F303832

General Info

Members Datasets Scaffolds Average Seq Length
198 141 396 389

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10103199|rootH1_101031992
Length 415
Sequence MPRIRSRFPPIEMTNATLNENYSKLDRLQLLAILGLMLIGALFVASATTVNSGEMDKAWYAQTWFRQIIWYALGFGVAGAVCLVDYHSLARWAMVGYWGMIVCLVAVLIPFIGKTHGWGARRWIDLPFFQFQPSEFAKLAFILAGANFWCRPPDELKQPKIFWLGIGMMMLPFVLIMKEPDLGSALVLLPTGLIMMLVAGTPKKYLIWLVGGVGLVGMLFVADVLFAPKHFRIPMQDYQRQRLLVYFGASFAGSDASAQERSEARRTQLEKSYQVRQALISVGSGGMFGKGWRQGQQTALNFLPAGAAHNDFIFSVIAEEEGFVGSVVVLTLYAVVLFTGLRTAGQARDRLGKLLAVGVVTLLFSHVFVNIGMNIRIVPVTGIPLPLLSYGGSSVLCSLIALGLMQNVYKNRRGY

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
83 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
94 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
95 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 1.52
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.03
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10103199 3300003323 Unclassified 2304
2 Ga0070666_10002552 3300005335 Bacteria 11015
3 Ga0070666_10010345 3300005335 Bacteria 5833
4 Ga0070680_100144928 3300005336 Bacteria 1992
5 Ga0070689_100001072 3300005340 Bacteria 17135
6 Ga0070689_100166718 3300005340 Unclassified 1783
7 Ga0070692_10029896 3300005345 Bacteria 2720
8 Ga0070673_100011297 3300005364 Bacteria 6089
9 Ga0070701_10031560 3300005438 Bacteria 2629
10 Ga0070694_100030597 3300005444 Bacteria 3523
11 Ga0070708_100047378 3300005445 Bacteria 3796
12 Ga0070686_100001673 3300005544 Bacteria 12387
13 Ga0070686_100041176 3300005544 Unclassified 2886
14 Ga0070665_100015635 3300005548 Bacteria 7623
15 Ga0070704_100077870 3300005549 Bacteria 2430
16 Ga0070704_100093802 3300005549 Bacteria 2244
17 Ga0068855_100342576 3300005563 Bacteria 1648
18 Ga0068856_100088492 3300005614 Bacteria 3079
19 Ga0068859_100034066 3300005617 Bacteria 5113
20 Ga0068859_100142218 3300005617 Bacteria 2473
21 Ga0068859_100288811 3300005617 Bacteria 1733
22 Ga0068864_100025419 3300005618 Bacteria 4986
23 Ga0068864_100054487 3300005618 Bacteria 3452
24 Ga0068863_100020301 3300005841 Bacteria 6355
25 Ga0068863_100025563 3300005841 Bacteria 5630
26 Ga0068858_100015088 3300005842 Bacteria 7266
27 Ga0068860_100004252 3300005843 Bacteria 14662
28 Ga0097621_100173235 3300006237 Bacteria 1861
29 Ga0068871_100024397 3300006358 Bacteria 4689
30 Ga0075428_100011808 3300006844 Bacteria 9721
31 Ga0075428_100026526 3300006844 Bacteria 6414
32 Ga0075431_100123813 3300006847 Unclassified 2667
33 Ga0075433_10044920 3300006852 Bacteria 3839
34 Ga0075429_100079507 3300006880 Bacteria 2858
35 Ga0068865_100129319 3300006881 Bacteria 1890
36 Ga0097620_100034066 3300006931 Bacteria 5113
37 Ga0097620_100142220 3300006931 Bacteria 2473
38 Ga0105240_10007599 3300009093 Bacteria 15703
39 Ga0111539_10241600 3300009094 Unclassified 2102
40 Ga0105245_10003815 3300009098 Bacteria 13394
41 Ga0105245_10107078 3300009098 Bacteria 2595
42 Ga0105242_10021453 3300009176 Bacteria 5073
43 Ga0105248_10101639 3300009177 Bacteria 3240
44 Ga0105238_10263479 3300009551 Bacteria 1703
45 Ga0105246_10230177 3300011119 Unclassified 1459
46 Ga0157374_10014537 3300013296 Bacteria 6889
47 Ga0157378_10174867 3300013297 Bacteria 2016
48 Ga0163162_10273649 3300013306 Unclassified 1820
49 Ga0157372_10177546 3300013307 Bacteria 2465
