F302731
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 197 | 138 | 192 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100288796|Ga0070686_1002887961 |
| Length | 317 |
| Sequence | LNVYTRNFVNEDRPLSDNFESAMQRRTLIKAGGILAVAQISGMSTLSALAALGKELSPSERMPIMFVGHGNPMNAIEDNVYHKSWQALGKTLPRPQAILSVSAHWITKGTKVASMSHPKTIHDFGGFPKKLFDQEYPAPGSPEFAKLTKELVTYSHIQTDESWGLDHGTWSVLLPMYPAADIPVYQLSLDYDQPPTYHYEIGKQLSKLRDKGVLIIGSGNLVHNLREVDWAGGKQVYDWAREFDAKFTEWMDKGDHASILNYQKILGNTATMAHPTYDHLLPLFYILGLQQKKEKITYFNDQFDMASVSMRSMLIHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 2 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 3 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 4 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 5 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 78 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 79 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 80 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 82 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 83 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 86 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 87 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 89 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 90 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 92 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 93 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 95 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 100 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 101 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 102 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 103 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 104 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 105 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 106 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 127 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 128 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 135 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 136 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.46 |
| Metatranscriptomes | 0 |
| Isolates | 2.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.51 |
| Bulb | 0 |
| Endosphere | 2.54 |
| Nodule | 0 |
| Rhizoplane | 1.02 |
| Rhizosphere | 92.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100003201 | 3300005330 | Bacteria | 8928 |
| 2 | Ga0070670_100007834 | 3300005331 | Bacteria | 9089 |
| 3 | Ga0070666_10001137 | 3300005335 | Bacteria | 16197 |
| 4 | Ga0068868_100005508 | 3300005338 | Bacteria | 8903 |
| 5 | Ga0070671_100016426 | 3300005355 | Bacteria | 5985 |
| 6 | Ga0070667_100071661 | 3300005367 | Unclassified | 2951 |
| 7 | Ga0070709_10009730 | 3300005434 | Bacteria | 5309 |
| 8 | Ga0070709_10175313 | 3300005434 | Bacteria | 1501 |
| 9 | Ga0070714_100000051 | 3300005435 | Bacteria | 110289 |
| 10 | Ga0070713_100000876 | 3300005436 | Bacteria | 19291 |
| 11 | Ga0070713_100002684 | 3300005436 | Bacteria | 11605 |
| 12 | Ga0070713_100656029 | 3300005436 | Bacteria | 999 |
| 13 | Ga0070713_100756953 | 3300005436 | Bacteria | 929 |
| 14 | Ga0070710_10043709 | 3300005437 | Bacteria | 2483 |
| 15 | Ga0070681_10000202 | 3300005458 | Bacteria | 46492 |
| 16 | Ga0070679_100415927 | 3300005530 | Bacteria | 1290 |
| 17 | Ga0070679_100452653 | 3300005530 | Bacteria | 1228 |
| 18 | Ga0070672_100001694 | 3300005543 | Bacteria | 13762 |
| 19 | Ga0070686_100288796 | 3300005544 | Unclassified | 1212 |
| 20 | Ga0070665_100261024 | 3300005548 | Bacteria | 1733 |
| 21 | Ga0070664_100007205 | 3300005564 | Bacteria | 8971 |
| 22 | Ga0068856_100020090 | 3300005614 | Bacteria | 6486 |
| 23 | Ga0068864_100003613 | 3300005618 | Bacteria | 12788 |
