F302731

General Info

Members Datasets Scaffolds Average Seq Length
197 138 192 270

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100288796|Ga0070686_1002887961
Length 317
Sequence LNVYTRNFVNEDRPLSDNFESAMQRRTLIKAGGILAVAQISGMSTLSALAALGKELSPSERMPIMFVGHGNPMNAIEDNVYHKSWQALGKTLPRPQAILSVSAHWITKGTKVASMSHPKTIHDFGGFPKKLFDQEYPAPGSPEFAKLTKELVTYSHIQTDESWGLDHGTWSVLLPMYPAADIPVYQLSLDYDQPPTYHYEIGKQLSKLRDKGVLIIGSGNLVHNLREVDWAGGKQVYDWAREFDAKFTEWMDKGDHASILNYQKILGNTATMAHPTYDHLLPLFYILGLQQKKEKITYFNDQFDMASVSMRSMLIHA

Samples

Sample ID Description Type Environment
1 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
2 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
3 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
4 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
5 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 1.02
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100003201 3300005330 Bacteria 8928
2 Ga0070670_100007834 3300005331 Bacteria 9089
3 Ga0070666_10001137 3300005335 Bacteria 16197
4 Ga0068868_100005508 3300005338 Bacteria 8903
5 Ga0070671_100016426 3300005355 Bacteria 5985
6 Ga0070667_100071661 3300005367 Unclassified 2951
7 Ga0070709_10009730 3300005434 Bacteria 5309
8 Ga0070709_10175313 3300005434 Bacteria 1501
9 Ga0070714_100000051 3300005435 Bacteria 110289
10 Ga0070713_100000876 3300005436 Bacteria 19291
11 Ga0070713_100002684 3300005436 Bacteria 11605
12 Ga0070713_100656029 3300005436 Bacteria 999
13 Ga0070713_100756953 3300005436 Bacteria 929
14 Ga0070710_10043709 3300005437 Bacteria 2483
15 Ga0070681_10000202 3300005458 Bacteria 46492
16 Ga0070679_100415927 3300005530 Bacteria 1290
17 Ga0070679_100452653 3300005530 Bacteria 1228
18 Ga0070672_100001694 3300005543 Bacteria 13762
19 Ga0070686_100288796 3300005544 Unclassified 1212
20 Ga0070665_100261024 3300005548 Bacteria 1733
21 Ga0070664_100007205 3300005564 Bacteria 8971
22 Ga0068856_100020090 3300005614 Bacteria 6486
23 Ga0068864_100003613 3300005618 Bacteria 12788
24 Ga0068870_10127885 3300005840 Bacteria 1472
25 Ga0068863_100053375 3300005841 Archaea 3831
26 Ga0068863_100198611 3300005841 Bacteria 1928
27 Ga0068858_100023284 3300005842 Bacteria 5771
28 Ga0070717_10005386 3300006028 Bacteria 9339
29 Ga0070717_10031327 3300006028 Bacteria 4277
30 Ga0070717_10121429 3300006028 Bacteria 2238
31 Ga0070717_10295037 3300006028 Bacteria 1440
32 Ga0075364_10012796 3300006051 Bacteria 5146
33 Ga0070716_100078723 3300006173 Bacteria 1960
34 Ga0070712_100001429 3300006175 Bacteria 14560
35 Ga0070712_100018149 3300006175 Bacteria 4565
36 Ga0097621_100062808 3300006237 Bacteria 3050
37 Ga0097621_100121156 3300006237 Bacteria 2219
38 Ga0075370_10003196 3300006353 Bacteria 7756
39 Ga0068871_100015550 3300006358 Bacteria 5700
40 Ga0075428_100907635 3300006844 Bacteria 934
41 Ga0105240_10000390 3300009093 Bacteria 82256
42 Ga0105240_10037636 3300009093 Bacteria 6216
43 Ga0105240_10085589 3300009093 Unclassified 3862