50 Ga0157375_10000025 3300013308 Bacteria 224384
51 Ga0157375_10102673 3300013308 Bacteria 2945
52 Ga0163163_10000189 3300014325 Bacteria 63349
53 Ga0163163_10013134 3300014325 Bacteria 7567
54 Ga0163163_10016376 3300014325 Bacteria 6886
55 Ga0163163_10032202 3300014325 Bacteria 5064
56 Ga0163163_10260630 3300014325 Bacteria 1784
57 Ga0157379_10002256 3300014968 Bacteria 16053
58 Ga0157376_10005915 3300014969 Bacteria 8587
59 Ga0207680_10085443 3300025903 Bacteria 1993
60 Ga0207681_10151059 3300025923 Unclassified 1741
61 Ga0207687_10014784 3300025927 Bacteria 5112
62 Ga0207664_10152824 3300025929 Unclassified 1962
63 Ga0207686_10017802 3300025934 Bacteria 4010
64 Ga0207670_10042160 3300025936 Archaea 3006
65 Ga0207670_10049551 3300025936 Bacteria 2810
66 Ga0207670_10154982 3300025936 Unclassified 1704
67 Ga0207711_10025409 3300025941 Bacteria 4970
68 Ga0207651_10023856 3300025960 Bacteria 3772
69 Ga0207658_10048570 3300025986 Bacteria 3112
70 Ga0207677_10022208 3300026023 Bacteria 3895
71 Ga0207703_10003966 3300026035 Bacteria 12266
72 Ga0207702_10011530 3300026078 Bacteria 7364
73 Ga0207641_10023160 3300026088 Bacteria 5117
74 Ga0207641_10095347 3300026088 Bacteria 2611
75 Ga0207641_10159659 3300026088 Bacteria 2049
76 Ga0207676_10022255 3300026095 Bacteria 4660
77 Ga0207674_10297022 3300026116 Unclassified 1564
78 Ga0268264_10084012 3300028381 Bacteria 2728
79 Ga0265326_10030894 3300028558 Unclassified 1526
80 Ga0265326_10034644 3300028558 Bacteria 1436
81 Ga0265338_10000030 3300028800 Bacteria 260974
82 Ga0265338_10000788 3300028800 Bacteria 53663
83 Ga0265338_10083104 3300028800 Unclassified 2680
84 Ga0265338_10138142 3300028800 Unclassified 1912
85 Ga0265324_10000637 3300029957 Bacteria 23808
86 Ga0265324_10001101 3300029957 Bacteria 16246
87 Ga0265324_10034140 3300029957 Bacteria 1772
88 Ga0265332_10023862 3300031238 Unclassified 2695
89 Ga0265328_10026106 3300031239 Unclassified 2198
90 Ga0265325_10095468 3300031241 Bacteria 1461
91 Ga0265329_10004111 3300031242 Bacteria 6164
92 Ga0265340_10010548 3300031247 Bacteria 4940
93 Ga0265340_10031577 3300031247 Bacteria 2648
94 Ga0265339_10058360 3300031249 Bacteria 2084
95 Ga0265327_10001289 3300031251 Bacteria 32900
96 Ga0265327_10002626 3300031251 Bacteria 18535
97 Ga0265327_10005074 3300031251 Bacteria 11226
98 Ga0265327_10006192 3300031251 Bacteria 9654
99 Ga0265327_10053501 3300031251 Bacteria 2095
100 Ga0265316_10034012 3300031344 Bacteria 4145
101 Ga0316575_10056910 3300031665 Bacteria 1558
102 Ga0316579_10000205 3300031691 Bacteria 17584
103 Ga0265314_10000115 3300031711 Bacteria 124024
104 Ga0265314_10058233 3300031711 Unclassified 2648
105 Ga0316576_10002484 3300031727 Bacteria 10493
106 Ga0316576_10057227 3300031727 Bacteria 2849
107 Ga0316578_10014339 3300031728 Bacteria 4231
108 Ga0316578_10061043 3300031728 Bacteria 2220
109 Ga0316578_10080585 3300031728 Bacteria 1936
110 Ga0307405_10152598 3300031731 Unclassified 1626
111 Ga0316577_10000512 3300031733 Bacteria 15507
112 Ga0316577_10003841 3300031733 Bacteria 7656
113 Ga0316577_10079556 3300031733 Bacteria 1831
114 Ga0307410_10175211 3300031852 Unclassified 1620
115 Ga0307406_10063759 3300031901 Bacteria 2389
116 Ga0307411_10057071 3300032005 Bacteria 2577
117 Ga0307415_100236751 3300032126 Unclassified 1474
118 Ga0316583_10000042 3300032133 Bacteria 24815
