F304137

General Info

Members Datasets Scaffolds Average Seq Length
198 129 198 85

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100093640|Ga0070665_1000936404
Length 98
Sequence VVLLYAESNGDACMESALTVKGQATIPKAIREHLRLKPGDRVKFFVHPDGSVVLLPKLPAAALRGIVKSRRSRPVTIAEMTEAAAEGAAGVSPRTSRR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
51 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 1.01
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10094387 3300003322 Bacteria 2415
2 Ga0070682_100413960 3300005337 Unclassified 1023
3 Ga0070682_101958137 3300005337 Bacteria 514
4 Ga0070709_10275686 3300005434 Unclassified 1220
5 Ga0070709_11666346 3300005434 Unclassified 520
6 Ga0070714_100284885 3300005435 Bacteria 1536
7 Ga0070713_100001235 3300005436 Bacteria 16346
8 Ga0070713_100081558 3300005436 Bacteria 2760
9 Ga0070713_100687812 3300005436 Unclassified 976
10 Ga0070713_101395134 3300005436 Unclassified 679
11 Ga0070710_10014199 3300005437 Unclassified 4005
12 Ga0070710_10047564 3300005437 Bacteria 2393
13 Ga0070711_100000908 3300005439 Bacteria 15590
14 Ga0070711_100009261 3300005439 Bacteria 6057
15 Ga0070705_100565023 3300005440 Unclassified 874
16 Ga0070708_100004390 3300005445 Bacteria 11077
17 Ga0070708_100066146 3300005445 Bacteria 3244
18 Ga0070681_10001849 3300005458 Bacteria 19110
19 Ga0070681_10245190 3300005458 Bacteria 1705
20 Ga0070681_10426897 3300005458 Unclassified 1237
21 Ga0070706_100311131 3300005467 Unclassified 1469
22 Ga0070707_100374205 3300005468 Bacteria 1384
23 Ga0070707_100446157 3300005468 Unclassified 1254
24 Ga0070707_101630945 3300005468 Unclassified 612
25 Ga0070698_100018601 3300005471 Bacteria 7313
26 Ga0070698_100051923 3300005471 Bacteria 4173
27 Ga0070699_100107343 3300005518 Unclassified 2449
28 Ga0070699_100284762 3300005518 Bacteria 1481
29 Ga0070699_101148763 3300005518 Bacteria 712
30 Ga0070679_101981078 3300005530 Bacteria 531
31 Ga0070684_100423010 3300005535 Unclassified 1230
32 Ga0070697_100000469 3300005536 Bacteria 30871
33 Ga0070697_100605768 3300005536 Unclassified 963
34 Ga0070697_100965969 3300005536 Bacteria 757
35 Ga0068853_100934214 3300005539 Unclassified 834
36 Ga0070665_100093640 3300005548 Unclassified 3009
37 Ga0068855_100763843 3300005563 Bacteria 1030
38 Ga0068864_102180603 3300005618 Bacteria 560
39 Ga0068863_100868397 3300005841 Bacteria 901
40 Ga0068860_100167763 3300005843 Unclassified 2120
41 Ga0081455_10275765 3300005937 Bacteria 1217
42 Ga0070717_10027057 3300006028 Bacteria 4582
43 Ga0070717_10176389 3300006028 Bacteria 1861
44 Ga0070717_11726576 3300006028 Unclassified 566
45 Ga0070715_10030805 3300006163 Unclassified 2172
46 Ga0070715_10445592 3300006163 Bacteria 730
47 Ga0070716_100015136 3300006173 Bacteria 3957
48 Ga0070716_100045846 3300006173 Unclassified 2457
49 Ga0070716_100088569 3300006173 Unclassified 1867
50 Ga0070716_100390136 3300006173 Unclassified 998
51 Ga0070712_100000430 3300006175 Bacteria 24028
52 Ga0070712_100002436 3300006175 Bacteria 11468
53 Ga0075433_10071415 3300006852 Bacteria 3052
54 Ga0075434_100012196 3300006871 Bacteria 8142
55 Ga0075434_100581700 3300006871 Bacteria 1139
