F302750

General Info

Members Datasets Scaffolds Average Seq Length
197 132 192 261

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100185817|Ga0068855_1001858172
Length 281
Sequence VSTPTEGRTPAFADGSAGDADYGAIGEQYSRYRRADPRIAARILEALGGARSVLNVGAGAGSYEPTDRKVTAVEPSASMRAQRPPGLPRAVDAVAEHLPFDDASFDAVMTTFSVHQWSDLDAGLAELRRVSRGPVVILSCDPDELGRFWLGQYAPEVIAIEARRYPAISRLAQALDRPTTVGSVPIPLDCTDGFGEAYYGRPEAFLDPAARRANSAWSFVDAATAARYVAALAADLESGEWDRRFGALRSQPEFDGSLRLIVGWIDPLREWRASSCCAHRG

Samples

Sample ID Description Type Environment
1 2643221734 Bosea sp. Root670 Isolate Unclassified
2 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
3 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
4 2909042592 Labrys sp. LIt4 Isolate Nodule
5 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
126 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
127 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 0.51
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.72
Nodule 0.51
Rhizoplane 0.51
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000092 3300002774 Bacteria 51251
2 JGI25151J46595_10000007 3300003187 Bacteria 411751
3 JGI25151J46595_10000063 3300003187 Bacteria 146046
4 JGI25151J46595_10022154 3300003187 Bacteria 2643
5 JGI25153J46596_10002551 3300003215 Bacteria 10442
6 Ga0055526_1000202 3300003771 Bacteria 51431
7 Ga0055524_1000144 3300003775 Bacteria 84213
8 Ga0065165_1006636 3300005262 Bacteria 5981
9 Ga0070658_10001629 3300005327 Bacteria 18977
10 Ga0070658_10021816 3300005327 Bacteria 5133
11 Ga0068868_100018808 3300005338 Bacteria 5169
12 Ga0070660_100048014 3300005339 Bacteria 3277
13 Ga0070661_100140374 3300005344 Bacteria 1820
14 Ga0070668_100635875 3300005347 Unclassified 936
15 Ga0070659_100000922 3300005366 Bacteria 21545
16 Ga0070659_100005122 3300005366 Bacteria 9403
17 Ga0070667_100020234 3300005367 Bacteria 5525
18 Ga0070667_100516292 3300005367 Bacteria 1096
19 Ga0070714_100335806 3300005435 Unclassified 1416
20 Ga0070711_100010804 3300005439 Bacteria 5662
21 Ga0070663_100010171 3300005455 Bacteria 5856
22 Ga0070685_10021937 3300005466 Bacteria 3475
23 Ga0068853_100099673 3300005539 Bacteria 2567
24 Ga0068853_100507368 3300005539 Bacteria 1139
25 Ga0068855_100185817 3300005563 Bacteria 2347
26 Ga0068857_100001238 3300005577 Bacteria 19931
27 Ga0068857_100152885 3300005577 Bacteria 2092
28 Ga0068856_100058884 3300005614 Bacteria 3794
29 Ga0068856_100453963 3300005614 Bacteria 1303
30 Ga0068852_100304015 3300005616 Bacteria 1545
31 Ga0068859_100059066 3300005617 Bacteria 3864
32 Ga0068859_100375508 3300005617 Bacteria 1517
33 Ga0068851_10000003 3300005834 Bacteria 293018
34 Ga0068858_100000934 3300005842 Bacteria 30301
35 Ga0081455_10089799 3300005937 Bacteria 2492
36 Ga0070716_100144179 3300006173 Unclassified 1523
37 Ga0075433_10002762 3300006852 Bacteria 13429
38 Ga0097620_100059066 3300006931 Bacteria 3864
39 Ga0097620_100375539 3300006931 Bacteria 1517
40 Ga0105240_10023014 3300009093 Bacteria 8252