119 Ga0316585_10014472 3300032137 Bacteria 2358
120 Ga0316593_10000129 3300032168 Bacteria 10385
121 Ga0316596_1000177 3300033541 Bacteria 9158
122 Ga0316596_1000842 3300033541 Bacteria 5728
123 Ga0373943_0008706 3300035170 Bacteria 4550
124 Ga0373931_0018299 3300035691 Unclassified 3483
125 Ga0373935_0009497 3300035692 Bacteria 5820
126 Ga0373927_0012733 3300035695 Bacteria 5594
127 Ga0373947_0036448 3300035725 Bacteria 2917
128 Ga0316582_0004146 3300036647 Bacteria 7261
129 Ga0316584_0001205 3300036712 Bacteria 15292
130 Ga0316584_0003360 3300036712 Bacteria 10366
131 Ga0316584_0028306 3300036712 Bacteria 4131
132 Ga0316584_0153694 3300036712 Bacteria 1712
133 Ga0373925_0038512 3300037068 Unclassified 3535
134 Ga0373925_0122008 3300037068 Bacteria 2024
135 Ga0316581_0000481 3300037588 Bacteria 7661
136 Ga0400484_33976 3300038725 Bacteria 28432
137 Ga0400487_10246 3300039110 Bacteria 2478
138 Ga0400487_66019 3300039110 Bacteria 38416
139 Ga0436363_0566011 3300039450 Bacteria 2114
140 Ga0451577_0004287 3300042876 Bacteria 15159
141 Ga0451577_0026492 3300042876 Bacteria 5252
142 Ga0451576_0021740 3300045051 Bacteria 6966
143 Ga0451576_0080870 3300045051 Unclassified 3380
144 Ga0451576_0089144 3300045051 Unclassified 3208
145 Ga0451576_0102598 3300045051 Bacteria 2976
146 Ga0451576_0131313 3300045051 Unclassified 2611
147 Ga0495641_0043570 3300046461 Unclassified 2075
148 Ga0495582_0022859 3300046473 Unclassified 3420
149 Ga0495618_0144891 3300046514 Unclassified 1519
150 Ga0495630_0000453 3300046517 Bacteria 31046
151 Ga0495630_0010712 3300046517 Bacteria 6622
152 Ga0495666_0008019 3300046526 Bacteria 5291
153 Ga0495586_0000305 3300046535 Bacteria 31082
154 Ga0495586_0001998 3300046535 Bacteria 11065
155 Ga0495586_0039499 3300046535 Bacteria 2537
156 Ga0495586_0137831 3300046535 Bacteria 1368
157 Ga0495667_0067831 3300046559 Bacteria 2330
158 Ga0495634_0024919 3300046642 Bacteria 4193
159 Ga0495634_0024939 3300046642 Bacteria 4191
160 Ga0495657_0079094 3300046675 Bacteria 2130
161 Ga0495613_0026230 3300046689 Bacteria 4342
162 Ga0495613_0047856 3300046689 Bacteria 3158
163 Ga0495624_0034110 3300046690 Bacteria 3294
164 Ga0495674_0004258 3300047319 Bacteria 13782
165 Ga0495676_0064605 3300047321 Unclassified 2844
166 Ga0496104_0005730 3300048907 Bacteria 10869
167 Ga0496105_0003366 3300048908 Bacteria 11816
168 Ga0496106_0244737 3300048909 Bacteria 1433
169 Ga0496108_0003453 3300048911 Bacteria 12675
170 Ga0496109_0004951 3300048912 Bacteria 11125
171 Ga0496110_0011528 3300048913 Bacteria 7241
172 Ga0501031_0000231 3300049568 Bacteria 31958
173 Ga0501033_0002690 3300049570 Bacteria 14908
174 Ga0501033_0005324 3300049570 Bacteria 10195
175 Ga0501034_0020437 3300049571 Bacteria 6760
176 Ga0501036_0055948 3300049572 Bacteria 3342
177 Ga0501037_0001580 3300049573 Bacteria 16609
178 Ga0501038_0004154 3300049574 Bacteria 13471
179 Ga0501041_0121207 3300049577 Bacteria 1626
180 Ga0501043_0011482 3300049579 Bacteria 6933
181 Ga0501046_0092303 3300049580 Bacteria 2328
182 Ga0501047_0062159 3300049581 Bacteria 3602
183 Ga0501068_0026553 3300049584 Bacteria 3413
184 Ga0501072_0087949 3300049588 Bacteria 2465
185 Ga0501073_0009454 3300049589 Bacteria 7195
186 Ga0501080_0008086 3300049742 Bacteria 9529
187 Ga0501083_0040460 3300049744 Bacteria 3164