56 Ga0075434_101025466 3300006871 Unclassified 839
57 Ga0075436_100025395 3300006914 Bacteria 4077
58 Ga0075436_100181276 3300006914 Unclassified 1488
59 Ga0075436_100194242 3300006914 Bacteria 1436
60 Ga0075436_100556537 3300006914 Unclassified 842
61 Ga0075435_100119540 3300007076 Unclassified 2198
62 Ga0075435_100867215 3300007076 Unclassified 787
63 Ga0099794_10025737 3300007265 Plasmid 2713
64 Ga0099794_10030137 3300007265 Bacteria 2531
65 Ga0099794_10039489 3300007265 Bacteria 2240
66 Ga0105240_10049196 3300009093 Bacteria 5322
67 Ga0105240_10359781 3300009093 Unclassified 1649
68 Ga0105240_10720031 3300009093 Unclassified 1087
69 Ga0105247_10663735 3300009101 Unclassified 780
70 Ga0105241_11590230 3300009174 Bacteria 632
71 Ga0105248_10522403 3300009177 Unclassified 1339
72 Ga0105237_10073487 3300009545 Bacteria 3411
73 Ga0105237_10456988 3300009545 Unclassified 1283
74 Ga0105238_10994659 3300009551 Unclassified 859
75 Ga0105249_10531647 3300009553 Unclassified 1224
76 Ga0099796_10013682 3300010159 Bacteria 2324
77 Ga0157373_10736250 3300013100 Unclassified 724
78 Ga0157369_10377077 3300013105 Unclassified 1472
79 Ga0157369_10455193 3300013105 Unclassified 1325
80 Ga0157372_10283661 3300013307 Bacteria 1926
81 Ga0157372_11158657 3300013307 Unclassified 894
82 Ga0157372_12391981 3300013307 Unclassified 607
83 Ga0157380_12553187 3300014326 Bacteria 577
84 Ga0213873_10158955 3300021358 Bacteria 684
85 Ga0213872_10266421 3300021361 Unclassified 718
86 Ga0213874_10007025 3300021377 Plasmid 2688
87 Ga0213876_10267615 3300021384 Unclassified 908
88 Ga0224570_100887 3300022730 Bacteria 2379
89 Ga0224571_115336 3300022734 Unclassified 551
90 Ga0224572_1009439 3300024225 Unclassified 1820
91 Ga0228598_1006290 3300024227 Bacteria 2460
92 Ga0207692_10015294 3300025898 Bacteria 3373
93 Ga0207710_10325230 3300025900 Unclassified 780
94 Ga0207685_10018518 3300025905 Unclassified 2275
95 Ga0207699_10106055 3300025906 Bacteria 1793
96 Ga0207699_11449302 3300025906 Unclassified 508
97 Ga0207684_10001186 3300025910 Bacteria 29163
98 Ga0207707_10049435 3300025912 Bacteria 3663
99 Ga0207707_10352615 3300025912 Unclassified 1268
100 Ga0207707_11223516 3300025912 Bacteria 607
101 Ga0207695_10170267 3300025913 Bacteria 2104
102 Ga0207695_10311552 3300025913 Bacteria 1464
103 Ga0207671_10657581 3300025914 Unclassified 834
104 Ga0207693_10005878 3300025915 Bacteria 10179
105 Ga0207693_10060225 3300025915 Bacteria 2974
106 Ga0207663_10007538 3300025916 Bacteria 5648
107 Ga0207663_10072721 3300025916 Unclassified 2223
108 Ga0207663_10219513 3300025916 Unclassified 1382
109 Ga0207660_10147830 3300025917 Unclassified 1803
110 Ga0207646_10000405 3300025922 Bacteria 57762
111 Ga0207646_10751219 3300025922 Bacteria 870
112 Ga0207646_11585147 3300025922 Bacteria 565
113 Ga0207700_10051990 3300025928 Bacteria 3061
114 Ga0207700_10065518 3300025928 Plasmid 2772
115 Ga0207700_10198342 3300025928 Bacteria 1690
116 Ga0207700_10529195 3300025928 Bacteria 1045
117 Ga0207700_10882092 3300025928 Unclassified 800
118 Ga0207664_10100322 3300025929 Bacteria 2390
119 Ga0207665_10004134 3300025939 Bacteria 9669
120 Ga0207665_10019522 3300025939 Bacteria 4457