| 24 | Ga0068870_10127885 | 3300005840 | Bacteria | 1472 |
| 25 | Ga0068863_100053375 | 3300005841 | Archaea | 3831 |
| 26 | Ga0068863_100198611 | 3300005841 | Bacteria | 1928 |
| 27 | Ga0068858_100023284 | 3300005842 | Bacteria | 5771 |
| 28 | Ga0070717_10005386 | 3300006028 | Bacteria | 9339 |
| 29 | Ga0070717_10031327 | 3300006028 | Bacteria | 4277 |
| 30 | Ga0070717_10121429 | 3300006028 | Bacteria | 2238 |
| 31 | Ga0070717_10295037 | 3300006028 | Bacteria | 1440 |
| 32 | Ga0075364_10012796 | 3300006051 | Bacteria | 5146 |
| 33 | Ga0070716_100078723 | 3300006173 | Bacteria | 1960 |
| 34 | Ga0070712_100001429 | 3300006175 | Bacteria | 14560 |
| 35 | Ga0070712_100018149 | 3300006175 | Bacteria | 4565 |
| 36 | Ga0097621_100062808 | 3300006237 | Bacteria | 3050 |
| 37 | Ga0097621_100121156 | 3300006237 | Bacteria | 2219 |
| 38 | Ga0075370_10003196 | 3300006353 | Bacteria | 7756 |
| 39 | Ga0068871_100015550 | 3300006358 | Bacteria | 5700 |
| 40 | Ga0075428_100907635 | 3300006844 | Bacteria | 934 |
| 41 | Ga0105240_10000390 | 3300009093 | Bacteria | 82256 |
| 42 | Ga0105240_10037636 | 3300009093 | Bacteria | 6216 |
| 43 | Ga0105240_10085589 | 3300009093 | Unclassified | 3862 |
| 44 | Ga0105242_10925130 | 3300009176 | Unclassified | 874 |
| 45 | Ga0105248_10001841 | 3300009177 | Bacteria | 23501 |
| 46 | Ga0105237_10003688 | 3300009545 | Bacteria | 18053 |
| 47 | Ga0105237_10118721 | 3300009545 | Unclassified | 2639 |
| 48 | Ga0105239_10000184 | 3300010375 | Bacteria | 91348 |
| 49 | Ga0105239_10033818 | 3300010375 | Bacteria | 5612 |
| 50 | Ga0157369_10576148 | 3300013105 | Bacteria | 1163 |
| 51 | Ga0157374_10505053 | 3300013296 | Unclassified | 1214 |
| 52 | Ga0157378_10037390 | 3300013297 | Bacteria | 4299 |
| 53 | Ga0157375_10005323 | 3300013308 | Bacteria | 11181 |
| 54 | Ga0157375_10680766 | 3300013308 | Bacteria | 1183 |
| 55 | Ga0163163_10027228 | 3300014325 | Bacteria | 5474 |
| 56 | Ga0163163_10033698 | 3300014325 | Bacteria | 4957 |
| 57 | Ga0163163_10125539 | 3300014325 | Bacteria | 2604 |
| 58 | Ga0157380_10002640 | 3300014326 | Bacteria | 12145 |
| 59 | Ga0157377_10146140 | 3300014745 | Unclassified | 1458 |
| 60 | Ga0157376_10116463 | 3300014969 | Bacteria | 2361 |
| 61 | Ga0207692_10156430 | 3300025898 | Bacteria | 1310 |
| 62 | Ga0207680_10034916 | 3300025903 | Unclassified | 2881 |
| 63 | Ga0207647_10017536 | 3300025904 | Bacteria | 4865 |
| 64 | Ga0207699_10005397 | 3300025906 | Bacteria | 6127 |
| 65 | Ga0207707_10000177 | 3300025912 | Bacteria | 66169 |
| 66 | Ga0207707_10016144 | 3300025912 | Bacteria | 6513 |
| 67 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 68 | Ga0207695_10022806 | 3300025913 | Bacteria | 7092 |
| 69 | Ga0207695_10124247 | 3300025913 | Bacteria | 2545 |
| 70 | Ga0207671_10000025 | 3300025914 | Bacteria | 271617 |
| 71 | Ga0207693_10000672 | 3300025915 | Bacteria | 30694 |
| 72 | Ga0207663_10054139 | 3300025916 | Unclassified | 2511 |
| 73 | Ga0207649_10117968 | 3300025920 | Unclassified | 1785 |
| 74 | Ga0207650_10022870 | 3300025925 | Bacteria | 4429 |
| 75 | Ga0207700_10002088 | 3300025928 | Bacteria | 11395 |
| 76 | Ga0207700_10003723 | 3300025928 | Bacteria | 8896 |
| 77 | Ga0207664_10000029 | 3300025929 | Bacteria | 183815 |
| 78 | Ga0207664_10648941 | 3300025929 | Bacteria | 949 |
| 79 | Ga0207644_10050883 | 3300025931 | Unclassified | 2971 |
| 80 | Ga0207686_10191390 | 3300025934 | Bacteria | 1459 |
| 81 | Ga0207670_10184694 | 3300025936 | Bacteria | 1573 |
| 82 | Ga0207665_10026761 | 3300025939 | Bacteria | 3809 |
| 83 | Ga0207665_10074854 | 3300025939 | Bacteria | 2318 |
| 84 | Ga0207691_10110974 | 3300025940 | Archaea | 2439 |
| 85 | Ga0207711_10007210 | 3300025941 | Bacteria | 9317 |
| 86 | Ga0207711_10417517 | 3300025941 | Bacteria | 1248 |