44 Ga0105242_10925130 3300009176 Unclassified 874
45 Ga0105248_10001841 3300009177 Bacteria 23501
46 Ga0105237_10003688 3300009545 Bacteria 18053
47 Ga0105237_10118721 3300009545 Unclassified 2639
48 Ga0105239_10000184 3300010375 Bacteria 91348
49 Ga0105239_10033818 3300010375 Bacteria 5612
50 Ga0157369_10576148 3300013105 Bacteria 1163
51 Ga0157374_10505053 3300013296 Unclassified 1214
52 Ga0157378_10037390 3300013297 Bacteria 4299
53 Ga0157375_10005323 3300013308 Bacteria 11181
54 Ga0157375_10680766 3300013308 Bacteria 1183
55 Ga0163163_10027228 3300014325 Bacteria 5474
56 Ga0163163_10033698 3300014325 Bacteria 4957
57 Ga0163163_10125539 3300014325 Bacteria 2604
58 Ga0157380_10002640 3300014326 Bacteria 12145
59 Ga0157377_10146140 3300014745 Unclassified 1458
60 Ga0157376_10116463 3300014969 Bacteria 2361
61 Ga0207692_10156430 3300025898 Bacteria 1310
62 Ga0207680_10034916 3300025903 Unclassified 2881
63 Ga0207647_10017536 3300025904 Bacteria 4865
64 Ga0207699_10005397 3300025906 Bacteria 6127
65 Ga0207707_10000177 3300025912 Bacteria 66169
66 Ga0207707_10016144 3300025912 Bacteria 6513
67 Ga0207695_10000020 3300025913 Bacteria 723025
68 Ga0207695_10022806 3300025913 Bacteria 7092
69 Ga0207695_10124247 3300025913 Bacteria 2545
70 Ga0207671_10000025 3300025914 Bacteria 271617
71 Ga0207693_10000672 3300025915 Bacteria 30694
72 Ga0207663_10054139 3300025916 Unclassified 2511
73 Ga0207649_10117968 3300025920 Unclassified 1785
74 Ga0207650_10022870 3300025925 Bacteria 4429
75 Ga0207700_10002088 3300025928 Bacteria 11395
76 Ga0207700_10003723 3300025928 Bacteria 8896
77 Ga0207664_10000029 3300025929 Bacteria 183815
78 Ga0207664_10648941 3300025929 Bacteria 949
79 Ga0207644_10050883 3300025931 Unclassified 2971
80 Ga0207686_10191390 3300025934 Bacteria 1459
81 Ga0207670_10184694 3300025936 Bacteria 1573
82 Ga0207665_10026761 3300025939 Bacteria 3809
83 Ga0207665_10074854 3300025939 Bacteria 2318
84 Ga0207691_10110974 3300025940 Archaea 2439
85 Ga0207711_10007210 3300025941 Bacteria 9317
86 Ga0207711_10417517 3300025941 Bacteria 1248
87 Ga0207679_10017573 3300025945 Bacteria 4774
88 Ga0207667_10485642 3300025949 Bacteria 1254
89 Ga0207651_10023637 3300025960 Unclassified 3786
90 Ga0207677_10236807 3300026023 Unclassified 1474
91 Ga0207703_10142482 3300026035 Unclassified 2081
92 Ga0207639_10257869 3300026041 Bacteria 1524
93 Ga0207641_10079572 3300026088 Bacteria 2841
94 Ga0207641_10209455 3300026088 Unclassified 1802
95 Ga0207641_10581411 3300026088 Unclassified 1095
96 Ga0207676_10004508 3300026095 Bacteria 9848
97 Ga0207683_10041811 3300026121 Bacteria 4003
98 Ga0265338_10005487 3300028800 Bacteria 16534
99 Ga0265338_10081183 3300028800 Unclassified 2720
100 Ga0265338_10081730 3300028800 Bacteria 2707
101 Ga0265324_10011550 3300029957 Bacteria 3363
102 Ga0265325_10006653 3300031241 Bacteria 6992
103 Ga0265340_10056788 3300031247 Bacteria 1883