121 Ga0207665_10243137 3300025939 Bacteria 1327
122 Ga0207665_11617773 3300025939 Unclassified 513
123 Ga0207661_10529098 3300025944 Bacteria 1079
124 Ga0207712_11320940 3300025961 Unclassified 645
125 Ga0207639_10858347 3300026041 Unclassified 847
126 Ga0207641_10351621 3300026088 Bacteria 1405
127 Ga0207676_11970785 3300026095 Bacteria 583
128 Ga0209588_1048695 3300027671 Unclassified 1372
129 Ga0209588_1114177 3300027671 Bacteria 866
130 Ga0265356_1000154 3300028017 Bacteria 12468
131 Ga0268266_10000194 3300028379 Bacteria 106020
132 Ga0265762_1131725 3300030760 Unclassified 581
133 Ga0265760_10007336 3300031090 Bacteria 3157
134 Ga0265760_10008004 3300031090 Bacteria 3018
135 Ga0307416_100387535 3300032002 Bacteria 1430
136 Ga0373950_0060518 3300034818 Bacteria 760
137 Ga0373934_0347702 3300035086 Unclassified 617
138 Ga0373957_0023119 3300035120 Bacteria 2221
139 Ga0373943_0290903 3300035170 Unclassified 926
140 Ga0373955_0825444 3300035172 Unclassified 570
141 Ga0373924_0115374 3300035410 Unclassified 1163
142 Ga0373931_0429436 3300035691 Unclassified 841
143 Ga0373935_0207867 3300035692 Bacteria 1355
144 Ga0373927_0055297 3300035695 Bacteria 2567
145 Ga0373933_0070389 3300035724 Bacteria 2128
146 Ga0373947_0228443 3300035725 Bacteria 1225
147 Ga0373947_0550579 3300035725 Unclassified 785
148 Ga0373937_0013332 3300036401 Bacteria 7242
149 Ga0373925_0008776 3300037068 Bacteria 7363
150 Ga0373925_1387264 3300037068 Unclassified 576
151 Ga0436364_0762739 3300037853 Unclassified 1000
152 Ga0436364_0784693 3300037853 Unclassified 609
153 Ga0436360_0443618 3300039438 Unclassified 564
154 Ga0436360_0507287 3300039438 Bacteria 1816
155 Ga0436360_1008046 3300039438 Bacteria 892
156 Ga0436361_0663931 3300039447 Unclassified 786
157 Ga0436363_0559917 3300039450 Bacteria 660
158 Ga0436363_1543130 3300039450 Plasmid 2861
159 Ga0436362_0640065 3300039453 Bacteria 673
160 Ga0436362_1044804 3300039453 Bacteria 2070
161 Ga0451807_1306554 3300041486 Unclassified 512
162 Ga0495592_0178892 3300046454 Bacteria 1446
163 Ga0495638_0114401 3300046460 Bacteria 1600
164 Ga0495651_0000645 3300046462 Bacteria 26939
165 Ga0495651_0175088 3300046462 Bacteria 1524
166 Ga0495653_0141199 3300046463 Unclassified 1694
167 Ga0495664_0046717 3300046477 Unclassified 2569
168 Ga0495664_0165369 3300046477 Bacteria 1342
169 Ga0495608_0512607 3300046511 Unclassified 726
170 Ga0495628_0256515 3300046516 Bacteria 1304
171 Ga0495630_0415794 3300046517 Bacteria 1030
172 Ga0495652_0367399 3300046529 Bacteria 1026
173 Ga0495640_0259827 3300046533 Bacteria 1085
174 Ga0495587_0234822 3300046536 Bacteria 1033
175 Ga0495667_0070939 3300046559 Bacteria 2273
176 Ga0495635_0490879 3300046663 Unclassified 809
177 Ga0495657_0330720 3300046675 Bacteria 904
178 Ga0495599_0031526 3300046678 Bacteria 3327
179 Ga0495613_0587592 3300046689 Unclassified 742
180 Ga0495600_0022351 3300046809 Bacteria 4059
181 Ga0495674_0667487 3300047319 Unclassified 818
182 Ga0495680_0001235 3300047322 Bacteria 28051
183 Ga0495680_0789035 3300047322 Unclassified 621
184 Ga0495675_0129600 3300047444 Unclassified 1568
185 Ga0496115_0004387 3300048918 Bacteria 10214
