 901
188 Ga0495675_0593041 3300047444 Bacteria 629
189 Ga0495684_0020960 3300047471 Bacteria 5035
190 Ga0495684_0097431 3300047471 Bacteria 2225
191 Ga0495684_0623829 3300047471 Unclassified 724
192 Ga0495593_0298210 3300047673 Unclassified 806
193 Ga0495602_0028475 3300048088 Bacteria 5345
194 Ga0495602_0039448 3300048088 Bacteria 4349
195 Ga0495602_0237869 3300048088 Bacteria 1364
196 Ga0495602_0377681 3300048088 Bacteria 1016
197 Ga0496112_0174789 3300048915 Bacteria 2113
198 Ga0496115_0146331 3300048918 Bacteria 1950
199 Ga0070704_101066804
200 Ga0070683_100040266
201 Ga0070683_100174579
202 Ga0070670_101242039
203 Ga0070666_10742935
204 Ga0070680_100371541
205 Ga0070689_101338683
206 Ga0070671_100069182
207 Ga0070674_101115385
208 Ga0070673_100023640
209 Ga0070673_100466172
210 Ga0070667_100316145
211 Ga0070667_101292514
212 Ga0070714_100000593
213 Ga0070713_100015462
214 Ga0070713_100018527
215 Ga0070713_100583285
216 Ga0070711_100071476
217 Ga0068867_100213492
218 Ga0070679_100318304
219 Ga0070684_100060548
220 Ga0070684_100093263
221 Ga0070672_100926761
222 Ga0068857_100328944
223 Ga0068859_100411029
224 Ga0068859_100642950
225 Ga0068863_100532353
226 Ga0070717_10027790
227 Ga0070717_10089760
228 Ga0070717_10409579
229 Ga0070712_100054601
230 Ga0070712_100618129
231 Ga0097621_100389577
232 Ga0097621_101342428
233 Ga0068871_100195991
234 Ga0097620_100411082
235 Ga0097620_100642907
236 Ga0097620_101557036
237 Ga0105240_10014314
238 Ga0105240_10099508
239 Ga0105245_10631542
240 Ga0105243_10938100
241 Ga0105241_11283603
242 Ga0105248_10147897
243 Ga0105248_10516122
244 Ga0105248_10521918
245 Ga0105237_10034282
246 Ga0105237_10112039
247 Ga0105238_10354308
248 Ga0105239_10031212
249 Ga0157370_10292683
250 Ga0157370_10387179
251 Ga0157370_10913775
252 Ga0157369_10083573
253 Ga0157369_10193207
254 Ga0157374_10408979
255 Ga0157374_10432243
256 Ga0157374_10554758
257 Ga0157374_10641506
258 Ga0157374_11684022
259 Ga0157378_10265295
260 Ga0157372_10130801
261 Ga0157372_11567372
262 Ga0157375_10322955
263 Ga0157375_11624816
264 Ga0163163_10124591
265 Ga0163163_10296494
266 Ga0163163_10505346
267 Ga0157376_10040277
268 Ga0157376_10062284
269 Ga0157376_10435112
270 Ga0157376_11047591
271 Ga0157376_11659126
272 Ga0163161_11059311
273 Ga0206352_10946066
274 Ga0213876_10045139
275 Ga0207695_10058084
276 Ga0207695_10360225
277 Ga0207671_10093500
278 Ga0207693_10286090
279 Ga0207694_10128695
280 Ga0207650_11037126
281 Ga0207664_10033401
282 Ga0207644_10008290
283 Ga0207669_10862855
284 Ga0207711_10121563
285 Ga0207711_10360139
286 Ga0207711_10548867
287 Ga0207661_10150077
288 Ga0207661_10278183
289 Ga0207667_11029594
290 Ga0207651_10122735
291 Ga0207668_10505127
292 Ga0207641_10306394
293 Ga0207676_10320447
294 Ga0207674_10370996
295 Ga0207674_10637067
296 Ga0207683_10350078
297 Ga0268264_10204920
298 Ga0265323_10000463
299 Ga0265338_10857286
300 Ga0265330_10055042
301 Ga0265331_10026347
302 Ga0265331_10113378
303 Ga0265316_10001027
304 Ga0265316_10013489
305 Ga0265316_10194059
306 Ga0265316_10199110
307 Ga0265316_10339975
308 Ga0265316_10354049
309 Ga0265316_10442880
310 Ga0265314_10120152
311 Ga0265314_10144975
