F303243

General Info

Members Datasets Scaffolds Average Seq Length
197 160 394 288

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100650264|Ga0307416_1006502642
Length 310
Sequence MIPAQHRHGDAGGPRETPPHEKRERMSILNETYTLSNGVKIPKLGLGTWFIDDALAADAVRAAVEIGYRNIDTAQAYGNERGVGEGVHTSGVPRDELFVSTKLAAEIKDYDQAVAAIDGSLQKLGLDHIDLMLIHSPQPWEDFRAGDYAEGNRQAWRALEEAHEAGKIRSIGVSNFLQTDLENILSDAKIVPHVNQLLVHAGNTPSELLSYCEDKGILVEAYSPIAHGAILDHAEVKAMARKYSVSVPQLCIGYTLQLGTVSLPKTANPEHMRSNAEINFVISEADMELLRDLRDVDYGEHSAFPVYSGK

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
134 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
135 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
138 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
139 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
140 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
141 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
142 2643221548 Streptomyces sp. Root55 Isolate Unclassified
143 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
144 2643221584 Caulobacter sp. Root656 Isolate Unclassified
145 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
146 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
147 2808606394 Promicromonospora sp. C35 Isolate Unclassified
148 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
149 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
150 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
151 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
152 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
153 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
154 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
155 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
156 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
157 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
158 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
159 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
160 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.82
Metatranscriptomes 0
Isolates 12.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.61
Nodule 2.03
Rhizoplane 5.08
Rhizosphere 75.63
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100650264 3300032002 Bacteria 1139
2 JGI25152J39213_1000019 3300002773 Bacteria 108017
3 JGI25406J46586_10069999 3300003203 Unclassified 1104
4 Ga0055542_1003473 3300003762 Bacteria 4251
5 Ga0055542_1003879 3300003762 Bacteria 3853
6 Ga0070658_10198601 3300005327 Bacteria 1692
7 Ga0070658_10309372 3300005327 Bacteria 1348
8 Ga0070666_10134220 3300005335 Unclassified 1721
9 Ga0070680_100016763 3300005336 Bacteria 5766
10 Ga0070680_100337040 3300005336 Bacteria 1281
11 Ga0070682_100097706 3300005337 Bacteria 1933
12 Ga0070682_100319676 3300005337 Bacteria 1146
13 Ga0070660_100131433 3300005339 Bacteria 2003
14 Ga0070660_100386141 3300005339 Bacteria 1156
15 Ga0070661_100059191 3300005344 Bacteria 2808
16 Ga0070671_100281802 3300005355 Bacteria 1414
17 Ga0070673_100204498 3300005364 Bacteria 1702
18 Ga0070659_100067346 3300005366 Plasmid 2840
19 Ga0070659_100354704 3300005366 Bacteria 1231
20 Ga0070667_100275565 3300005367 Bacteria 1509
21 Ga0070714_100043835 3300005435 Bacteria 3786
22 Ga0070662_100103470 3300005457 Bacteria 2159
23 Ga0070681_10099336 3300005458 Bacteria 2856
24 Ga0068867_100426985 3300005459 Unclassified 1124
25 Ga0070685_10191658 3300005466 Bacteria 1323
26 Ga0070679_100029660 3300005530 Bacteria 5396
27 Ga0070679_100055300 3300005530 Bacteria 3952
28 Ga0070679_100119539 3300005530 Bacteria 2620
29 Ga0068853_100156958 3300005539 Bacteria 2050
30 Ga0070665_100083646 3300005548 Bacteria 3196
31 Ga0070664_100343199 3300005564 Unclassified 1357
32 Ga0068854_100074104 3300005578 Bacteria 2497
33 Ga0068854_100194762 3300005578 Bacteria 1590
34 Ga0068856_100070700 3300005614 Bacteria 3453
35 Ga0068856_100187389 3300005614 Bacteria 2083
36 Ga0068852_100100961 3300005616 Bacteria 2604
37 Ga0068852_100277452 3300005616 Bacteria 1615
38 Ga0068864_100485504 3300005618 Bacteria 1186
39 Ga0068858_100198161 3300005842 Bacteria 1898
40 Ga0081455_10000386 3300005937 Bacteria 58274
41 Ga0081539_10017200 3300005985 Bacteria 5091
42 Ga0075366_10083427 3300006195 Bacteria 1910
43 Ga0068871_100217639 3300006358 Bacteria 1654
44 Ga0105244_10007578 3300009036 Bacteria 6883
45 Ga0105245_10018982 3300009098 Bacteria 6018
46 Ga0105245_10039232 3300009098 Bacteria 4215
47 Ga0105238_10307100 3300009551 Bacteria 1571
48 Ga0105239_10000650 3300010375 Bacteria 49427
49 Ga0105239_10890492 3300010375 Unclassified 1021
50 Ga0105246_10003655 3300011119 Bacteria 9309
51 Ga0157373_10015755 3300013100 Bacteria 5521
52 Ga0157371_10004726 3300013102 Bacteria 11765
53 Ga0157370_10095671 3300013104 Bacteria 2786
54 Ga0157369_10124383 3300013105 Bacteria 2735
55 Ga0163162_10638460 3300013306 Bacteria 1189
56 Ga0157372_10377176 3300013307 Bacteria 1653
57 Ga0209148_1003138 3300025254 Bacteria 4792
58 Ga0209129_1000046 3300025258 Bacteria 271702
59 Ga0209025_1000543 3300025294 Bacteria 70931
60 Ga0207655_1012090 3300025728 Bacteria 5076
61 Ga0207647_10059519 3300025904 Bacteria 2337
62 Ga0207705_10005799 3300025909 Bacteria 9198
63 Ga0207705_10287300 3300025909 Bacteria 1260
64 Ga0207660_10291377 3300025917 Bacteria 1298
65 Ga0207657_10038714 3300025919 Bacteria 4242
66 Ga0207657_10059333 3300025919 Bacteria 3288
67 Ga0207649_10091586 3300025920 Bacteria 1992
68 Ga0207652_10000154 3300025921 Bacteria 74554
69 Ga0207694_10333346 3300025924 Bacteria 1254
70 Ga0207687_10258692 3300025927 Bacteria 1387
71 Ga0207690_10089588 3300025932 Bacteria 2170
72 Ga0207706_10038920 3300025933 Bacteria 4217
73 Ga0207711_10139304 3300025941 Bacteria 2182
74 Ga0207661_10060382 3300025944 Bacteria 3059
75 Ga0207667_10471161 3300025949 Bacteria 1275
76 Ga0207651_10302172 3300025960 Bacteria 1331
77 Ga0207640_10022575 3300025981 Bacteria 3769
78 Ga0207640_10329184 3300025981 Bacteria 1219
79 Ga0207678_10037999 3300026067 Bacteria 4186
80 Ga0207678_10269925 3300026067 Bacteria 1459
81 Ga0207702_10210661 3300026078 Bacteria 1807
82 Ga0207676_10413093 3300026095 Bacteria 1264
83 Ga0207683_10025133 3300026121 Bacteria 5135
84 Ga0268266_10059541 3300028379 Bacteria 3291
85 Ga0265327_10008180 3300031251 Bacteria 7850
86 Ga0373935_0078184 3300035692 Bacteria 2146
87 Ga0395899_0026696 3300037312 Bacteria 4357
88 Ga0395900_0011326 3300037418 Bacteria 9123
89 Ga0395900_0247482 3300037418 Bacteria 1785
90 Ga0395898_0224299 3300037466 Bacteria 1793
91 Ga0395905_0036123 3300037471 Bacteria 4641
92 Ga0395905_0053196 3300037471 Bacteria 3790
93 Ga0395905_0073090 3300037471 Bacteria 3214
94 Ga0395905_0252690 3300037471 Bacteria 1647
95 Ga0395905_0321216 3300037471 Bacteria 1438
96 Ga0436364_1106833 3300037853 Bacteria 11782
97 Ga0395901_0000561 3300038443 Bacteria 43086
98 Ga0395901_0016497 3300038443 Bacteria 7526
99 Ga0395901_0026379 3300038443 Bacteria 5965