186 Ga0501035_1566240 3300049822 Unclassified 501
187 nmdc:mga0n895_298003_c1 3300050512 Bacteria 1635
188 nmdc:mga0n895_387676_c1 3300050512 Bacteria 1413
189 nmdc:mga0rr50_146416_c1 3300050513 Unclassified 1905
190 nmdc:mga08x19_10554_c1 3300050514 Bacteria 5551
191 nmdc:mga08x19_249348_c1 3300050514 Bacteria 1225
192 nmdc:mga08x19_526215_c1 3300050514 Unclassified 836
193 nmdc:mga0a205_10437_c3 3300050515 Bacteria 4267
194 Ga0495601_0498648 3300053077 Bacteria 786
195 Ga0495619_0783885 3300053085 Unclassified 645
196 Ga0500644_0449033 3300053088 Unclassified 565
197 Ga0500583_0126179 3300053092 Bacteria 1268
198 Ga0500645_008396 3300053730 Bacteria 3532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053730 Ga0500645_008396 Ga0500645_008396_2588_2854 77
2 3300005536 Ga0070697_100965969 Ga0070697_1009659691 78
3 3300021384 Ga0213876_10267615 Ga0213876_102676152 81
4 3300005440 Ga0070705_100565023 Ga0070705_1005650232 82
5 3300025928 Ga0207700_10529195 Ga0207700_105291952 82
6 3300035086 Ga0373934_0347702 Ga0373934_0347702_200_451 82
7 3300035120 Ga0373957_0023119 Ga0373957_0023119_445_696 82
8 3300035170 Ga0373943_0290903 Ga0373943_0290903_551_802 82
9 3300035172 Ga0373955_0825444 Ga0373955_0825444_230_481 82
10 3300035410 Ga0373924_0115374 Ga0373924_0115374_240_491 82
11 3300035692 Ga0373935_0207867 Ga0373935_0207867_732_983 82
12 3300035695 Ga0373927_0055297 Ga0373927_0055297_1413_1664 82
13 3300035724 Ga0373933_0070389 Ga0373933_0070389_1288_1539 82
14 3300035725 Ga0373947_0228443 Ga0373947_0228443_807_1058 82
15 3300036401 Ga0373937_0013332 Ga0373937_0013332_5434_5685 82
16 3300037068 Ga0373925_0008776 Ga0373925_0008776_5574_5825 82
17 3300039438 Ga0436360_0507287 Ga0436360_0507287_282_530 82
18 3300046454 Ga0495592_0178892 Ga0495592_0178892_669_920 82
19 3300046462 Ga0495651_0175088 Ga0495651_0175088_502_753 82
20 3300046477 Ga0495664_0165369 Ga0495664_0165369_449_700 82
21 3300046516 Ga0495628_0256515 Ga0495628_0256515_677_928 82
22 3300046517 Ga0495630_0415794 Ga0495630_0415794_577_828 82
23 3300046529 Ga0495652_0367399 Ga0495652_0367399_259_510 82
24 3300046533 Ga0495640_0259827 Ga0495640_0259827_638_889 82
25 3300046536 Ga0495587_0234822 Ga0495587_0234822_488_739 82
26 3300046663 Ga0495635_0490879 Ga0495635_0490879_240_491 82
27 3300046675 Ga0495657_0330720 Ga0495657_0330720_120_371 82
28 3300046678 Ga0495599_0031526 Ga0495599_0031526_2476_2727 82
29 3300047319 Ga0495674_0667487 Ga0495674_0667487_75_326 82
30 3300047322 Ga0495680_0789035 Ga0495680_0789035_81_332 82
31 3300053077 Ga0495601_0498648 Ga0495601_0498648_513_764 82
32 3300053085 Ga0495619_0783885 Ga0495619_0783885_81_332 82
33 3300003322 rootL2_10094387 rootL2_100943874 83
34 3300005337 Ga0070682_100413960 Ga0070682_1004139602 83
35 3300005337 Ga0070682_101958137 Ga0070682_1019581372 83
36 3300005434 Ga0070709_10275686 Ga0070709_102756861 83
37 3300005434 Ga0070709_11666346 Ga0070709_116663461 83
38 3300005435 Ga0070714_100284885 Ga0070714_1002848852 83
39 3300005436 Ga0070713_100001235 Ga0070713_1000012357 83
40 3300005436 Ga0070713_100081558 Ga0070713_1000815582 83
41 3300005436 Ga0070713_100687812 Ga0070713_1006878122 83