| 87 | Ga0207679_10017573 | 3300025945 | Bacteria | 4774 |
| 88 | Ga0207667_10485642 | 3300025949 | Bacteria | 1254 |
| 89 | Ga0207651_10023637 | 3300025960 | Unclassified | 3786 |
| 90 | Ga0207677_10236807 | 3300026023 | Unclassified | 1474 |
| 91 | Ga0207703_10142482 | 3300026035 | Unclassified | 2081 |
| 92 | Ga0207639_10257869 | 3300026041 | Bacteria | 1524 |
| 93 | Ga0207641_10079572 | 3300026088 | Bacteria | 2841 |
| 94 | Ga0207641_10209455 | 3300026088 | Unclassified | 1802 |
| 95 | Ga0207641_10581411 | 3300026088 | Unclassified | 1095 |
| 96 | Ga0207676_10004508 | 3300026095 | Bacteria | 9848 |
| 97 | Ga0207683_10041811 | 3300026121 | Bacteria | 4003 |
| 98 | Ga0265338_10005487 | 3300028800 | Bacteria | 16534 |
| 99 | Ga0265338_10081183 | 3300028800 | Unclassified | 2720 |
| 100 | Ga0265338_10081730 | 3300028800 | Bacteria | 2707 |
| 101 | Ga0265324_10011550 | 3300029957 | Bacteria | 3363 |
| 102 | Ga0265325_10006653 | 3300031241 | Bacteria | 6992 |
| 103 | Ga0265340_10056788 | 3300031247 | Bacteria | 1883 |
| 104 | Ga0265339_10096936 | 3300031249 | Bacteria | 1539 |
| 105 | Ga0265327_10008787 | 3300031251 | Bacteria | 7452 |
| 106 | Ga0265316_10045138 | 3300031344 | Bacteria | 3501 |
| 107 | Ga0265316_10102422 | 3300031344 | Bacteria | 2175 |
| 108 | Ga0265314_10034258 | 3300031711 | Bacteria | 3714 |
| 109 | Ga0265314_10215808 | 3300031711 | Bacteria | 1123 |
| 110 | Ga0265342_10127294 | 3300031712 | Bacteria | 1429 |
| 111 | Ga0316576_10213935 | 3300031727 | Bacteria | 1450 |
| 112 | Ga0373926_0038306 | 3300035083 | Unclassified | 1707 |
| 113 | Ga0373944_0014455 | 3300035089 | Unclassified | 2203 |
| 114 | Ga0373923_0076481 | 3300035111 | Unclassified | 1446 |
| 115 | Ga0373945_0000644 | 3300035116 | Bacteria | 10060 |
| 116 | Ga0373945_0054742 | 3300035116 | Bacteria | 1475 |
| 117 | Ga0373954_0078796 | 3300035118 | Bacteria | 1572 |
| 118 | Ga0373943_0000107 | 3300035170 | Bacteria | 30563 |
| 119 | Ga0373943_0079656 | 3300035170 | Bacteria | 1677 |
| 120 | Ga0373943_0091262 | 3300035170 | Bacteria | 1578 |
| 121 | Ga0373946_0003824 | 3300035171 | Bacteria | 5345 |
| 122 | Ga0373935_0000588 | 3300035692 | Bacteria | 18933 |
| 123 | Ga0373935_0002420 | 3300035692 | Bacteria | 10685 |
| 124 | Ga0373927_0000070 | 3300035695 | Bacteria | 73849 |
| 125 | Ga0373933_0003755 | 3300035724 | Bacteria | 8394 |
| 126 | Ga0373933_0065072 | 3300035724 | Bacteria | 2207 |
| 127 | Ga0373947_0000202 | 3300035725 | Bacteria | 33146 |
| 128 | Ga0373937_0012599 | 3300036401 | Bacteria | 7442 |
| 129 | Ga0373937_0012976 | 3300036401 | Bacteria | 7338 |
| 130 | Ga0373937_0067963 | 3300036401 | Bacteria | 3285 |
| 131 | Ga0373925_0001143 | 3300037068 | Bacteria | 23596 |
| 132 | Ga0373925_0053865 | 3300037068 | Unclassified | 3008 |
| 133 | Ga0395905_0009658 | 3300037471 | Bacteria | 9416 |
| 134 | Ga0395905_0388183 | 3300037471 | Bacteria | 1291 |
| 135 | Ga0451791_1444116 | 3300041451 | Bacteria | 900 |
| 136 | Ga0451837_1615792 | 3300041494 | Bacteria | 2004 |
| 137 | Ga0451577_0000557 | 3300042876 | Bacteria | 60863 |
| 138 | Ga0451577_0014834 | 3300042876 | Bacteria | 7259 |
| 139 | Ga0451577_0061197 | 3300042876 | Bacteria | 3357 |
| 140 | Ga0451577_0198480 | 3300042876 | Bacteria | 1811 |
| 141 | Ga0453683_0062173 | 3300044673 | Bacteria | 2335 |
| 142 | Ga0466964_0019084 | 3300044706 | Bacteria | 2634 |
| 143 | Ga0453684_0000024 | 3300044712 | Bacteria | 819351 |
| 144 | Ga0453684_0001008 | 3300044712 | Bacteria | 91215 |
| 145 | Ga0453684_0001841 | 3300044712 | Bacteria | 55419 |
| 146 | Ga0453684_0006219 | 3300044712 | Bacteria | 22887 |
| 147 | Ga0453684_0195430 | 3300044712 | Bacteria | 2363 |
| 148 | Ga0451576_0000043 | 3300045051 | Bacteria | 335666 |