41 Ga0105240_10422066 3300009093 Bacteria 1498
42 Ga0105240_10636777 3300009093 Bacteria 1170
43 Ga0105245_10016901 3300009098 Bacteria 6370
44 Ga0105237_10000751 3300009545 Bacteria 44426
45 Ga0105237_10017582 3300009545 Bacteria 7411
46 Ga0105238_10455653 3300009551 Bacteria 1276
47 Ga0105239_10010336 3300010375 Bacteria 10451
48 Ga0105239_10013744 3300010375 Bacteria 8987
49 Ga0105239_10122637 3300010375 Bacteria 2887
50 Ga0157370_10004548 3300013104 Bacteria 15878
51 Ga0157370_10007452 3300013104 Bacteria 11896
52 Ga0157379_10069287 3300014968 Bacteria 3154
53 Ga0207425_1000018 3300025245 Bacteria 411841
54 Ga0209148_1011466 3300025254 Bacteria 1646
55 Ga0209129_1000026 3300025258 Bacteria 411839
56 Ga0209129_1000209 3300025258 Bacteria 68109
57 Ga0209673_1014592 3300025273 Bacteria 3033
58 Ga0209675_1002438 3300025291 Bacteria 9556
59 Ga0209025_1000014 3300025294 Bacteria 865448
60 Ga0209025_1000035 3300025294 Bacteria 411841
61 Ga0209025_1000878 3300025294 Bacteria 47176
62 Ga0209564_1000187 3300025295 Bacteria 146950
63 Ga0209758_1000040 3300025297 Bacteria 411841
64 Ga0209256_1000055 3300025299 Bacteria 295530
65 Ga0207426_1009043 3300025302 Bacteria 3965
66 Ga0209051_1034770 3300025303 Bacteria 1884
67 Ga0207656_10000012 3300025321 Bacteria 190545
68 Ga0207705_10000006 3300025909 Bacteria 657147
69 Ga0207705_10005504 3300025909 Bacteria 9469
70 Ga0207705_10016434 3300025909 Bacteria 5304
71 Ga0207705_10150192 3300025909 Bacteria 1746
72 Ga0207695_10002567 3300025913 Bacteria 26687
73 Ga0207671_10000002 3300025914 Bacteria 1144816
74 Ga0207671_10090568 3300025914 Bacteria 2304
75 Ga0207663_10007435 3300025916 Bacteria 5679
76 Ga0207657_10103693 3300025919 Bacteria 2357
77 Ga0207649_10115430 3300025920 Bacteria 1801
78 Ga0207694_10000061 3300025924 Bacteria 141236
79 Ga0207687_10091801 3300025927 Bacteria 2216
80 Ga0207690_10189605 3300025932 Bacteria 1554
81 Ga0207667_10034979 3300025949 Bacteria 5392
82 Ga0207667_10089874 3300025949 Bacteria 3173
83 Ga0207667_10132705 3300025949 Bacteria 2565
84 Ga0207658_10016445 3300025986 Bacteria 5088
85 Ga0207658_10635891 3300025986 Bacteria 961
86 Ga0207677_10002865 3300026023 Bacteria 9101
87 Ga0207703_10000828 3300026035 Bacteria 30430
88 Ga0207639_10444120 3300026041 Bacteria 1176
89 Ga0207639_10532939 3300026041 Bacteria 1076
90 Ga0207678_10040830 3300026067 Bacteria 4022
91 Ga0207702_10029190 3300026078 Bacteria 4588
92 Ga0207702_10303859 3300026078 Bacteria 1515
93 Ga0207641_10079256 3300026088 Bacteria 2847
94 Ga0207674_10014791 3300026116 Bacteria 8606
95 Ga0207698_10004017 3300026142 Bacteria 8929
96 Ga0372808_000854 3300036459 Bacteria 2807
97 Ga0395899_0075304 3300037312 Bacteria 2465
98 Ga0451837_0951168 3300041494 Bacteria 2643
99 Ga0466961_0072820 3300044693 Bacteria 2179
100 Ga0466961_0230420 3300044693 Bacteria 1140
101 Ga0466963_0006288 3300044694 Bacteria 7022
102 Ga0466963_0099434 3300044694 Bacteria 1990
103 Ga0466964_0029201 3300044706 Bacteria 2176