312 Ga0265342_10061376
313 Ga0373945_0229329
314 Ga0373953_0288055
315 Ga0373943_0077551
316 Ga0373935_0569061
317 Ga0373927_0219770
318 Ga0373933_0033460
319 Ga0373947_0119485
320 Ga0373937_0002255
321 Ga0373937_0164580
322 Ga0373937_0281064
323 Ga0373925_0194525
324 Ga0373925_0241103
325 Ga0373925_0449227
326 Ga0373925_0536531
327 Ga0373925_0631279
328 Ga0395905_0332560
329 Ga0436364_1047976
330 Ga0436364_1087209
331 Ga0436364_1167736
332 Ga0436365_0131410
333 Ga0451853_3211640
334 Ga0466963_0285035
335 Ga0453684_1004024
336 Ga0466957_1066972
337 Ga0466959_0199859
338 Ga0495592_0024261
339 Ga0495651_0009748
340 Ga0495651_0113607
341 Ga0495653_0332444
342 Ga0495580_0016979
343 Ga0495580_0034000
344 Ga0495580_0080898
345 Ga0495580_0561149
346 Ga0495582_0257710
347 Ga0495662_0047355
348 Ga0495664_0009680
349 Ga0495664_0391118
350 Ga0495594_0098982
351 Ga0495594_0723733
352 Ga0495608_0041738
353 Ga0495618_0034264
354 Ga0495618_0433893
355 Ga0495630_0225985
356 Ga0495630_0863883
357 Ga0495652_0016207
358 Ga0495652_0300598
359 Ga0495665_0206428
360 Ga0495640_0031866
361 Ga0495640_0135614
362 Ga0495645_0001354
363 Ga0495645_0098933
364 Ga0495667_0135561
365 Ga0495634_0116872
366 Ga0495635_0317868
367 Ga0495635_0403871
368 Ga0495657_0216611
369 Ga0495599_0255016
370 Ga0495623_0006868
371 Ga0495623_0013858
372 Ga0495623_0222874
373 Ga0495604_0044356
374 Ga0495604_0273224
375 Ga0495604_0314527
376 Ga0495604_0385659
377 Ga0495604_0563949
378 Ga0495674_0015726
379 Ga0495674_0032614
380 Ga0495674_0058739
381 Ga0495674_0158367
382 Ga0495680_0324110
383 Ga0495675_0068155
384 Ga0495675_0150680
385 Ga0495675_0329990
386 Ga0495675_0593041
387 Ga0495684_0020960
388 Ga0495684_0097431
389 Ga0495684_0623829
390 Ga0495593_0298210
391 Ga0495602_0028475
392 Ga0495602_0039448
393 Ga0495602_0237869
394 Ga0495602_0377681
395 Ga0496112_0174789
396 Ga0496115_0146331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

33

162

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9569 2 172
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9548 2 172
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9336 1 173
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9304 2 172
5i8u-assembly4.cif.gz_E crystal structure of the rv1700 (mt adprase) e142q mutant 0.9286 1 173
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9568 2 172 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9475 2 167 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9303 2 172 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9146 1 173 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9047 1 173 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2V8UYA4-F1-model_v4 NUDIX hydrolase 0.9958 1 172 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A7V6D0N0-F1-model_v4 NUDIX hydrolase 0.994 1 173 GO:0006753
GO:0016462
GO:0019693
AF-A0A7V6ZW39-F1-model_v4 NUDIX hydrolase 0.9891 35 172 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A7S1EBU3-F1-model_v4 Nudix hydrolase domain-containing protein 0.9887 35 173 GO:0005829
GO:0006753
GO:0019693
AF-A0A1F2RKR6-F1-model_v4 Nudix hydrolase domain-containing protein 0.983 3 168 GO:0005829
GO:0006753
GO:0019693

Map