| 149 | Ga0451576_0018690 | 3300045051 | Bacteria | 7583 |
| 150 | Ga0451576_0049935 | 3300045051 | Bacteria | 4390 |
| 151 | Ga0451576_0211855 | 3300045051 | Bacteria | 2023 |
| 152 | Ga0466967_0209278 | 3300045976 | Bacteria | 1849 |
| 153 | Ga0495592_0069051 | 3300046454 | Unclassified | 2577 |
| 154 | Ga0495592_0259993 | 3300046454 | Bacteria | 1144 |
| 155 | Ga0495651_0434698 | 3300046462 | Bacteria | 851 |
| 156 | Ga0495653_0128857 | 3300046463 | Unclassified | 1794 |
| 157 | Ga0495662_0022506 | 3300046476 | Bacteria | 3043 |
| 158 | Ga0495664_0059571 | 3300046477 | Unclassified | 2273 |
| 159 | Ga0495664_0087600 | 3300046477 | Bacteria | 1871 |
| 160 | Ga0495594_0173410 | 3300046499 | Unclassified | 1227 |
| 161 | Ga0495618_0012004 | 3300046514 | Bacteria | 5256 |
| 162 | Ga0495630_0022459 | 3300046517 | Bacteria | 4660 |
| 163 | Ga0495630_0030977 | 3300046517 | Bacteria | 3982 |
| 164 | Ga0495586_0207150 | 3300046535 | Unclassified | 1112 |
| 165 | Ga0495667_0001136 | 3300046559 | Bacteria | 17338 |
| 166 | Ga0495657_0004041 | 3300046675 | Bacteria | 11765 |
| 167 | Ga0495599_0061186 | 3300046678 | Unclassified | 2353 |
| 168 | Ga0495599_0095646 | 3300046678 | Bacteria | 1853 |
| 169 | Ga0495613_0039675 | 3300046689 | Bacteria | 3490 |
| 170 | Ga0495613_0056494 | 3300046689 | Bacteria | 2882 |
| 171 | Ga0495624_0109469 | 3300046690 | Bacteria | 1699 |
| 172 | Ga0495674_0008611 | 3300047319 | Bacteria | 9706 |
| 173 | Ga0495674_0033564 | 3300047319 | Bacteria | 4647 |
| 174 | Ga0495674_0058772 | 3300047319 | Bacteria | 3360 |
| 175 | Ga0495675_0091377 | 3300047444 | Bacteria | 1911 |
| 176 | Ga0495684_0076222 | 3300047471 | Bacteria | 2547 |
| 177 | Ga0495684_0162718 | 3300047471 | Bacteria | 1664 |
| 178 | Ga0495684_0307932 | 3300047471 | Unclassified | 1136 |
| 179 | Ga0495602_0276243 | 3300048088 | Bacteria | 1240 |
| 180 | Ga0496104_0556817 | 3300048907 | Bacteria | 1057 |
| 181 | Ga0496117_0002159 | 3300048920 | Bacteria | 25663 |
| 182 | Ga0496123_0032007 | 3300048926 | Bacteria | 3817 |
| 183 | Ga0501033_0130272 | 3300049570 | Bacteria | 1823 |
| 184 | Ga0501067_0370845 | 3300049583 | Bacteria | 798 |
| 185 | Ga0501068_0455322 | 3300049584 | Bacteria | 828 |
| 186 | Ga0501071_0170260 | 3300049587 | Bacteria | 1630 |
| 187 | Ga0501079_0048129 | 3300049741 | Bacteria | 3290 |
| 188 | nmdc:mga00v17_1044_c1 | 3300050491 | Bacteria | 14681 |
| 189 | nmdc:mga07m45_6521_c1 | 3300050496 | Bacteria | 5905 |
| 190 | Ga0495601_0139289 | 3300053077 | Bacteria | 1582 |
| 191 | Ga0495619_0033026 | 3300053085 | Bacteria | 3360 |
| 192 | Ga0500577_0004561 | 3300053142 | Bacteria | 3673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100000876 | Ga0070713_1000008762 | 239 |
| 2 | 3300006028 | Ga0070717_10031327 | Ga0070717_100313275 | 239 |
| 3 | 3300006173 | Ga0070716_100078723 | Ga0070716_1000787232 | 239 |
| 4 | 3300025928 | Ga0207700_10002088 | Ga0207700_100020889 | 239 |
| 5 | 3300025939 | Ga0207665_10074854 | Ga0207665_100748542 | 239 |
| 6 | 3300028800 | Ga0265338_10005487 | Ga0265338_100054876 | 239 |
| 7 | 3300031344 | Ga0265316_10102422 | Ga0265316_101024222 | 239 |
| 8 | 3300044706 | Ga0466964_0019084 | Ga0466964_0019084_1828_2571 | 239 |
| 9 | 3300045976 | Ga0466967_0209278 | Ga0466967_0209278_979_1722 | 239 |
| 10 | 3300049583 | Ga0501067_0370845 | Ga0501067_0370845_11_739 | 242 |
| 11 | 3300009176 | Ga0105242_10925130 | Ga0105242_109251301 | 244 |
| 12 | 3300025934 | Ga0207686_10191390 | Ga0207686_101913901 | 244 |
| 13 | 3300005614 | Ga0068856_100020090 | Ga0068856_1000200902 | 248 |
| 14 | 3300026088 | Ga0207641_10581411 | Ga0207641_105814111 | 249 |
| 15 | 3300005434 | Ga0070709_10175313 | Ga0070709_101753132 | 250 |