104 Ga0466964_0119008 3300044706 Bacteria 1188
105 Ga0466957_0008451 3300044842 Bacteria 5856
106 Ga0466957_0402150 3300044842 Bacteria 937
107 Ga0466958_0083431 3300045836 Bacteria 1969
108 Ga0466967_0017860 3300045976 Bacteria 5650
109 Ga0495606_0029769 3300046507 Bacteria 3826
110 Ga0495640_0008204 3300046533 Bacteria 8200
111 Ga0495640_0249166 3300046533 Bacteria 1113
112 Ga0495587_0011729 3300046536 Bacteria 5546
113 Ga0495671_0130330 3300046692 Unclassified 1226
114 Ga0496100_0240436 3300048903 Bacteria 1336
115 Ga0496120_0017470 3300048923 Bacteria 4651
116 Ga0496120_0055170 3300048923 Unclassified 2248
117 Ga0496122_0002118 3300048925 Bacteria 29315
118 Ga0496125_0296371 3300048928 Bacteria 993
119 Ga0496126_0059787 3300048929 Bacteria 3431
120 Ga0496126_0116351 3300048929 Bacteria 2324
121 Ga0496126_0462950 3300048929 Bacteria 1019
122 Ga0501031_0012743 3300049568 Bacteria 5492
123 Ga0501032_0011460 3300049569 Bacteria 6369
124 Ga0501032_0038192 3300049569 Bacteria 3272
125 Ga0501032_0196303 3300049569 Bacteria 1318
126 Ga0501033_0021475 3300049570 Bacteria 4870
127 Ga0501033_0118465 3300049570 Bacteria 1923
128 Ga0501034_0007630 3300049571 Bacteria 11508
129 Ga0501034_0008070 3300049571 Bacteria 11170
130 Ga0501034_0397383 3300049571 Bacteria 1301
131 Ga0501036_0002424 3300049572 Bacteria 14599
132 Ga0501036_0092347 3300049572 Bacteria 2557
133 Ga0501036_0722433 3300049572 Bacteria 822
134 Ga0501037_0024554 3300049573 Bacteria 4457
135 Ga0501037_0060182 3300049573 Bacteria 2770
136 Ga0501037_0277694 3300049573 Bacteria 1168
137 Ga0501037_0303213 3300049573 Bacteria 1109
138 Ga0501038_0016031 3300049574 Bacteria 6806
139 Ga0501038_0091628 3300049574 Bacteria 2546
140 Ga0501039_0031248 3300049575 Bacteria 4105
141 Ga0501040_0087152 3300049576 Bacteria 2167
142 Ga0501041_0002260 3300049577 Bacteria 10894
143 Ga0501042_0028356 3300049578 Bacteria 3943
144 Ga0501043_0004994 3300049579 Bacteria 10732
145 Ga0501043_0069177 3300049579 Bacteria 2773
146 Ga0501043_0124081 3300049579 Bacteria 2025
147 Ga0501046_0015552 3300049580 Bacteria 6390
148 Ga0501046_0141331 3300049580 Bacteria 1821
149 Ga0501046_0192536 3300049580 Bacteria 1520
150 Ga0501047_0000281 3300049581 Bacteria 58767
151 Ga0501047_0041737 3300049581 Bacteria 4432
152 Ga0501048_0001755 3300049582 Bacteria 16492
153 Ga0501067_0000715 3300049583 Bacteria 17913
154 Ga0501068_0001365 3300049584 Bacteria 12961
155 Ga0501069_0023373 3300049585 Bacteria 3370
156 Ga0501070_0015688 3300049586 Bacteria 6369
157 Ga0501071_0007060 3300049587 Bacteria 7340
158 Ga0501071_0153648 3300049587 Bacteria 1718
159 Ga0501072_0017159 3300049588 Bacteria 5562
160 Ga0501073_0046965 3300049589 Bacteria 3035
161 Ga0501074_0062206 3300049590 Bacteria 2688
162 Ga0501074_0097242 3300049590 Bacteria 2108
163 Ga0501074_0129799 3300049590 Bacteria 1803
164 Ga0501076_0013485 3300049592 Bacteria 6130
165 Ga0501079_0010690 3300049741 Bacteria 6989