42 3300005436 Ga0070713_101395134 Ga0070713_1013951341 83
43 3300005437 Ga0070710_10014199 Ga0070710_100141994 83
44 3300005437 Ga0070710_10047564 Ga0070710_100475643 83
45 3300005439 Ga0070711_100000908 Ga0070711_10000090811 83
46 3300005439 Ga0070711_100009261 Ga0070711_1000092615 83
47 3300005445 Ga0070708_100004390 Ga0070708_10000439011 83
48 3300005445 Ga0070708_100066146 Ga0070708_1000661464 83
49 3300005458 Ga0070681_10001849 Ga0070681_100018492 83
50 3300005458 Ga0070681_10245190 Ga0070681_102451902 83
51 3300005458 Ga0070681_10426897 Ga0070681_104268972 83
52 3300005467 Ga0070706_100311131 Ga0070706_1003111312 83
53 3300005468 Ga0070707_100374205 Ga0070707_1003742053 83
54 3300005468 Ga0070707_100446157 Ga0070707_1004461573 83
55 3300005468 Ga0070707_101630945 Ga0070707_1016309451 83
56 3300005471 Ga0070698_100018601 Ga0070698_1000186019 83
57 3300005471 Ga0070698_100051923 Ga0070698_1000519232 83
58 3300005518 Ga0070699_100107343 Ga0070699_1001073433 83
59 3300005518 Ga0070699_100284762 Ga0070699_1002847623 83
60 3300005518 Ga0070699_101148763 Ga0070699_1011487631 83
61 3300005530 Ga0070679_101981078 Ga0070679_1019810782 83
62 3300005535 Ga0070684_100423010 Ga0070684_1004230102 83
63 3300005536 Ga0070697_100000469 Ga0070697_1000004692 83
64 3300005536 Ga0070697_100605768 Ga0070697_1006057682 83
65 3300005539 Ga0068853_100934214 Ga0068853_1009342142 83
66 3300005548 Ga0070665_100093640 Ga0070665_1000936404 83
67 3300005563 Ga0068855_100763843 Ga0068855_1007638432 83
68 3300005618 Ga0068864_102180603 Ga0068864_1021806031 83
69 3300005841 Ga0068863_100868397 Ga0068863_1008683973 83
70 3300005843 Ga0068860_100167763 Ga0068860_1001677632 83
71 3300005937 Ga0081455_10275765 Ga0081455_102757652 83
72 3300006028 Ga0070717_10027057 Ga0070717_100270575 83
73 3300006028 Ga0070717_10176389 Ga0070717_101763892 83
74 3300006028 Ga0070717_11726576 Ga0070717_117265761 83
75 3300006163 Ga0070715_10030805 Ga0070715_100308052 83
76 3300006163 Ga0070715_10445592 Ga0070715_104455921 83
77 3300006173 Ga0070716_100015136 Ga0070716_1000151365 83
78 3300006173 Ga0070716_100045846 Ga0070716_1000458463 83
79 3300006173 Ga0070716_100088569 Ga0070716_1000885693 83
80 3300006173 Ga0070716_100390136 Ga0070716_1003901362 83
81 3300006175 Ga0070712_100000430 Ga0070712_1000004309 83
82 3300006175 Ga0070712_100002436 Ga0070712_1000024367 83
83 3300006852 Ga0075433_10071415 Ga0075433_100714155 83
84 3300006871 Ga0075434_100012196 Ga0075434_10001219610 83
85 3300006871 Ga0075434_100581700 Ga0075434_1005817002 83
86 3300006871 Ga0075434_101025466 Ga0075434_1010254662 83
87 3300006914 Ga0075436_100025395 Ga0075436_1000253955 83
88 3300006914 Ga0075436_100181276 Ga0075436_1001812763 83
89 3300006914 Ga0075436_100194242 Ga0075436_1001942423 83
90 3300006914 Ga0075436_100556537 Ga0075436_1005565372 83
91 3300007076 Ga0075435_100119540 Ga0075435_1001195402 83
92 3300007076 Ga0075435_100867215 Ga0075435_1008672152 83
93 3300007265 Ga0099794_10025737 Ga0099794_100257372 83
94 3300007265 Ga0099794_10030137 Ga0099794_100301373 83
95 3300007265 Ga0099794_10039489 Ga0099794_100394892 83
96 3300009093 Ga0105240_10049196 Ga0105240_100491965 83