104 Ga0265339_10096936 3300031249 Bacteria 1539
105 Ga0265327_10008787 3300031251 Bacteria 7452
106 Ga0265316_10045138 3300031344 Bacteria 3501
107 Ga0265316_10102422 3300031344 Bacteria 2175
108 Ga0265314_10034258 3300031711 Bacteria 3714
109 Ga0265314_10215808 3300031711 Bacteria 1123
110 Ga0265342_10127294 3300031712 Bacteria 1429
111 Ga0316576_10213935 3300031727 Bacteria 1450
112 Ga0373926_0038306 3300035083 Unclassified 1707
113 Ga0373944_0014455 3300035089 Unclassified 2203
114 Ga0373923_0076481 3300035111 Unclassified 1446
115 Ga0373945_0000644 3300035116 Bacteria 10060
116 Ga0373945_0054742 3300035116 Bacteria 1475
117 Ga0373954_0078796 3300035118 Bacteria 1572
118 Ga0373943_0000107 3300035170 Bacteria 30563
119 Ga0373943_0079656 3300035170 Bacteria 1677
120 Ga0373943_0091262 3300035170 Bacteria 1578
121 Ga0373946_0003824 3300035171 Bacteria 5345
122 Ga0373935_0000588 3300035692 Bacteria 18933
123 Ga0373935_0002420 3300035692 Bacteria 10685
124 Ga0373927_0000070 3300035695 Bacteria 73849
125 Ga0373933_0003755 3300035724 Bacteria 8394
126 Ga0373933_0065072 3300035724 Bacteria 2207
127 Ga0373947_0000202 3300035725 Bacteria 33146
128 Ga0373937_0012599 3300036401 Bacteria 7442
129 Ga0373937_0012976 3300036401 Bacteria 7338
130 Ga0373937_0067963 3300036401 Bacteria 3285
131 Ga0373925_0001143 3300037068 Bacteria 23596
132 Ga0373925_0053865 3300037068 Unclassified 3008
133 Ga0395905_0009658 3300037471 Bacteria 9416
134 Ga0395905_0388183 3300037471 Bacteria 1291
135 Ga0451791_1444116 3300041451 Bacteria 900
136 Ga0451837_1615792 3300041494 Bacteria 2004
137 Ga0451577_0000557 3300042876 Bacteria 60863
138 Ga0451577_0014834 3300042876 Bacteria 7259
139 Ga0451577_0061197 3300042876 Bacteria 3357
140 Ga0451577_0198480 3300042876 Bacteria 1811
141 Ga0453683_0062173 3300044673 Bacteria 2335
142 Ga0466964_0019084 3300044706 Bacteria 2634
143 Ga0453684_0000024 3300044712 Bacteria 819351
144 Ga0453684_0001008 3300044712 Bacteria 91215
145 Ga0453684_0001841 3300044712 Bacteria 55419
146 Ga0453684_0006219 3300044712 Bacteria 22887
147 Ga0453684_0195430 3300044712 Bacteria 2363
148 Ga0451576_0000043 3300045051 Bacteria 335666
149 Ga0451576_0018690 3300045051 Bacteria 7583
150 Ga0451576_0049935 3300045051 Bacteria 4390
151 Ga0451576_0211855 3300045051 Bacteria 2023
152 Ga0466967_0209278 3300045976 Bacteria 1849
153 Ga0495592_0069051 3300046454 Unclassified 2577
154 Ga0495592_0259993 3300046454 Bacteria 1144
155 Ga0495651_0434698 3300046462 Bacteria 851
156 Ga0495653_0128857 3300046463 Unclassified 1794
157 Ga0495662_0022506 3300046476 Bacteria 3043
158 Ga0495664_0059571 3300046477 Unclassified 2273
159 Ga0495664_0087600 3300046477 Bacteria 1871
160 Ga0495594_0173410 3300046499 Unclassified 1227
161 Ga0495618_0012004 3300046514 Bacteria 5256
162 Ga0495630_0022459 3300046517 Bacteria 4660
163 Ga0495630_0030977 3300046517 Bacteria 3982
164 Ga0495586_0207150 3300046535 Unclassified 1112