166 Ga0501080_0140536 3300049742 Bacteria 2232
167 Ga0501080_0184961 3300049742 Bacteria 1916
168 Ga0501083_0009381 3300049744 Bacteria 6909
169 Ga0501083_0158275 3300049744 Bacteria 1482
170 Ga0501035_0000689 3300049822 Bacteria 36879
171 Ga0501035_0027137 3300049822 Bacteria 5236
172 Ga0501035_0070000 3300049822 Bacteria 3109
173 Ga0501035_0157638 3300049822 Bacteria 1966
174 Ga0501044_0000737 3300049823 Bacteria 39428
175 Ga0501044_0037189 3300049823 Bacteria 5089
176 Ga0501044_0078613 3300049823 Bacteria 3343
177 Ga0501044_0136673 3300049823 Bacteria 2442
178 Ga0501044_0388603 3300049823 Bacteria 1309
179 nmdc:mga0a205_922_c2 3300050515 Bacteria 12948
180 Ga0495601_0204127 3300053077 Bacteria 1291
181 Ga0495612_0000256 3300053078 Bacteria 21965
182 Ga0500635_0083422 3300053080 Bacteria 1152
183 Ga0500651_0000749 3300053093 Bacteria 15843
184 Ga0500555_007911 3300053103 Bacteria 3023
185 Ga0500572_000257 3300053111 Bacteria 19086
186 Ga0500577_0035638 3300053142 Bacteria 1776
187 Ga0500616_0007513 3300053153 Bacteria 6903
188 Ga0500620_002554 3300053155 Bacteria 3699
189 Ga0501084_0127081 3300054114 Bacteria 2145
190 Ga0501082_0005450 3300060353 Bacteria 11048
191 Ga0501082_0459691 3300060353 Bacteria 1112
192 Ga0530510_0149101 3300061734 Bacteria 1726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0402150 Ga0466957_0402150_51_836 247
2 3300046533 Ga0495640_0249166 Ga0495640_0249166_326_1075 248
3 3300053077 Ga0495601_0204127 Ga0495601_0204127_224_973 248
4 3300053078 Ga0495612_0000256 Ga0495612_0000256_13173_13922 248
5 3300005439 Ga0070711_100010804 Ga0070711_1000108047 249
6 3300006173 Ga0070716_100144179 Ga0070716_1001441792 249
7 3300006852 Ga0075433_10002762 Ga0075433_100027622 249
8 3300025916 Ga0207663_10007435 Ga0207663_100074353 249
9 3300046533 Ga0495640_0008204 Ga0495640_0008204_5079_5831 249
10 3300046536 Ga0495587_0011729 Ga0495587_0011729_1584_2336 249
11 3300050515 nmdc:mga0a205_922_c2 nmdc:mga0a205_922_c2_10928_11680 249
12 3300044693 Ga0466961_0072820 Ga0466961_0072820_784_1569 250
13 3300005435 Ga0070714_100335806 Ga0070714_1003358061 251
14 3300044694 Ga0466963_0099434 Ga0466963_0099434_216_971 251
15 3300044706 Ga0466964_0119008 Ga0466964_0119008_133_888 251
16 3300013104 Ga0157370_10007452 Ga0157370_100074527 254
17 3300025302 Ga0207426_1009043 Ga0207426_10090435 254
18 iso_pu_bacteria 2883354860 2883357838 254
19 iso_pu_bacteria 2909042592 2909045414 254
20 iso_pu_bacteria 2918501144 2918507333 254
21 3300053103 Ga0500555_007911 Ga0500555_007911_659_1426 255
22 3300037312 Ga0395899_0075304 Ga0395899_0075304_385_1155 256
23 3300049569 Ga0501032_0038192 Ga0501032_0038192_2230_3000 256
24 3300049569 Ga0501032_0196303 Ga0501032_0196303_293_1066 256
25 3300049571 Ga0501034_0008070 Ga0501034_0008070_300_1070 256
26 3300049571 Ga0501034_0397383 Ga0501034_0397383_300_1070 256
27 3300049572 Ga0501036_0092347 Ga0501036_0092347_1513_2283 256
28 3300049573 Ga0501037_0303213 Ga0501037_0303213_237_1007 256