100 Ga0395901_0253556 3300038443 Bacteria 1833
101 Ga0436360_0086537 3300039438 Bacteria 6392
102 Ga0436363_0883744 3300039450 Bacteria 1525
103 Ga0436362_0177840 3300039453 Bacteria 6147
104 Ga0451837_0204899 3300041494 Bacteria 1410
105 Ga0451853_0813215 3300041512 Bacteria 999
106 Ga0451853_1675264 3300041512 Bacteria 1868
107 Ga0466966_0107533 3300044684 Bacteria 1721
108 Ga0466966_0138658 3300044684 Bacteria 1487
109 Ga0466960_0084128 3300044901 Bacteria 1609
110 Ga0466959_0225926 3300045049 Bacteria 1297
111 Ga0466958_0136831 3300045836 Bacteria 1541
112 Ga0495592_0003088 3300046454 Bacteria 11885
113 Ga0495603_0001547 3300046455 Bacteria 13469
114 Ga0495603_0041589 3300046455 Bacteria 2748
115 Ga0495629_0225293 3300046459 Bacteria 1293
116 Ga0495651_0089951 3300046462 Bacteria 2303
117 Ga0495596_0002124 3300046500 Bacteria 10845
118 Ga0495583_0014300 3300046506 Bacteria 4385
119 Ga0495608_0171063 3300046511 Bacteria 1378
120 Ga0495618_0094187 3300046514 Bacteria 1915
121 Ga0495628_0098071 3300046516 Bacteria 2264
122 Ga0495643_0052445 3300046522 Bacteria 2190
123 Ga0495622_0006331 3300046557 Bacteria 5495
124 Ga0495633_0110002 3300046558 Bacteria 1277
125 Ga0495668_0013551 3300046616 Bacteria 4806
126 Ga0495634_0026656 3300046642 Bacteria 4031
127 Ga0495625_0087602 3300046660 Bacteria 2158
128 Ga0495613_0032559 3300046689 Bacteria 3873
129 Ga0495624_0075046 3300046690 Bacteria 2100
130 Ga0495600_0002395 3300046809 Bacteria 10742
131 Ga0495600_0005363 3300046809 Bacteria 7731
132 Ga0495581_0169857 3300047315 Bacteria 1275
133 Ga0495604_0037069 3300047317 Bacteria 3841
134 Ga0495674_0445370 3300047319 Bacteria 1041
135 Ga0495676_0001042 3300047321 Bacteria 23408
136 Ga0495676_0003650 3300047321 Bacteria 13962
137 Ga0496101_0469976 3300048904 Bacteria 993
138 Ga0496102_0473948 3300048905 Bacteria 1173
139 Ga0496107_0066223 3300048910 Bacteria 2619
140 Ga0496108_0091872 3300048911 Bacteria 2580
141 Ga0496109_0223381 3300048912 Bacteria 1771
142 Ga0496110_0056218 3300048913 Bacteria 3463
143 Ga0496114_0134586 3300048917 Bacteria 2137
144 Ga0496114_0156438 3300048917 Bacteria 1979
145 Ga0496114_0325941 3300048917 Bacteria 1357
146 Ga0496115_0334530 3300048918 Bacteria 1237
147 Ga0501031_0008703 3300049568 Bacteria 6599
148 Ga0501032_0008382 3300049569 Bacteria 7537
149 Ga0501033_0056050 3300049570 Bacteria 2914
150 Ga0501034_0033984 3300049571 Bacteria 5170
151 Ga0501034_0043586 3300049571 Bacteria 4540
152 Ga0501036_0055953 3300049572 Bacteria 3342
153 Ga0501037_0002620 3300049573 Bacteria 12977
154 Ga0501038_0001567 3300049574 Bacteria 21171
155 Ga0501039_0000525 3300049575 Bacteria 27702
156 Ga0501040_0325733 3300049576 Bacteria 1099
157 Ga0501043_0000801 3300049579 Bacteria 27935
158 Ga0501067_0016233 3300049583 Bacteria 4116
159 Ga0501070_0003640 3300049586 Bacteria 13322
160 Ga0501073_0057230 3300049589 Bacteria 2726
161 Ga0501035_0018316 3300049822 Bacteria 6452
162 Ga0501044_0007121 3300049823 Bacteria 12300
163 Ga0501044_0044301 3300049823 Bacteria 4617
164 Ga0501044_0102353 3300049823 Bacteria 2880
165 nmdc:mga0k408_112135_c1 3300050493 Bacteria 1612
166 Ga0500635_0000183 3300053080 Bacteria 32119
167 Ga0495619_0181390 3300053085 Bacteria 1457
168 Ga0500647_0091084 3300053091 Bacteria 1460
169 Ga0500641_0065473 3300053096 Bacteria 1520
170 Ga0500594_0017495 3300053118 Bacteria 1756
171 Ga0500568_0066863 3300053139 Bacteria 1382
172 Ga0500624_000080 3300053157 Bacteria 50463
173 Ga0500627_0063868 3300053158 Bacteria 1623
174 2523383371 2523231044 Bacteria 6434991
175 2585308010 2582581313 Bacteria 10042643
176 2601445697 2600255229 Bacteria 1988965
177 2643761614 2643221548 Bacteria 8053412
178 2643780605 2643221552 Bacteria 5708754
179 2643782326 2643221552 Bacteria 5708754
180 2643929250 2643221584 Bacteria 5511711
181 2643929375 2643221584 Bacteria 5511711
182 2739204247 2738543005 Bacteria 5278128
183 2776915093 2775507049 Bacteria 6284736
184 2809028626 2808606394 Bacteria 6248540
185 2833713077 2833709550 Bacteria 4008291
186 2838023557 2838022645 Bacteria 6494267
187 2842199071 2842198810 Bacteria 6608673
188 2848553146 2848551377 Bacteria 3720646
189 2881635425 2881633906 Bacteria 2972201
190 2883824072 2883821847 Bacteria 5121194
191 2902804330 2902799365 Bacteria 5419524
192 2919719693 2919713450 Bacteria 7431245
193 3006327116 3006321560 Bacteria 8247479
194 8008488490 8008485437 Bacteria 7198341
195 8019637389 8019629233 Bacteria 8687553
196 8019674889 8019668869 Bacteria 8791617
197 8025527463 8025524527 Bacteria 7197316
198 Ga0307416_100650264
199 JGI25152J39213_1000019
200 JGI25406J46586_10069999
201 Ga0055542_1003473
202 Ga0055542_1003879
203 Ga0070658_10198601
204 Ga0070658_10309372
205 Ga0070666_10134220
206 Ga0070680_100016763
207 Ga0070680_100337040
208 Ga0070682_100097706
209 Ga0070682_100319676
210 Ga0070660_100131433
211 Ga0070660_100386141
212 Ga0070661_100059191
213 Ga0070671_100281802
214 Ga0070673_100204498
215 Ga0070659_100067346
216 Ga0070659_100354704
217 Ga0070667_100275565
218 Ga0070714_100043835
219 Ga0070662_100103470
220 Ga0070681_10099336
221 Ga0068867_100426985
222 Ga0070685_10191658
223 Ga0070679_100029660
224 Ga0070679_100055300
225 Ga0070679_100119539
226 Ga0068853_100156958
227 Ga0070665_100083646
228 Ga0070664_100343199
229 Ga0068854_100074104
230 Ga0068854_100194762
231 Ga0068856_100070700
232 Ga0068856_100187389
233 Ga0068852_100100961
234 Ga0068852_100277452
235 Ga0068864_100485504
236 Ga0068858_100198161
237 Ga0081455_10000386
238 Ga0081539_10017200
239 Ga0075366_10083427
240 Ga0068871_100217639
241 Ga0105244_10007578
242 Ga0105245_10018982
243 Ga0105245_10039232
244 Ga0105238_10307100
245 Ga0105239_10000650
246 Ga0105239_10890492
247 Ga0105246_10003655
248 Ga0157373_10015755
249 Ga0157371_10004726
250 Ga0157370_10095671
251 Ga0157369_10124383
252 Ga0163162_10638460
253 Ga0157372_10377176
254 Ga0209148_1003138
255 Ga0209129_1000046
256 Ga0209025_1000543
257 Ga0207655_1012090
258 Ga0207647_10059519
259 Ga0207705_10005799
260 Ga0207705_10287300
261 Ga0207660_10291377
262 Ga0207657_10038714
263 Ga0207657_10059333
264 Ga0207649_10091586
265 Ga0207652_10000154
266 Ga0207694_10333346
267 Ga0207687_10258692
268 Ga0207690_10089588
269 Ga0207706_10038920
270 Ga0207711_10139304
271 Ga0207661_10060382
272 Ga0207667_10471161
273 Ga0207651_10302172
274 Ga0207640_10022575
275 Ga0207640_10329184
276 Ga0207678_10037999
277 Ga0207678_10269925
278 Ga0207702_10210661
279 Ga0207676_10413093
280 Ga0207683_10025133
281 Ga0268266_10059541
282 Ga0265327_10008180
283 Ga0373935_0078184
284 Ga0395899_0026696
285 Ga0395900_0011326
286 Ga0395900_0247482
287 Ga0395898_0224299
288 Ga0395905_0036123
289 Ga0395905_0053196
290 Ga0395905_0073090
291 Ga0395905_0252690
292 Ga0395905_0321216
293 Ga0436364_1106833
294 Ga0395901_0000561
295 Ga0395901_0016497
296 Ga0395901_0026379
297 Ga0395901_0253556
298 Ga0436360_0086537
299 Ga0436363_0883744
300 Ga0436362_0177840
301 Ga0451837_0204899
302 Ga0451853_0813215
303 Ga0451853_1675264
304 Ga0466966_0107533
305 Ga0466966_0138658
306 Ga0466960_0084128
307 Ga0466959_0225926
308 Ga0466958_0136831
309 Ga0495592_0003088
310 Ga0495603_0001547
311 Ga0495603_0041589
312 Ga0495629_0225293
313 Ga0495651_0089951
314 Ga0495596_0002124
315 Ga0495583_0014300
316 Ga0495608_0171063
317 Ga0495618_0094187
318 Ga0495628_0098071
319 Ga0495643_0052445
320 Ga0495622_0006331
321 Ga0495633_0110002
322 Ga0495668_0013551
323 Ga0495634_0026656
324 Ga0495625_0087602
325 Ga0495613_0032559
326 Ga0495624_0075046
327 Ga0495600_0002395
328 Ga0495600_0005363
329 Ga0495581_0169857
330 Ga0495604_0037069
331 Ga0495674_0445370
332 Ga0495676_0001042
333 Ga0495676_0003650
334 Ga0496101_0469976
335 Ga0496102_0473948
336 Ga0496107_0066223
337 Ga0496108_0091872
338 Ga0496109_0223381
339 Ga0496110_0056218
340 Ga0496114_0134586
341 Ga0496114_0156438
342 Ga0496114_0325941
343 Ga0496115_0334530
344 Ga0501031_0008703
345 Ga0501032_0008382
346 Ga0501033_0056050
347 Ga0501034_0033984
348 Ga0501034_0043586
349 Ga0501036_0055953
350 Ga0501037_0002620
351 Ga0501038_0001567
352 Ga0501039_0000525
353 Ga0501040_0325733
354 Ga0501043_0000801
355 Ga0501067_0016233
356 Ga0501070_0003640
357 Ga0501073_0057230
358 Ga0501035_0018316
359 Ga0501044_0007121
360 Ga0501044_0044301
361 Ga0501044_0102353
362 nmdc:mga0k408_112135_c1
363 Ga0500635_0000183
364 Ga0495619_0181390
365 Ga0500647_0091084
366 Ga0500641_0065473
367 Ga0500594_0017495
368 Ga0500568_0066863
369 Ga0500624_000080
370 Ga0500627_0063868
371 2523383371
372 2585308010
373 2601445697
374 2643761614
375 2643780605
376 2643782326
377 2643929250
378 2643929375
379 2739204247
380 2776915093
381 2809028626
382 2833713077
383 2838023557
384 2842199071
385 2848553146
386 2881635425
387 2883824072
388 2902804330
389 2919719693
390 3006327116
391 8008488490
392 8019637389
393 8019674889
394 8025527463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

43

295

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wzm-assembly2.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9623 6 269
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.9401 4 270
4q3m-assembly3.cif.gz_E crystal structure of mgs-m4, an aldo-keto reductase enzyme from a medee basin deep-sea metagenome library 0.9369 8 265
4g5d-assembly2.cif.gz_B x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph 0.9366 3 270
4q3m-assembly1.cif.gz_B crystal structure of mgs-m4, an aldo-keto reductase enzyme from a medee basin deep-sea metagenome library 0.936 6 266
ID Description Score Start End Superfamily
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9623 6 269 3.20.20.100
af_C7IWJ1_1_81_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9502 7 79 3.20.20.100
af_P91021_30_130_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9466 6 81 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9404 6 269 3.20.20.100
af_U3JA33_6_289_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9363 4 269 3.20.20.100
ID Description Score Start End GO Terms
AF-T0VLN1-F1-model_v4 deleted 0.9883 145 268
AF-C2EMU2-F1-model_v4 Oxidoreductase, aldo/keto reductase family protein (EC 1.1.1.274) 0.9856 135 269 GO:0004033
GO:0044281
GO:0050580
AF-A0A645C6V9-F1-model_v4 Glyoxal reductase (EC 1.1.1.-) 0.9835 135 270 GO:0004033
GO:0044281
AF-A0A7S0N9Y7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.981 130 265 GO:0004033
GO:0044281
AF-A0A1Q3DP60-F1-model_v4 deleted 0.9785 1 281

Map