97 3300009093 Ga0105240_10359781 Ga0105240_103597812 83
98 3300009093 Ga0105240_10720031 Ga0105240_107200312 83
99 3300009101 Ga0105247_10663735 Ga0105247_106637351 83
100 3300009174 Ga0105241_11590230 Ga0105241_115902302 83
101 3300009177 Ga0105248_10522403 Ga0105248_105224032 83
102 3300009545 Ga0105237_10073487 Ga0105237_100734874 83
103 3300009545 Ga0105237_10456988 Ga0105237_104569882 83
104 3300009551 Ga0105238_10994659 Ga0105238_109946592 83
105 3300009553 Ga0105249_10531647 Ga0105249_105316472 83
106 3300010159 Ga0099796_10013682 Ga0099796_100136823 83
107 3300013100 Ga0157373_10736250 Ga0157373_107362502 83
108 3300013105 Ga0157369_10377077 Ga0157369_103770772 83
109 3300013105 Ga0157369_10455193 Ga0157369_104551933 83
110 3300013307 Ga0157372_10283661 Ga0157372_102836613 83
111 3300013307 Ga0157372_11158657 Ga0157372_111586572 83
112 3300013307 Ga0157372_12391981 Ga0157372_123919812 83
113 3300014326 Ga0157380_12553187 Ga0157380_125531872 83
114 3300021358 Ga0213873_10158955 Ga0213873_101589551 83
115 3300021361 Ga0213872_10266421 Ga0213872_102664211 83
116 3300021377 Ga0213874_10007025 Ga0213874_100070251 83
117 3300022730 Ga0224570_100887 Ga0224570_1008873 83
118 3300022734 Ga0224571_115336 Ga0224571_1153361 83
119 3300024225 Ga0224572_1009439 Ga0224572_10094392 83
120 3300024227 Ga0228598_1006290 Ga0228598_10062902 83
121 3300025898 Ga0207692_10015294 Ga0207692_100152943 83
122 3300025900 Ga0207710_10325230 Ga0207710_103252301 83
123 3300025905 Ga0207685_10018518 Ga0207685_100185181 83
124 3300025906 Ga0207699_10106055 Ga0207699_101060551 83
125 3300025906 Ga0207699_11449302 Ga0207699_114493021 83
126 3300025910 Ga0207684_10001186 Ga0207684_1000118622 83
127 3300025912 Ga0207707_10049435 Ga0207707_100494354 83
128 3300025912 Ga0207707_10352615 Ga0207707_103526152 83
129 3300025912 Ga0207707_11223516 Ga0207707_112235162 83
130 3300025913 Ga0207695_10170267 Ga0207695_101702672 83
131 3300025913 Ga0207695_10311552 Ga0207695_103115522 83
132 3300025914 Ga0207671_10657581 Ga0207671_106575812 83
133 3300025915 Ga0207693_10005878 Ga0207693_100058784 83
134 3300025915 Ga0207693_10060225 Ga0207693_100602251 83
135 3300025916 Ga0207663_10007538 Ga0207663_100075383 83
136 3300025916 Ga0207663_10072721 Ga0207663_100727213 83
137 3300025916 Ga0207663_10219513 Ga0207663_102195132 83
138 3300025917 Ga0207660_10147830 Ga0207660_101478302 83
139 3300025922 Ga0207646_10000405 Ga0207646_1000040520 83
140 3300025922 Ga0207646_10751219 Ga0207646_107512192 83
141 3300025922 Ga0207646_11585147 Ga0207646_115851471 83
142 3300025928 Ga0207700_10051990 Ga0207700_100519905 83
143 3300025928 Ga0207700_10065518 Ga0207700_100655182 83
144 3300025928 Ga0207700_10198342 Ga0207700_101983422 83
145 3300025928 Ga0207700_10882092 Ga0207700_108820923 83
146 3300025929 Ga0207664_10100322 Ga0207664_101003223 83
147 3300025939 Ga0207665_10004134 Ga0207665_100041347 83
148 3300025939 Ga0207665_10019522 Ga0207665_100195224 83
149 3300025939 Ga0207665_10243137 Ga0207665_102431373 83
150 3300025939 Ga0207665_11617773 Ga0207665_116177732 83
151 3300025944 Ga0207661_10529098 Ga0207661_105290981 83
152 3300025961 Ga0207712_11320940 Ga0207712_113209402 83