29 3300049579 Ga0501043_0124081 Ga0501043_0124081_569_1342 256
30 3300049580 Ga0501046_0192536 Ga0501046_0192536_77_850 256
31 3300049581 Ga0501047_0041737 Ga0501047_0041737_2110_2883 256
32 3300049587 Ga0501071_0153648 Ga0501071_0153648_65_835 256
33 3300049822 Ga0501035_0027137 Ga0501035_0027137_219_992 256
34 3300049823 Ga0501044_0136673 Ga0501044_0136673_699_1472 256
35 3300005617 Ga0068859_100375508 Ga0068859_1003755082 257
36 3300006931 Ga0097620_100375539 Ga0097620_1003755392 257
37 3300046692 Ga0495671_0130330 Ga0495671_0130330_420_1193 257
38 3300049568 Ga0501031_0012743 Ga0501031_0012743_561_1334 257
39 3300049569 Ga0501032_0011460 Ga0501032_0011460_1819_2592 257
40 3300049570 Ga0501033_0021475 Ga0501033_0021475_2524_3297 257
41 3300049571 Ga0501034_0007630 Ga0501034_0007630_6557_7330 257
42 3300049572 Ga0501036_0002424 Ga0501036_0002424_10917_11690 257
43 3300049573 Ga0501037_0024554 Ga0501037_0024554_1819_2592 257
44 3300049574 Ga0501038_0016031 Ga0501038_0016031_1875_2648 257
45 3300049576 Ga0501040_0087152 Ga0501040_0087152_60_833 257
46 3300049577 Ga0501041_0002260 Ga0501041_0002260_2788_3561 257
47 3300049578 Ga0501042_0028356 Ga0501042_0028356_159_932 257
48 3300049579 Ga0501043_0004994 Ga0501043_0004994_6608_7381 257
49 3300049580 Ga0501046_0015552 Ga0501046_0015552_1391_2164 257
50 3300049581 Ga0501047_0000281 Ga0501047_0000281_18472_19245 257
51 3300049582 Ga0501048_0001755 Ga0501048_0001755_3778_4551 257
52 3300049583 Ga0501067_0000715 Ga0501067_0000715_15567_16340 257
53 3300049584 Ga0501068_0001365 Ga0501068_0001365_6698_7471 257
54 3300049585 Ga0501069_0023373 Ga0501069_0023373_1335_2108 257
55 3300049586 Ga0501070_0015688 Ga0501070_0015688_1819_2592 257
56 3300049587 Ga0501071_0007060 Ga0501071_0007060_1278_2051 257
57 3300049588 Ga0501072_0017159 Ga0501072_0017159_3672_4445 257
58 3300049589 Ga0501073_0046965 Ga0501073_0046965_689_1462 257
59 3300049590 Ga0501074_0062206 Ga0501074_0062206_342_1115 257
60 3300049592 Ga0501076_0013485 Ga0501076_0013485_4369_5142 257
61 3300049741 Ga0501079_0010690 Ga0501079_0010690_159_932 257
62 3300049742 Ga0501080_0140536 Ga0501080_0140536_1118_1891 257
63 3300049744 Ga0501083_0009381 Ga0501083_0009381_1940_2713 257
64 3300049822 Ga0501035_0000689 Ga0501035_0000689_6462_7235 257
65 3300049822 Ga0501035_0157638 Ga0501035_0157638_921_1694 257
66 3300049823 Ga0501044_0000737 Ga0501044_0000737_6557_7330 257
67 3300054114 Ga0501084_0127081 Ga0501084_0127081_1313_2086 257
68 3300060353 Ga0501082_0005450 Ga0501082_0005450_59_832 257
69 3300061734 Ga0530510_0149101 Ga0530510_0149101_59_832 257
70 3300005262 Ga0065165_1006636 Ga0065165_10066364 258
71 3300041494 Ga0451837_0951168 Ga0451837_0951168_348_1124 258
72 3300049572 Ga0501036_0722433 Ga0501036_0722433_36_812 258
73 3300049573 Ga0501037_0060182 Ga0501037_0060182_342_1118 258
74 3300049573 Ga0501037_0277694 Ga0501037_0277694_89_865 258
75 3300049574 Ga0501038_0091628 Ga0501038_0091628_283_1059 258
76 3300049575 Ga0501039_0031248 Ga0501039_0031248_2563_3339 258
77 3300049579 Ga0501043_0069177 Ga0501043_0069177_654_1430 258
78 3300049580 Ga0501046_0141331 Ga0501046_0141331_361_1137 258
79 3300049590 Ga0501074_0097242 Ga0501074_0097242_92_868 258
80 3300049590 Ga0501074_0129799 Ga0501074_0129799_37_813 258
81 3300049822 Ga0501035_0070000 Ga0501035_0070000_2071_2847 258
82 3300049823 Ga0501044_0037189 Ga0501044_0037189_1143_1919 258
83 3300049823 Ga0501044_0078613 Ga0501044_0078613_2176_2952 258
84 3300049823 Ga0501044_0388603 Ga0501044_0388603_328_1104 258
85 3300053153 Ga0500616_0007513 Ga0500616_0007513_1785_2561 258
86 iso_pu_bacteria 2848551377 2848552031 258
87 3300003187 JGI25151J46595_10000063 JGI25151J46595_1000006312 259
88 3300003771 Ga0055526_1000202 Ga0055526_100020238 259
89 3300003775 Ga0055524_1000144 Ga0055524_100014422 259
90 3300009545 Ga0105237_10017582 Ga0105237_100175824 259
91 3300010375 Ga0105239_10010336 Ga0105239_100103366 259
92 3300025273 Ga0209673_1014592 Ga0209673_10145925 259
93 3300025291 Ga0209675_1002438 Ga0209675_10024385 259
94 3300025294 Ga0209025_1000014 Ga0209025_1000014561 259
95 3300025295 Ga0209564_1000187 Ga0209564_100018766 259
96 3300025299 Ga0209256_1000055 Ga0209256_1000055225 259
97 3300025914 Ga0207671_10090568 Ga0207671_100905682 259
98 3300046507 Ga0495606_0029769 Ga0495606_0029769_1355_2134 259
99 3300048903 Ga0496100_0240436 Ga0496100_0240436_179_958 259
100 3300048928 Ga0496125_0296371 Ga0496125_0296371_159_950 259
101 iso_pu_bacteria 2643221734 2644735838 259
102 3300005327 Ga0070658_10001629 Ga0070658_1000162916 260
103 3300005366 Ga0070659_100005122 Ga0070659_10000512211 260
104 3300005455 Ga0070663_100010171 Ga0070663_1000101715 260
105 3300005539 Ga0068853_100507368 Ga0068853_1005073682 260
106 3300005937 Ga0081455_10089799 Ga0081455_100897992 260
107 3300009093 Ga0105240_10422066 Ga0105240_104220662 260
108 3300013104 Ga0157370_10004548 Ga0157370_100045486 260
109 3300025909 Ga0207705_10000006 Ga0207705_10000006129 260
110 3300025932 Ga0207690_10189605 Ga0207690_101896052 260
111 3300025949 Ga0207667_10034979 Ga0207667_100349792 260
112 3300026041 Ga0207639_10532939 Ga0207639_105329392 260
113 3300026067 Ga0207678_10040830 Ga0207678_100408303 260
114 3300036459 Ga0372808_000854 Ga0372808_000854_1962_2795 260
115 3300049570 Ga0501033_0118465 Ga0501033_0118465_144_938 260
116 3300053093 Ga0500651_0000749 Ga0500651_0000749_8420_9202 260
117 3300053142 Ga0500577_0035638 Ga0500577_0035638_763_1548 261
118 3300048925 Ga0496122_0002118 Ga0496122_0002118_12600_13388 262
119 3300005327 Ga0070658_10021816 Ga0070658_100218163 263
120 3300005338 Ga0068868_100018808 Ga0068868_1000188083 263
121 3300005339 Ga0070660_100048014 Ga0070660_1000480144 263
122 3300005344 Ga0070661_100140374 Ga0070661_1001403742 263
123 3300005366 Ga0070659_100000922 Ga0070659_1000009226 263
124 3300005367 Ga0070667_100020234 Ga0070667_1000202343 263
125 3300005466 Ga0070685_10021937 Ga0070685_100219372 263