165 Ga0495667_0001136 3300046559 Bacteria 17338
166 Ga0495657_0004041 3300046675 Bacteria 11765
167 Ga0495599_0061186 3300046678 Unclassified 2353
168 Ga0495599_0095646 3300046678 Bacteria 1853
169 Ga0495613_0039675 3300046689 Bacteria 3490
170 Ga0495613_0056494 3300046689 Bacteria 2882
171 Ga0495624_0109469 3300046690 Bacteria 1699
172 Ga0495674_0008611 3300047319 Bacteria 9706
173 Ga0495674_0033564 3300047319 Bacteria 4647
174 Ga0495674_0058772 3300047319 Bacteria 3360
175 Ga0495675_0091377 3300047444 Bacteria 1911
176 Ga0495684_0076222 3300047471 Bacteria 2547
177 Ga0495684_0162718 3300047471 Bacteria 1664
178 Ga0495684_0307932 3300047471 Unclassified 1136
179 Ga0495602_0276243 3300048088 Bacteria 1240
180 Ga0496104_0556817 3300048907 Bacteria 1057
181 Ga0496117_0002159 3300048920 Bacteria 25663
182 Ga0496123_0032007 3300048926 Bacteria 3817
183 Ga0501033_0130272 3300049570 Bacteria 1823
184 Ga0501067_0370845 3300049583 Bacteria 798
185 Ga0501068_0455322 3300049584 Bacteria 828
186 Ga0501071_0170260 3300049587 Bacteria 1630
187 Ga0501079_0048129 3300049741 Bacteria 3290
188 nmdc:mga00v17_1044_c1 3300050491 Bacteria 14681
189 nmdc:mga07m45_6521_c1 3300050496 Bacteria 5905
190 Ga0495601_0139289 3300053077 Bacteria 1582
191 Ga0495619_0033026 3300053085 Bacteria 3360
192 Ga0500577_0004561 3300053142 Bacteria 3673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100000876 Ga0070713_1000008762 239
2 3300006028 Ga0070717_10031327 Ga0070717_100313275 239
3 3300006173 Ga0070716_100078723 Ga0070716_1000787232 239
4 3300025928 Ga0207700_10002088 Ga0207700_100020889 239
5 3300025939 Ga0207665_10074854 Ga0207665_100748542 239
6 3300028800 Ga0265338_10005487 Ga0265338_100054876 239
7 3300031344 Ga0265316_10102422 Ga0265316_101024222 239
8 3300044706 Ga0466964_0019084 Ga0466964_0019084_1828_2571 239
9 3300045976 Ga0466967_0209278 Ga0466967_0209278_979_1722 239
10 3300049583 Ga0501067_0370845 Ga0501067_0370845_11_739 242
11 3300009176 Ga0105242_10925130 Ga0105242_109251301 244
12 3300025934 Ga0207686_10191390 Ga0207686_101913901 244
13 3300005614 Ga0068856_100020090 Ga0068856_1000200902 248
14 3300026088 Ga0207641_10581411 Ga0207641_105814111 249
15 3300005434 Ga0070709_10175313 Ga0070709_101753132 250
16 3300005436 Ga0070713_100656029 Ga0070713_1006560291 250
17 3300005436 Ga0070713_100756953 Ga0070713_1007569532 250
18 3300006028 Ga0070717_10005386 Ga0070717_100053863 250
19 3300006028 Ga0070717_10121429 Ga0070717_101214292 250
20 3300006028 Ga0070717_10295037 Ga0070717_102950372 250
21 3300006175 Ga0070712_100001429 Ga0070712_1000014298 250
22 3300009093 Ga0105240_10037636 Ga0105240_100376362 250
23 3300013105 Ga0157369_10576148 Ga0157369_105761481 250
24 3300025906 Ga0207699_10005397 Ga0207699_100053974 250
25 3300025912 Ga0207707_10016144 Ga0207707_100161448 250
26 3300025913 Ga0207695_10124247 Ga0207695_101242473 250
27 3300025915 Ga0207693_10000672 Ga0207693_1000067219 250
28 3300025928 Ga0207700_10003723 Ga0207700_100037232 250
29 3300025929 Ga0207664_10648941 Ga0207664_106489411 250
30 3300025939 Ga0207665_10026761 Ga0207665_100267612 250
31 3300025949 Ga0207667_10485642 Ga0207667_104856422 250
32 3300031712 Ga0265342_10127294 Ga0265342_101272942 250
33 3300035083 Ga0373926_0038306 Ga0373926_0038306_651_1430 250
34 3300035089 Ga0373944_0014455 Ga0373944_0014455_1341_2120 250
35 3300035111 Ga0373923_0076481 Ga0373923_0076481_455_1234 250
36 3300035116 Ga0373945_0000644 Ga0373945_0000644_4571_5350 250
37 3300035116 Ga0373945_0054742 Ga0373945_0054742_73_846 250
38 3300035118 Ga0373954_0078796 Ga0373954_0078796_149_928 250
39 3300035170 Ga0373943_0000107 Ga0373943_0000107_14079_14858 250
40 3300035170 Ga0373943_0079656 Ga0373943_0079656_486_1259 250
41 3300035170 Ga0373943_0091262 Ga0373943_0091262_740_1519 250
42 3300035171 Ga0373946_0003824 Ga0373946_0003824_1606_2385 250
43 3300035692 Ga0373935_0000588 Ga0373935_0000588_11409_12188 250
44 3300035692 Ga0373935_0002420 Ga0373935_0002420_4865_5638 250
45 3300035695 Ga0373927_0000070 Ga0373927_0000070_37468_38247 250
46 3300035725 Ga0373947_0000202 Ga0373947_0000202_22225_23004 250
47 3300037068 Ga0373925_0001143 Ga0373925_0001143_5346_6125 250
48 3300037068 Ga0373925_0053865 Ga0373925_0053865_263_1036 250
49 3300046454 Ga0495592_0259993 Ga0495592_0259993_104_877 250
50 3300046463 Ga0495653_0128857 Ga0495653_0128857_982_1761 250
51 3300046477 Ga0495664_0059571 Ga0495664_0059571_1323_2096 250
52 3300046517 Ga0495630_0022459 Ga0495630_0022459_3062_3835 250
53 3300046517 Ga0495630_0030977 Ga0495630_0030977_1603_2382 250
54 3300046535 Ga0495586_0207150 Ga0495586_0207150_241_1014 250
55 3300046678 Ga0495599_0095646 Ga0495599_0095646_324_1097 250
56 3300046690 Ga0495624_0109469 Ga0495624_0109469_685_1464 250
57 3300047319 Ga0495674_0008611 Ga0495674_0008611_7452_8225 250
58 3300047319 Ga0495674_0058772 Ga0495674_0058772_445_1224 250
59 3300047444 Ga0495675_0091377 Ga0495675_0091377_657_1436 250
60 3300047471 Ga0495684_0307932 Ga0495684_0307932_238_1011 250
61 3300048088 Ga0495602_0276243 Ga0495602_0276243_198_977 250
62 3300048907 Ga0496104_0556817 Ga0496104_0556817_11_796 250
63 3300053077 Ga0495601_0139289 Ga0495601_0139289_539_1312 250
64 3300026121 Ga0207683_10041811 Ga0207683_100418112 251
65 3300005458 Ga0070681_10000202 Ga0070681_1000020212 252
66 3300005530 Ga0070679_100452653 Ga0070679_1004526531 252
67 3300025912 Ga0207707_10000177 Ga0207707_1000017762 252
68 3300031727 Ga0316576_10213935 Ga0316576_102139352 252
69 3300041451 Ga0451791_1444116 Ga0451791_1444116_103_867 252
70 3300049584 Ga0501068_0455322 Ga0501068_0455322_12_776 252
71 3300005434 Ga0070709_10009730 Ga0070709_100097303 253
72 3300005436 Ga0070713_100002684 Ga0070713_1000026841 253
73 3300005437 Ga0070710_10043709 Ga0070710_100437093 253
74 3300005530 Ga0070679_100415927 Ga0070679_1004159271 253
75 3300006175 Ga0070712_100018149 Ga0070712_1000181492 253
76 3300025898 Ga0207692_10156430 Ga0207692_101564302 253
77 3300028800 Ga0265338_10081730 Ga0265338_100817302 253
78 3300031247 Ga0265340_10056788 Ga0265340_100567883 253
79 3300031249 Ga0265339_10096936 Ga0265339_100969362 253
80 3300031344 Ga0265316_10045138 Ga0265316_100451383 253
81 3300031711 Ga0265314_10215808 Ga0265314_102158081 253
82 3300035724 Ga0373933_0003755 Ga0373933_0003755_2510_3295 253
83 3300036401 Ga0373937_0012976 Ga0373937_0012976_6257_7042 253
84 3300045051 Ga0451576_0211855 Ga0451576_0211855_335_1099 253
85 3300046462 Ga0495651_0434698 Ga0495651_0434698_35_820 253
86 3300045051 Ga0451576_0049935 Ga0451576_0049935_2411_3181 255
87 3300005435 Ga0070714_100000051 Ga0070714_10000005192 256
88 3300025916 Ga0207663_10054139 Ga0207663_100541392 256
89 3300025929 Ga0207664_10000029 Ga0207664_1000002962 256
90 3300028800 Ga0265338_10081183 Ga0265338_100811832 256
91 3300031241 Ga0265325_10006653 Ga0265325_100066533 256
92 3300037471 Ga0395905_0009658 Ga0395905_0009658_1727_2518 256
93 3300053142 Ga0500577_0004561 Ga0500577_0004561_379_1185 256
94 3300044712 Ga0453684_0001008 Ga0453684_0001008_18257_19030 257
95 3300014325 Ga0163163_10125539 Ga0163163_101255392 258
96 3300041494 Ga0451837_1615792 Ga0451837_1615792_800_1618 258
97 3300048926 Ga0496123_0032007 Ga0496123_0032007_1900_2718 258
98 3300049587 Ga0501071_0170260 Ga0501071_0170260_464_1282 258
99 3300049741 Ga0501079_0048129 Ga0501079_0048129_521_1339 258
100 iso_pu_bacteria 2643221681 2644456801 258
101 iso_pu_bacteria 2643221961 2645719973 258
102 iso_pu_bacteria 2643221962 2645726845 258
103 3300005544 Ga0070686_100288796 Ga0070686_1002887961 259
104 3300005548 Ga0070665_100261024 Ga0070665_1002610243 259
105 3300006051 Ga0075364_10012796 Ga0075364_100127966 259
106 3300006353 Ga0075370_10003196 Ga0075370_100031964 259
107 3300009093 Ga0105240_10000390 Ga0105240_1000039036 259
108 3300009093 Ga0105240_10085589 Ga0105240_100855894 259
109 3300009545 Ga0105237_10003688 Ga0105237_1000368811 259
110 3300009545 Ga0105237_10118721 Ga0105237_101187213 259
111 3300010375 Ga0105239_10000184 Ga0105239_1000018432 259
112 3300010375 Ga0105239_10033818 Ga0105239_100338185 259
113 3300013297 Ga0157378_10037390 Ga0157378_100373903 259
114 3300014326 Ga0157380_10002640 Ga0157380_100026403 259
115 3300025904 Ga0207647_10017536 Ga0207647_100175365 259
116 3300025913 Ga0207695_10000020 Ga0207695_1000002097 259
117 3300025913 Ga0207695_10022806 Ga0207695_100228066 259
118 3300025914 Ga0207671_10000025 Ga0207671_1000002538 259
119 3300026041 Ga0207639_10257869 Ga0207639_102578691 259
120 3300029957 Ga0265324_10011550 Ga0265324_100115504 259
121 3300031251 Ga0265327_10008787 Ga0265327_100087877 259
122 3300031711 Ga0265314_10034258 Ga0265314_100342586 259
123 3300037471 Ga0395905_0388183 Ga0395905_0388183_279_1163 259
124 3300042876 Ga0451577_0000557 Ga0451577_0000557_25484_26362 259
125 3300042876 Ga0451577_0061197 Ga0451577_0061197_2443_3222 259
126 3300042876 Ga0451577_0198480 Ga0451577_0198480_504_1322 259
127 3300044673 Ga0453683_0062173 Ga0453683_0062173_295_1083 259
128 3300044712 Ga0453684_0000024 Ga0453684_0000024_245438_246316 259
129 3300044712 Ga0453684_0001841 Ga0453684_0001841_18391_19170 259
130 3300044712 Ga0453684_0006219 Ga0453684_0006219_15756_16583 259
131 3300044712 Ga0453684_0195430 Ga0453684_0195430_360_1178 259
132 3300045051 Ga0451576_0000043 Ga0451576_0000043_55241_56029 259
133 3300045051 Ga0451576_0018690 Ga0451576_0018690_3148_3927 259
134 3300048920 Ga0496117_0002159 Ga0496117_0002159_11437_12243 259
135 3300049570 Ga0501033_0130272 Ga0501033_0130272_487_1371 259
136 3300050491 nmdc:mga00v17_1044_c1 nmdc:mga00v17_1044_c1_10807_11628 259
137 3300050496 nmdc:mga07m45_6521_c1 nmdc:mga07m45_6521_c1_4653_5558 259
138 iso_pu_bacteria 2643221697 2644538789 259
139 iso_pu_bacteria 2984592036 2984592225 259
140 3300042876 Ga0451577_0014834 Ga0451577_0014834_644_1468 260
141 3300005840 Ga0068870_10127885 Ga0068870_101278852 261
142 3300005841 Ga0068863_100198611 Ga0068863_1001986111 261
143 3300006237 Ga0097621_100062808 Ga0097621_1000628083 261
144 3300006237 Ga0097621_100121156 Ga0097621_1001211563 261
145 3300006358 Ga0068871_100015550 Ga0068871_1000155503 261
146 3300006844 Ga0075428_100907635 Ga0075428_1009076351 261
147 3300013308 Ga0157375_10680766 Ga0157375_106807661 261
148 3300014325 Ga0163163_10027228 Ga0163163_100272283 261
149 3300014325 Ga0163163_10033698 Ga0163163_100336983 261
150 3300014969 Ga0157376_10116463 Ga0157376_101164632 261
151 3300025936 Ga0207670_10184694 Ga0207670_101846941 261
152 3300025941 Ga0207711_10417517 Ga0207711_104175172 261
153 3300026088 Ga0207641_10209455 Ga0207641_102094552 261
154 3300035724 Ga0373933_0065072 Ga0373933_0065072_602_1387 261
155 3300036401 Ga0373937_0012599 Ga0373937_0012599_4162_4947 261
156 3300036401 Ga0373937_0067963 Ga0373937_0067963_2331_3239 261
157 3300046454 Ga0495592_0069051 Ga0495592_0069051_113_898 261
158 3300046476 Ga0495662_0022506 Ga0495662_0022506_202_1110 261
159 3300046477 Ga0495664_0087600 Ga0495664_0087600_284_1192 261
160 3300046499 Ga0495594_0173410 Ga0495594_0173410_85_993 261
161 3300046514 Ga0495618_0012004 Ga0495618_0012004_1306_2214 261
162 3300046559 Ga0495667_0001136 Ga0495667_0001136_7391_8176 261
163 3300046675 Ga0495657_0004041 Ga0495657_0004041_6923_7708 261
164 3300046678 Ga0495599_0061186 Ga0495599_0061186_68_853 261
165 3300046689 Ga0495613_0039675 Ga0495613_0039675_476_1384 261
166 3300046689 Ga0495613_0056494 Ga0495613_0056494_1037_1945 261
167 3300047319 Ga0495674_0033564 Ga0495674_0033564_3367_4275 261
168 3300047471 Ga0495684_0076222 Ga0495684_0076222_935_1843 261
169 3300047471 Ga0495684_0162718 Ga0495684_0162718_588_1418 261
170 3300053085 Ga0495619_0033026 Ga0495619_0033026_2331_3116 261
171 3300005330 Ga0070690_100003201 Ga0070690_1000032015 262
172 3300005331 Ga0070670_100007834 Ga0070670_1000078345 262
173 3300005335 Ga0070666_10001137 Ga0070666_100011375 262
174 3300005338 Ga0068868_100005508 Ga0068868_1000055085 262
175 3300005355 Ga0070671_100016426 Ga0070671_1000164265 262
176 3300005367 Ga0070667_100071661 Ga0070667_1000716612 262
177 3300005543 Ga0070672_100001694 Ga0070672_1000016945 262
178 3300005564 Ga0070664_100007205 Ga0070664_10000720510 262
179 3300005618 Ga0068864_100003613 Ga0068864_1000036137 262
180 3300005841 Ga0068863_100053375 Ga0068863_1000533753 262
181 3300005842 Ga0068858_100023284 Ga0068858_1000232845 262
182 3300009177 Ga0105248_10001841 Ga0105248_1000184116 262
183 3300013296 Ga0157374_10505053 Ga0157374_105050532 262
184 3300013308 Ga0157375_10005323 Ga0157375_100053234 262
185 3300014745 Ga0157377_10146140 Ga0157377_101461402 262
186 3300025903 Ga0207680_10034916 Ga0207680_100349163 262
187 3300025920 Ga0207649_10117968 Ga0207649_101179682 262
188 3300025925 Ga0207650_10022870 Ga0207650_100228705 262
189 3300025931 Ga0207644_10050883 Ga0207644_100508833 262
190 3300025940 Ga0207691_10110974 Ga0207691_101109742 262
191 3300025941 Ga0207711_10007210 Ga0207711_100072107 262
192 3300025945 Ga0207679_10017573 Ga0207679_100175732 262
193 3300025960 Ga0207651_10023637 Ga0207651_100236375 262
194 3300026023 Ga0207677_10236807 Ga0207677_102368072 262
195 3300026035 Ga0207703_10142482 Ga0207703_101424821 262
196 3300026088 Ga0207641_10079572 Ga0207641_100795723 262
197 3300026095 Ga0207676_10004508 Ga0207676_100045085 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

62

310

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.9203 7 262
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.9167 7 262
7txy-assembly2.cif.gz_F crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7925 8 259
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7769 5 260
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7706 6 260
ID Description Score Start End Superfamily
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9561 9 262 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9499 1 262 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9463 1 262 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9276 9 262 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9133 5 262 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A6P2FYV3-F1-model_v4 LigB family dioxygenase 0.988 6 164 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A841R859-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.-) 0.9864 7 262 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A2A3UIR6-F1-model_v4 deleted 0.9854 6 262
AF-A0A4V1VG44-F1-model_v4 Dioxygenase 0.9853 5 137 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A0T2YJ31-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9851 162 262 GO:0008198
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.48 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map