| 16 | 3300005436 | Ga0070713_100656029 | Ga0070713_1006560291 | 250 |
| 17 | 3300005436 | Ga0070713_100756953 | Ga0070713_1007569532 | 250 |
| 18 | 3300006028 | Ga0070717_10005386 | Ga0070717_100053863 | 250 |
| 19 | 3300006028 | Ga0070717_10121429 | Ga0070717_101214292 | 250 |
| 20 | 3300006028 | Ga0070717_10295037 | Ga0070717_102950372 | 250 |
| 21 | 3300006175 | Ga0070712_100001429 | Ga0070712_1000014298 | 250 |
| 22 | 3300009093 | Ga0105240_10037636 | Ga0105240_100376362 | 250 |
| 23 | 3300013105 | Ga0157369_10576148 | Ga0157369_105761481 | 250 |
| 24 | 3300025906 | Ga0207699_10005397 | Ga0207699_100053974 | 250 |
| 25 | 3300025912 | Ga0207707_10016144 | Ga0207707_100161448 | 250 |
| 26 | 3300025913 | Ga0207695_10124247 | Ga0207695_101242473 | 250 |
| 27 | 3300025915 | Ga0207693_10000672 | Ga0207693_1000067219 | 250 |
| 28 | 3300025928 | Ga0207700_10003723 | Ga0207700_100037232 | 250 |
| 29 | 3300025929 | Ga0207664_10648941 | Ga0207664_106489411 | 250 |
| 30 | 3300025939 | Ga0207665_10026761 | Ga0207665_100267612 | 250 |
| 31 | 3300025949 | Ga0207667_10485642 | Ga0207667_104856422 | 250 |
| 32 | 3300031712 | Ga0265342_10127294 | Ga0265342_101272942 | 250 |
| 33 | 3300035083 | Ga0373926_0038306 | Ga0373926_0038306_651_1430 | 250 |
| 34 | 3300035089 | Ga0373944_0014455 | Ga0373944_0014455_1341_2120 | 250 |
| 35 | 3300035111 | Ga0373923_0076481 | Ga0373923_0076481_455_1234 | 250 |
| 36 | 3300035116 | Ga0373945_0000644 | Ga0373945_0000644_4571_5350 | 250 |
| 37 | 3300035116 | Ga0373945_0054742 | Ga0373945_0054742_73_846 | 250 |
| 38 | 3300035118 | Ga0373954_0078796 | Ga0373954_0078796_149_928 | 250 |
| 39 | 3300035170 | Ga0373943_0000107 | Ga0373943_0000107_14079_14858 | 250 |
| 40 | 3300035170 | Ga0373943_0079656 | Ga0373943_0079656_486_1259 | 250 |
| 41 | 3300035170 | Ga0373943_0091262 | Ga0373943_0091262_740_1519 | 250 |
| 42 | 3300035171 | Ga0373946_0003824 | Ga0373946_0003824_1606_2385 | 250 |
| 43 | 3300035692 | Ga0373935_0000588 | Ga0373935_0000588_11409_12188 | 250 |
| 44 | 3300035692 | Ga0373935_0002420 | Ga0373935_0002420_4865_5638 | 250 |
| 45 | 3300035695 | Ga0373927_0000070 | Ga0373927_0000070_37468_38247 | 250 |
| 46 | 3300035725 | Ga0373947_0000202 | Ga0373947_0000202_22225_23004 | 250 |
| 47 | 3300037068 | Ga0373925_0001143 | Ga0373925_0001143_5346_6125 | 250 |
| 48 | 3300037068 | Ga0373925_0053865 | Ga0373925_0053865_263_1036 | 250 |
| 49 | 3300046454 | Ga0495592_0259993 | Ga0495592_0259993_104_877 | 250 |
| 50 | 3300046463 | Ga0495653_0128857 | Ga0495653_0128857_982_1761 | 250 |
| 51 | 3300046477 | Ga0495664_0059571 | Ga0495664_0059571_1323_2096 | 250 |
| 52 | 3300046517 | Ga0495630_0022459 | Ga0495630_0022459_3062_3835 | 250 |
| 53 | 3300046517 | Ga0495630_0030977 | Ga0495630_0030977_1603_2382 | 250 |
| 54 | 3300046535 | Ga0495586_0207150 | Ga0495586_0207150_241_1014 | 250 |
| 55 | 3300046678 | Ga0495599_0095646 | Ga0495599_0095646_324_1097 | 250 |
| 56 | 3300046690 | Ga0495624_0109469 | Ga0495624_0109469_685_1464 | 250 |
| 57 | 3300047319 | Ga0495674_0008611 | Ga0495674_0008611_7452_8225 | 250 |
| 58 | 3300047319 | Ga0495674_0058772 | Ga0495674_0058772_445_1224 | 250 |
| 59 | 3300047444 | Ga0495675_0091377 | Ga0495675_0091377_657_1436 | 250 |
| 60 | 3300047471 | Ga0495684_0307932 | Ga0495684_0307932_238_1011 | 250 |
| 61 | 3300048088 | Ga0495602_0276243 | Ga0495602_0276243_198_977 | 250 |
| 62 | 3300048907 | Ga0496104_0556817 | Ga0496104_0556817_11_796 | 250 |
| 63 | 3300053077 | Ga0495601_0139289 | Ga0495601_0139289_539_1312 | 250 |
| 64 | 3300026121 | Ga0207683_10041811 | Ga0207683_100418112 | 251 |
| 65 | 3300005458 | Ga0070681_10000202 | Ga0070681_1000020212 | 252 |
| 66 | 3300005530 | Ga0070679_100452653 | Ga0070679_1004526531 | 252 |
| 67 | 3300025912 | Ga0207707_10000177 | Ga0207707_1000017762 | 252 |