153 3300026041 Ga0207639_10858347 Ga0207639_108583472 83
154 3300026088 Ga0207641_10351621 Ga0207641_103516213 83
155 3300026095 Ga0207676_11970785 Ga0207676_119707852 83
156 3300027671 Ga0209588_1048695 Ga0209588_10486952 83
157 3300027671 Ga0209588_1114177 Ga0209588_11141772 83
158 3300028017 Ga0265356_1000154 Ga0265356_100015413 83
159 3300028379 Ga0268266_10000194 Ga0268266_1000019479 83
160 3300030760 Ga0265762_1131725 Ga0265762_11317252 83
161 3300031090 Ga0265760_10007336 Ga0265760_100073364 83
162 3300031090 Ga0265760_10008004 Ga0265760_100080044 83
163 3300032002 Ga0307416_100387535 Ga0307416_1003875352 83
164 3300034818 Ga0373950_0060518 Ga0373950_0060518_196_453 83
165 3300035691 Ga0373931_0429436 Ga0373931_0429436_567_824 83
166 3300035725 Ga0373947_0550579 Ga0373947_0550579_118_384 83
167 3300037068 Ga0373925_1387264 Ga0373925_1387264_157_423 83
168 3300037853 Ga0436364_0762739 Ga0436364_0762739_371_730 83
169 3300037853 Ga0436364_0784693 Ga0436364_0784693_98_358 83
170 3300039438 Ga0436360_0443618 Ga0436360_0443618_148_405 83
171 3300039438 Ga0436360_1008046 Ga0436360_1008046_228_482 83
172 3300039447 Ga0436361_0663931 Ga0436361_0663931_507_764 83
173 3300039450 Ga0436363_0559917 Ga0436363_0559917_194_445 83
174 3300039450 Ga0436363_1543130 Ga0436363_1543130_2439_2696 83
175 3300039453 Ga0436362_0640065 Ga0436362_0640065_131_388 83
176 3300039453 Ga0436362_1044804 Ga0436362_1044804_1635_1889 83
177 3300041486 Ga0451807_1306554 Ga0451807_1306554_130_399 83
178 3300046460 Ga0495638_0114401 Ga0495638_0114401_1047_1307 83
179 3300046462 Ga0495651_0000645 Ga0495651_0000645_184_441 83
180 3300046463 Ga0495653_0141199 Ga0495653_0141199_1221_1478 83
181 3300046477 Ga0495664_0046717 Ga0495664_0046717_212_469 83
182 3300046511 Ga0495608_0512607 Ga0495608_0512607_447_713 83
183 3300046559 Ga0495667_0070939 Ga0495667_0070939_221_478 83
184 3300046689 Ga0495613_0587592 Ga0495613_0587592_109_375 83
185 3300046809 Ga0495600_0022351 Ga0495600_0022351_15_272 83
186 3300047322 Ga0495680_0001235 Ga0495680_0001235_204_461 83
187 3300047444 Ga0495675_0129600 Ga0495675_0129600_1267_1524 83
188 3300048918 Ga0496115_0004387 Ga0496115_0004387_3422_3679 83
189 3300049822 Ga0501035_1566240 Ga0501035_1566240_64_333 83
190 3300050512 nmdc:mga0n895_298003_c1 nmdc:mga0n895_298003_c1_1101_1358 83
191 3300050512 nmdc:mga0n895_387676_c1 nmdc:mga0n895_387676_c1_381_638 83
192 3300050513 nmdc:mga0rr50_146416_c1 nmdc:mga0rr50_146416_c1_464_721 83
193 3300050514 nmdc:mga08x19_10554_c1 nmdc:mga08x19_10554_c1_4983_5252 83
194 3300050514 nmdc:mga08x19_249348_c1 nmdc:mga08x19_249348_c1_451_705 83
195 3300050514 nmdc:mga08x19_526215_c1 nmdc:mga08x19_526215_c1_417_674 83
196 3300050515 nmdc:mga0a205_10437_c3 nmdc:mga0a205_10437_c3_1529_1786 83
197 3300053088 Ga0500644_0449033 Ga0500644_0449033_166_426 83
198 3300053092 Ga0500583_0126179 Ga0500583_0126179_761_1012 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

20

61

0.95

PF15937

PrlF_antitoxin

prlF antitoxin for toxin YhaV_toxin

15

62

0.95

Feature Viewer

pLDDT pTM Quality
71.71 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map