188 Ga0501083_0058734 3300049744 Bacteria 2573
189 Ga0501035_0004691 3300049822 Bacteria 12974
190 Ga0501044_0000079 3300049823 Bacteria 117924
191 Ga0501044_0008096 3300049823 Bacteria 11536
192 nmdc:mga0qj67_303135_c1 3300050509 Bacteria 1294
193 nmdc:mga06r32_120348_c2 3300050510 Bacteria 1761
194 nmdc:mga08y16_385001_c1 3300050511 Bacteria 1437
195 nmdc:mga0a205_315958_c1 3300050515 Bacteria 1433
196 Ga0501084_0074703 3300054114 Bacteria 2839
197 Ga0501082_0032583 3300060353 Bacteria 4495
198 8002749579 8002745576 Bacteria 4840272
199 rootH1_10103199
200 Ga0070666_10002552
201 Ga0070666_10010345
202 Ga0070680_100144928
203 Ga0070689_100001072
204 Ga0070689_100166718
205 Ga0070692_10029896
206 Ga0070673_100011297
207 Ga0070701_10031560
208 Ga0070694_100030597
209 Ga0070708_100047378
210 Ga0070686_100001673
211 Ga0070686_100041176
212 Ga0070665_100015635
213 Ga0070704_100077870
214 Ga0070704_100093802
215 Ga0068855_100342576
216 Ga0068856_100088492
217 Ga0068859_100034066
218 Ga0068859_100142218
219 Ga0068859_100288811
220 Ga0068864_100025419
221 Ga0068864_100054487
222 Ga0068863_100020301
223 Ga0068863_100025563
224 Ga0068858_100015088
225 Ga0068860_100004252
226 Ga0097621_100173235
227 Ga0068871_100024397
228 Ga0075428_100011808
229 Ga0075428_100026526
230 Ga0075431_100123813
231 Ga0075433_10044920
232 Ga0075429_100079507
233 Ga0068865_100129319
234 Ga0097620_100034066
235 Ga0097620_100142220
236 Ga0105240_10007599
237 Ga0111539_10241600
238 Ga0105245_10003815
239 Ga0105245_10107078
240 Ga0105242_10021453
241 Ga0105248_10101639
242 Ga0105238_10263479
243 Ga0105246_10230177
244 Ga0157374_10014537
245 Ga0157378_10174867
246 Ga0163162_10273649
247 Ga0157372_10177546
248 Ga0157375_10000025
249 Ga0157375_10102673
250 Ga0163163_10000189
251 Ga0163163_10013134
252 Ga0163163_10016376
253 Ga0163163_10032202
254 Ga0163163_10260630
255 Ga0157379_10002256
256 Ga0157376_10005915
257 Ga0207680_10085443
258 Ga0207681_10151059
259 Ga0207687_10014784
260 Ga0207664_10152824
261 Ga0207686_10017802
262 Ga0207670_10042160
263 Ga0207670_10049551
264 Ga0207670_10154982
265 Ga0207711_10025409
266 Ga0207651_10023856
267 Ga0207658_10048570
268 Ga0207677_10022208
269 Ga0207703_10003966
270 Ga0207702_10011530
271 Ga0207641_10023160
272 Ga0207641_10095347
273 Ga0207641_10159659
274 Ga0207676_10022255
275 Ga0207674_10297022
276 Ga0268264_10084012
277 Ga0265326_10030894
278 Ga0265326_10034644
279 Ga0265338_10000030
280 Ga0265338_10000788
281 Ga0265338_10083104
282 Ga0265338_10138142
283 Ga0265324_10000637
284 Ga0265324_10001101
285 Ga0265324_10034140
286 Ga0265332_10023862
287 Ga0265328_10026106
288 Ga0265325_10095468
289 Ga0265329_10004111
290 Ga0265340_10010548
291 Ga0265340_10031577
292 Ga0265339_10058360
293 Ga0265327_10001289
294 Ga0265327_10002626
295 Ga0265327_10005074
296 Ga0265327_10006192
297 Ga0265327_10053501
298 Ga0265316_10034012
299 Ga0316575_10056910
300 Ga0316579_10000205
301 Ga0265314_10000115
302 Ga0265314_10058233
303 Ga0316576_10002484
304 Ga0316576_10057227
305 Ga0316578_10014339
306 Ga0316578_10061043
307 Ga0316578_10080585
308 Ga0307405_10152598
309 Ga0316577_10000512
310 Ga0316577_10003841
311 Ga0316577_10079556
312 Ga0307410_10175211
313 Ga0307406_10063759
314 Ga0307411_10057071
315 Ga0307415_100236751
316 Ga0316583_10000042
317 Ga0316585_10014472
318 Ga0316593_10000129
319 Ga0316596_1000177
320 Ga0316596_1000842
321 Ga0373943_0008706
322 Ga0373931_0018299
323 Ga0373935_0009497
324 Ga0373927_0012733
325 Ga0373947_0036448
326 Ga0316582_0004146
327 Ga0316584_0001205
328 Ga0316584_0003360
329 Ga0316584_0028306
330 Ga0316584_0153694
331 Ga0373925_0038512
332 Ga0373925_0122008
333 Ga0316581_0000481
334 Ga0400484_33976
335 Ga0400487_10246
336 Ga0400487_66019
337 Ga0436363_0566011
338 Ga0451577_0004287
339 Ga0451577_0026492
340 Ga0451576_0021740
341 Ga0451576_0080870
342 Ga0451576_0089144
343 Ga0451576_0102598
344 Ga0451576_0131313
345 Ga0495641_0043570
346 Ga0495582_0022859
347 Ga0495618_0144891
348 Ga0495630_0000453
349 Ga0495630_0010712
350 Ga0495666_0008019
351 Ga0495586_0000305
352 Ga0495586_0001998
353 Ga0495586_0039499
354 Ga0495586_0137831
355 Ga0495667_0067831
356 Ga0495634_0024919
357 Ga0495634_0024939
358 Ga0495657_0079094
359 Ga0495613_0026230
360 Ga0495613_0047856
361 Ga0495624_0034110
362 Ga0495674_0004258
363 Ga0495676_0064605
364 Ga0496104_0005730
365 Ga0496105_0003366
366 Ga0496106_0244737
367 Ga0496108_0003453
368 Ga0496109_0004951
369 Ga0496110_0011528
370 Ga0501031_0000231
371 Ga0501033_0002690
372 Ga0501033_0005324
373 Ga0501034_0020437
374 Ga0501036_0055948
375 Ga0501037_0001580
376 Ga0501038_0004154
377 Ga0501041_0121207
378 Ga0501043_0011482
379 Ga0501046_0092303
380 Ga0501047_0062159
381 Ga0501068_0026553
382 Ga0501072_0087949
383 Ga0501073_0009454
384 Ga0501080_0008086
385 Ga0501083_0040460
386 Ga0501083_0058734
387 Ga0501035_0004691
388 Ga0501044_0000079
389 Ga0501044_0008096
390 nmdc:mga0qj67_303135_c1
391 nmdc:mga06r32_120348_c2
392 nmdc:mga08y16_385001_c1
393 nmdc:mga0a205_315958_c1
394 Ga0501084_0074703
395 Ga0501082_0032583
396 8002749579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

26

414

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8883 25 413
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8786 25 415
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8774 21 413
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8772 25 413
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8714 25 413
ID Description Score Start End Superfamily
4pr9F00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3213 236 413 1.20.120.230
4iggA06 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2989 194 412 1.20.120.230
4pr9F00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2915 236 413 1.20.120.230
af_K7V042_1_287_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.29 86 372 1.50.10.150
af_K7V042_1_287_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.2774 86 372 1.50.10.150
ID Description Score Start End GO Terms
AF-A0A7W1QPJ0-F1-model_v4 FtsW/RodA/SpoVE family cell cycle protein 0.9594 272 415 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A0G0R590-F1-model_v4 Rod shape-determining protein RodA 0.9539 272 414 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A7W0F761-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9452 270 413 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A800EV28-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.945 272 412 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
AF-A0A7V1KZY0-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) 0.9446 274 415 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301

Map