| 68 | 3300031727 | Ga0316576_10213935 | Ga0316576_102139352 | 252 |
| 69 | 3300041451 | Ga0451791_1444116 | Ga0451791_1444116_103_867 | 252 |
| 70 | 3300049584 | Ga0501068_0455322 | Ga0501068_0455322_12_776 | 252 |
| 71 | 3300005434 | Ga0070709_10009730 | Ga0070709_100097303 | 253 |
| 72 | 3300005436 | Ga0070713_100002684 | Ga0070713_1000026841 | 253 |
| 73 | 3300005437 | Ga0070710_10043709 | Ga0070710_100437093 | 253 |
| 74 | 3300005530 | Ga0070679_100415927 | Ga0070679_1004159271 | 253 |
| 75 | 3300006175 | Ga0070712_100018149 | Ga0070712_1000181492 | 253 |
| 76 | 3300025898 | Ga0207692_10156430 | Ga0207692_101564302 | 253 |
| 77 | 3300028800 | Ga0265338_10081730 | Ga0265338_100817302 | 253 |
| 78 | 3300031247 | Ga0265340_10056788 | Ga0265340_100567883 | 253 |
| 79 | 3300031249 | Ga0265339_10096936 | Ga0265339_100969362 | 253 |
| 80 | 3300031344 | Ga0265316_10045138 | Ga0265316_100451383 | 253 |
| 81 | 3300031711 | Ga0265314_10215808 | Ga0265314_102158081 | 253 |
| 82 | 3300035724 | Ga0373933_0003755 | Ga0373933_0003755_2510_3295 | 253 |
| 83 | 3300036401 | Ga0373937_0012976 | Ga0373937_0012976_6257_7042 | 253 |
| 84 | 3300045051 | Ga0451576_0211855 | Ga0451576_0211855_335_1099 | 253 |
| 85 | 3300046462 | Ga0495651_0434698 | Ga0495651_0434698_35_820 | 253 |
| 86 | 3300045051 | Ga0451576_0049935 | Ga0451576_0049935_2411_3181 | 255 |
| 87 | 3300005435 | Ga0070714_100000051 | Ga0070714_10000005192 | 256 |
| 88 | 3300025916 | Ga0207663_10054139 | Ga0207663_100541392 | 256 |
| 89 | 3300025929 | Ga0207664_10000029 | Ga0207664_1000002962 | 256 |
| 90 | 3300028800 | Ga0265338_10081183 | Ga0265338_100811832 | 256 |
| 91 | 3300031241 | Ga0265325_10006653 | Ga0265325_100066533 | 256 |
| 92 | 3300037471 | Ga0395905_0009658 | Ga0395905_0009658_1727_2518 | 256 |
| 93 | 3300053142 | Ga0500577_0004561 | Ga0500577_0004561_379_1185 | 256 |
| 94 | 3300044712 | Ga0453684_0001008 | Ga0453684_0001008_18257_19030 | 257 |
| 95 | 3300014325 | Ga0163163_10125539 | Ga0163163_101255392 | 258 |
| 96 | 3300041494 | Ga0451837_1615792 | Ga0451837_1615792_800_1618 | 258 |
| 97 | 3300048926 | Ga0496123_0032007 | Ga0496123_0032007_1900_2718 | 258 |
| 98 | 3300049587 | Ga0501071_0170260 | Ga0501071_0170260_464_1282 | 258 |
| 99 | 3300049741 | Ga0501079_0048129 | Ga0501079_0048129_521_1339 | 258 |
| 100 | iso_pu_bacteria | 2643221681 | 2644456801 | 258 |
| 101 | iso_pu_bacteria | 2643221961 | 2645719973 | 258 |
| 102 | iso_pu_bacteria | 2643221962 | 2645726845 | 258 |
| 103 | 3300005544 | Ga0070686_100288796 | Ga0070686_1002887961 | 259 |
| 104 | 3300005548 | Ga0070665_100261024 | Ga0070665_1002610243 | 259 |
| 105 | 3300006051 | Ga0075364_10012796 | Ga0075364_100127966 | 259 |
| 106 | 3300006353 | Ga0075370_10003196 | Ga0075370_100031964 | 259 |
| 107 | 3300009093 | Ga0105240_10000390 | Ga0105240_1000039036 | 259 |
| 108 | 3300009093 | Ga0105240_10085589 | Ga0105240_100855894 | 259 |
| 109 | 3300009545 | Ga0105237_10003688 | Ga0105237_1000368811 | 259 |
| 110 | 3300009545 | Ga0105237_10118721 | Ga0105237_101187213 | 259 |
| 111 | 3300010375 | Ga0105239_10000184 | Ga0105239_1000018432 | 259 |
| 112 | 3300010375 | Ga0105239_10033818 | Ga0105239_100338185 | 259 |
| 113 | 3300013297 | Ga0157378_10037390 | Ga0157378_100373903 | 259 |
| 114 | 3300014326 | Ga0157380_10002640 | Ga0157380_100026403 | 259 |
| 115 | 3300025904 | Ga0207647_10017536 | Ga0207647_100175365 | 259 |
| 116 | 3300025913 | Ga0207695_10000020 | Ga0207695_1000002097 | 259 |
| 117 | 3300025913 | Ga0207695_10022806 | Ga0207695_100228066 | 259 |
| 118 | 3300025914 | Ga0207671_10000025 | Ga0207671_1000002538 | 259 |
| 119 | 3300026041 | Ga0207639_10257869 | Ga0207639_102578691 | 259 |