126 3300005539 Ga0068853_100099673 Ga0068853_1000996734 263
127 3300005577 Ga0068857_100152885 Ga0068857_1001528852 263
128 3300005614 Ga0068856_100058884 Ga0068856_1000588845 263
129 3300005617 Ga0068859_100059066 Ga0068859_1000590662 263
130 3300005842 Ga0068858_100000934 Ga0068858_10000093427 263
131 3300006931 Ga0097620_100059066 Ga0097620_1000590662 263
132 3300009093 Ga0105240_10023014 Ga0105240_100230144 263
133 3300009093 Ga0105240_10636777 Ga0105240_106367771 263
134 3300009098 Ga0105245_10016901 Ga0105245_100169014 263
135 3300009551 Ga0105238_10455653 Ga0105238_104556532 263
136 3300010375 Ga0105239_10122637 Ga0105239_101226373 263
137 3300014968 Ga0157379_10069287 Ga0157379_100692873 263
138 3300025909 Ga0207705_10005504 Ga0207705_100055044 263
139 3300025909 Ga0207705_10016434 Ga0207705_100164343 263
140 3300025913 Ga0207695_10002567 Ga0207695_100025679 263
141 3300025919 Ga0207657_10103693 Ga0207657_101036933 263
142 3300025920 Ga0207649_10115430 Ga0207649_101154302 263
143 3300025927 Ga0207687_10091801 Ga0207687_100918012 263
144 3300025949 Ga0207667_10089874 Ga0207667_100898742 263
145 3300025986 Ga0207658_10016445 Ga0207658_100164454 263
146 3300026023 Ga0207677_10002865 Ga0207677_100028653 263
147 3300026035 Ga0207703_10000828 Ga0207703_100008282 263
148 3300026041 Ga0207639_10444120 Ga0207639_104441202 263
149 3300026078 Ga0207702_10029190 Ga0207702_100291902 263
150 3300048923 Ga0496120_0017470 Ga0496120_0017470_2870_3661 263
151 3300005577 Ga0068857_100001238 Ga0068857_10000123813 264
152 3300005614 Ga0068856_100453963 Ga0068856_1004539632 264
153 3300005616 Ga0068852_100304015 Ga0068852_1003040152 264
154 3300005834 Ga0068851_10000003 Ga0068851_10000003275 264
155 3300009545 Ga0105237_10000751 Ga0105237_1000075113 264
156 3300010375 Ga0105239_10013744 Ga0105239_100137442 264
157 3300025254 Ga0209148_1011466 Ga0209148_10114662 264
158 3300025321 Ga0207656_10000012 Ga0207656_10000012148 264
159 3300025909 Ga0207705_10150192 Ga0207705_101501923 264
160 3300025914 Ga0207671_10000002 Ga0207671_10000002256 264
161 3300026116 Ga0207674_10014791 Ga0207674_100147912 264
162 3300026142 Ga0207698_10004017 Ga0207698_100040172 264
163 3300044693 Ga0466961_0230420 Ga0466961_0230420_87_884 264
164 3300044694 Ga0466963_0006288 Ga0466963_0006288_746_1543 264
165 3300044706 Ga0466964_0029201 Ga0466964_0029201_216_1013 264
166 3300044842 Ga0466957_0008451 Ga0466957_0008451_592_1389 264
167 3300045836 Ga0466958_0083431 Ga0466958_0083431_476_1273 264
168 3300045976 Ga0466967_0017860 Ga0466967_0017860_970_1767 264
169 3300048923 Ga0496120_0055170 Ga0496120_0055170_415_1209 264
170 3300048929 Ga0496126_0116351 Ga0496126_0116351_1044_1838 264
171 3300048929 Ga0496126_0462950 Ga0496126_0462950_164_958 264
172 3300053155 Ga0500620_002554 Ga0500620_002554_2794_3594 264
173 3300005563 Ga0068855_100185817 Ga0068855_1001858172 265
174 3300025924 Ga0207694_10000061 Ga0207694_1000006143 265