| 120 | 3300029957 | Ga0265324_10011550 | Ga0265324_100115504 | 259 |
| 121 | 3300031251 | Ga0265327_10008787 | Ga0265327_100087877 | 259 |
| 122 | 3300031711 | Ga0265314_10034258 | Ga0265314_100342586 | 259 |
| 123 | 3300037471 | Ga0395905_0388183 | Ga0395905_0388183_279_1163 | 259 |
| 124 | 3300042876 | Ga0451577_0000557 | Ga0451577_0000557_25484_26362 | 259 |
| 125 | 3300042876 | Ga0451577_0061197 | Ga0451577_0061197_2443_3222 | 259 |
| 126 | 3300042876 | Ga0451577_0198480 | Ga0451577_0198480_504_1322 | 259 |
| 127 | 3300044673 | Ga0453683_0062173 | Ga0453683_0062173_295_1083 | 259 |
| 128 | 3300044712 | Ga0453684_0000024 | Ga0453684_0000024_245438_246316 | 259 |
| 129 | 3300044712 | Ga0453684_0001841 | Ga0453684_0001841_18391_19170 | 259 |
| 130 | 3300044712 | Ga0453684_0006219 | Ga0453684_0006219_15756_16583 | 259 |
| 131 | 3300044712 | Ga0453684_0195430 | Ga0453684_0195430_360_1178 | 259 |
| 132 | 3300045051 | Ga0451576_0000043 | Ga0451576_0000043_55241_56029 | 259 |
| 133 | 3300045051 | Ga0451576_0018690 | Ga0451576_0018690_3148_3927 | 259 |
| 134 | 3300048920 | Ga0496117_0002159 | Ga0496117_0002159_11437_12243 | 259 |
| 135 | 3300049570 | Ga0501033_0130272 | Ga0501033_0130272_487_1371 | 259 |
| 136 | 3300050491 | nmdc:mga00v17_1044_c1 | nmdc:mga00v17_1044_c1_10807_11628 | 259 |
| 137 | 3300050496 | nmdc:mga07m45_6521_c1 | nmdc:mga07m45_6521_c1_4653_5558 | 259 |
| 138 | iso_pu_bacteria | 2643221697 | 2644538789 | 259 |
| 139 | iso_pu_bacteria | 2984592036 | 2984592225 | 259 |
| 140 | 3300042876 | Ga0451577_0014834 | Ga0451577_0014834_644_1468 | 260 |
| 141 | 3300005840 | Ga0068870_10127885 | Ga0068870_101278852 | 261 |
| 142 | 3300005841 | Ga0068863_100198611 | Ga0068863_1001986111 | 261 |
| 143 | 3300006237 | Ga0097621_100062808 | Ga0097621_1000628083 | 261 |
| 144 | 3300006237 | Ga0097621_100121156 | Ga0097621_1001211563 | 261 |
| 145 | 3300006358 | Ga0068871_100015550 | Ga0068871_1000155503 | 261 |
| 146 | 3300006844 | Ga0075428_100907635 | Ga0075428_1009076351 | 261 |
| 147 | 3300013308 | Ga0157375_10680766 | Ga0157375_106807661 | 261 |
| 148 | 3300014325 | Ga0163163_10027228 | Ga0163163_100272283 | 261 |
| 149 | 3300014325 | Ga0163163_10033698 | Ga0163163_100336983 | 261 |
| 150 | 3300014969 | Ga0157376_10116463 | Ga0157376_101164632 | 261 |
| 151 | 3300025936 | Ga0207670_10184694 | Ga0207670_101846941 | 261 |
| 152 | 3300025941 | Ga0207711_10417517 | Ga0207711_104175172 | 261 |
| 153 | 3300026088 | Ga0207641_10209455 | Ga0207641_102094552 | 261 |
| 154 | 3300035724 | Ga0373933_0065072 | Ga0373933_0065072_602_1387 | 261 |
| 155 | 3300036401 | Ga0373937_0012599 | Ga0373937_0012599_4162_4947 | 261 |
| 156 | 3300036401 | Ga0373937_0067963 | Ga0373937_0067963_2331_3239 | 261 |
| 157 | 3300046454 | Ga0495592_0069051 | Ga0495592_0069051_113_898 | 261 |
| 158 | 3300046476 | Ga0495662_0022506 | Ga0495662_0022506_202_1110 | 261 |
| 159 | 3300046477 | Ga0495664_0087600 | Ga0495664_0087600_284_1192 | 261 |
| 160 | 3300046499 | Ga0495594_0173410 | Ga0495594_0173410_85_993 | 261 |
| 161 | 3300046514 | Ga0495618_0012004 | Ga0495618_0012004_1306_2214 | 261 |
| 162 | 3300046559 | Ga0495667_0001136 | Ga0495667_0001136_7391_8176 | 261 |
| 163 | 3300046675 | Ga0495657_0004041 | Ga0495657_0004041_6923_7708 | 261 |
| 164 | 3300046678 | Ga0495599_0061186 | Ga0495599_0061186_68_853 | 261 |
| 165 | 3300046689 | Ga0495613_0039675 | Ga0495613_0039675_476_1384 | 261 |
| 166 | 3300046689 | Ga0495613_0056494 | Ga0495613_0056494_1037_1945 | 261 |
| 167 | 3300047319 | Ga0495674_0033564 | Ga0495674_0033564_3367_4275 | 261 |
| 168 | 3300047471 | Ga0495684_0076222 | Ga0495684_0076222_935_1843 | 261 |
| 169 | 3300047471 | Ga0495684_0162718 | Ga0495684_0162718_588_1418 | 261 |
| 170 | 3300053085 | Ga0495619_0033026 | Ga0495619_0033026_2331_3116 | 261 |