175 3300025949 Ga0207667_10132705 Ga0207667_101327052 265
176 3300026078 Ga0207702_10303859 Ga0207702_103038592 265
177 3300026088 Ga0207641_10079256 Ga0207641_100792562 265
178 3300053080 Ga0500635_0083422 Ga0500635_0083422_205_1002 265
179 3300025258 Ga0209129_1000209 Ga0209129_100020945 266
180 3300025294 Ga0209025_1000878 Ga0209025_100087837 266
181 3300025303 Ga0209051_1034770 Ga0209051_10347701 266
182 3300049742 Ga0501080_0184961 Ga0501080_0184961_468_1310 266
183 3300049744 Ga0501083_0158275 Ga0501083_0158275_616_1458 266
184 3300060353 Ga0501082_0459691 Ga0501082_0459691_58_900 266
185 3300053111 Ga0500572_000257 Ga0500572_000257_1601_2449 268
186 3300003187 JGI25151J46595_10022154 JGI25151J46595_100221543 269
187 3300048929 Ga0496126_0059787 Ga0496126_0059787_1775_2590 271
188 3300002774 JGI25150J39212_1000092 JGI25150J39212_100009239 276
189 3300003187 JGI25151J46595_10000007 JGI25151J46595_100000079 276
190 3300003215 JGI25153J46596_10002551 JGI25153J46596_100025516 276
191 3300005347 Ga0070668_100635875 Ga0070668_1006358751 276
192 3300005367 Ga0070667_100516292 Ga0070667_1005162922 276
193 3300025245 Ga0207425_1000018 Ga0207425_1000018321 276
194 3300025258 Ga0209129_1000026 Ga0209129_10000268 276
195 3300025294 Ga0209025_1000035 Ga0209025_10000358 276
196 3300025297 Ga0209758_1000040 Ga0209758_10000408 276
197 3300025986 Ga0207658_10635891 Ga0207658_106358911 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

54

137

0.86

PF13649

Methyltransf_25

Methyltransferase domain

53

133

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.9152 37 268
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.859 37 268
5dpm-assembly1.cif.gz_A crystal structure of ubig mutant in complex with sah 0.8522 42 146
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8036 57 144
1ve3-assembly2.cif.gz_B-2 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.8025 23 152
ID Description Score Start End Superfamily
af_Q54QA3_21_266_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9738 30 269 3.40.50.150
af_Q54QA3_21_266_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9467 30 269 3.40.50.150
af_Q54LN8_1_115_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9411 100 136 3.40.50.150
3egeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9041 37 268 3.40.50.150
af_A0A0R0II64_62_165_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8926 100 147 3.40.50.150
ID Description Score Start End GO Terms
AF-A9WRX7-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9883 18 189 GO:0008757
AF-A0A4R6SEC9-F1-model_v4 Methyltransferase family protein 0.9842 49 269 GO:0008757
GO:0032259
AF-A0A6P0QVU7-F1-model_v4 deleted 0.9842 78 271
AF-A0A7W7CDV2-F1-model_v4 SAM-dependent methyltransferase 0.981 17 268 GO:0008757
GO:0032259
AF-A0A2S6IES7-F1-model_v4 Methyltransferase family protein 0.9805 33 269 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
89.24 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map