| 171 | 3300005330 | Ga0070690_100003201 | Ga0070690_1000032015 | 262 |
| 172 | 3300005331 | Ga0070670_100007834 | Ga0070670_1000078345 | 262 |
| 173 | 3300005335 | Ga0070666_10001137 | Ga0070666_100011375 | 262 |
| 174 | 3300005338 | Ga0068868_100005508 | Ga0068868_1000055085 | 262 |
| 175 | 3300005355 | Ga0070671_100016426 | Ga0070671_1000164265 | 262 |
| 176 | 3300005367 | Ga0070667_100071661 | Ga0070667_1000716612 | 262 |
| 177 | 3300005543 | Ga0070672_100001694 | Ga0070672_1000016945 | 262 |
| 178 | 3300005564 | Ga0070664_100007205 | Ga0070664_10000720510 | 262 |
| 179 | 3300005618 | Ga0068864_100003613 | Ga0068864_1000036137 | 262 |
| 180 | 3300005841 | Ga0068863_100053375 | Ga0068863_1000533753 | 262 |
| 181 | 3300005842 | Ga0068858_100023284 | Ga0068858_1000232845 | 262 |
| 182 | 3300009177 | Ga0105248_10001841 | Ga0105248_1000184116 | 262 |
| 183 | 3300013296 | Ga0157374_10505053 | Ga0157374_105050532 | 262 |
| 184 | 3300013308 | Ga0157375_10005323 | Ga0157375_100053234 | 262 |
| 185 | 3300014745 | Ga0157377_10146140 | Ga0157377_101461402 | 262 |
| 186 | 3300025903 | Ga0207680_10034916 | Ga0207680_100349163 | 262 |
| 187 | 3300025920 | Ga0207649_10117968 | Ga0207649_101179682 | 262 |
| 188 | 3300025925 | Ga0207650_10022870 | Ga0207650_100228705 | 262 |
| 189 | 3300025931 | Ga0207644_10050883 | Ga0207644_100508833 | 262 |
| 190 | 3300025940 | Ga0207691_10110974 | Ga0207691_101109742 | 262 |
| 191 | 3300025941 | Ga0207711_10007210 | Ga0207711_100072107 | 262 |
| 192 | 3300025945 | Ga0207679_10017573 | Ga0207679_100175732 | 262 |
| 193 | 3300025960 | Ga0207651_10023637 | Ga0207651_100236375 | 262 |
| 194 | 3300026023 | Ga0207677_10236807 | Ga0207677_102368072 | 262 |
| 195 | 3300026035 | Ga0207703_10142482 | Ga0207703_101424821 | 262 |
| 196 | 3300026088 | Ga0207641_10079572 | Ga0207641_100795723 | 262 |
| 197 | 3300026095 | Ga0207676_10004508 | Ga0207676_100045085 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pw6-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein jw3007 from escherichia coli k12 | 0.9203 | 7 | 262 |
| 2pw6-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein jw3007 from escherichia coli k12 | 0.9167 | 7 | 262 |
| 7txy-assembly2.cif.gz_F | crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria | 0.7925 | 8 | 259 |
| 8iq8-assembly1.cif.gz_D | crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii | 0.7769 | 5 | 260 |
| 7txy-assembly2.cif.gz_E | crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria | 0.7706 | 6 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MQB9_2_262_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9561 | 9 | 262 | 3.40.830.10 |
| af_P24197_1_271_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9499 | 1 | 262 | 3.40.830.10 |
| af_P24197_1_271_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9463 | 1 | 262 | 3.40.830.10 |
| af_I1MQB9_2_262_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9276 | 9 | 262 | 3.40.830.10 |
| af_Q54W77_1_267_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9133 | 5 | 262 | 3.40.830.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2FYV3-F1-model_v4 | LigB family dioxygenase | 0.988 | 6 | 164 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A841R859-F1-model_v4 | 4,5-DOPA dioxygenase extradiol (EC 1.13.11.-) | 0.9864 | 7 | 262 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A2A3UIR6-F1-model_v4 | deleted | 0.9854 | 6 | 262 |
|
| AF-A0A4V1VG44-F1-model_v4 | Dioxygenase | 0.9853 | 5 | 137 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A0T2YJ31-F1-model_v4 | Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein | 0.9851 | 162 | 262 |
GO:0008198
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar