F302581

General Info

Members Datasets Scaffolds Average Seq Length
197 142 196 112

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10751341|Ga0070692_107513412
Length 121
Sequence MPRQYVLGMTKFLVLYKASTEAFEKMMKSATPEQQQAGMDAWMAWSKKAASSIVDMGAPLGKSLRVAKGGAATPVVNDLGGYSIMQAESKEALAAAMKDHPHFMMPDSSIEIVELMPNPIM

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
113 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
142 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 2.54
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10244775 3300003203 Bacteria 526
2 Ga0070676_10554694 3300005328 Bacteria 823
3 Ga0070683_100154975 3300005329 Unclassified 2173
4 Ga0070690_100005821 3300005330 Bacteria 6948
5 Ga0070690_101732233 3300005330 Bacteria 508
6 Ga0070682_100176055 3300005337 Bacteria 1490
7 Ga0070682_100214937 3300005337 Bacteria 1365
8 Ga0070689_100093409 3300005340 Bacteria 2374
9 Ga0070691_10510061 3300005341 Bacteria 696
10 Ga0070687_100401776 3300005343 Bacteria 899
11 Ga0070692_10751341 3300005345 Bacteria 661
12 Ga0070669_100016619 3300005353 Bacteria 5252
13 Ga0070674_100176678 3300005356 Bacteria 1632
14 Ga0070688_100447171 3300005365 Bacteria 965
15 Ga0070709_10911979 3300005434 Unclassified 695
16 Ga0070713_100225983 3300005436 Bacteria 1700
17 Ga0070710_10017863 3300005437 Bacteria 3641
18 Ga0070701_10226042 3300005438 Unclassified 1118
19 Ga0070701_10933229 3300005438 Bacteria 601
20 Ga0070700_100011241 3300005441 Bacteria 4956
21 Ga0070700_100243525 3300005441 Unclassified 1286
22 Ga0070694_100276036 3300005444 Unclassified 1280
23 Ga0070678_100007118 3300005456 Bacteria 6617
24 Ga0070678_101271150 3300005456 Unclassified 684
25 Ga0070681_10447131 3300005458 Bacteria 1204
26 Ga0070681_10616885 3300005458 Bacteria 999
27 Ga0068867_100026284 3300005459 Bacteria 4179
28 Ga0070706_100095807 3300005467 Bacteria 2755
29 Ga0070698_100516234 3300005471 Unclassified 1133
30 Ga0070684_100240767 3300005535 Bacteria 1653
31 Ga0068853_100560258 3300005539 Bacteria 1083
32 Ga0070672_100012529 3300005543 Bacteria 5958
33 Ga0070686_100226599 3300005544 Unclassified 1353
34 Ga0070686_101688220 3300005544 Unclassified 537
35 Ga0070695_100584315 3300005545 Bacteria 875
36 Ga0070695_101732145 3300005545 Unclassified 523
37 Ga0070704_101947221 3300005549 Unclassified 545
38 Ga0068859_102706765 3300005617 Bacteria 545
39 Ga0068864_101528507 3300005618 Unclassified 671
40 Ga0068861_100131861 3300005719 Unclassified 2029
41 Ga0068863_100312061 3300005841 Bacteria 1526
42 Ga0068863_100482459 3300005841 Bacteria 1219
43 Ga0081539_10019553 3300005985 Bacteria 4628
44 Ga0070717_10470124 3300006028 Bacteria 1135
45 Ga0070712_100730633 3300006175 Bacteria 846
46 Ga0097621_100157813 3300006237 Bacteria 1948
47 Ga0097621_100615609 3300006237 Bacteria 994
48 Ga0068871_100320492 3300006358 Bacteria 1365
49 Ga0068871_100499346 3300006358 Unclassified 1096
50 Ga0075433_11557120 3300006852 Bacteria 570
51 Ga0075429_100701664 3300006880 Bacteria 886
52 Ga0068865_100095613 3300006881 Bacteria 2165
53 Ga0097620_102705757 3300006931 Bacteria 545
54 Ga0075435_100006400 3300007076 Bacteria 8325
55 Ga0105240_10047404 3300009093 Bacteria 5438
56 Ga0111539_10048384 3300009094 Bacteria 5077
57 Ga0114129_12172739 3300009147 Unclassified 668
58 Ga0157378_10746006 3300013297 Unclassified 1001
59 Ga0157378_11078053 3300013297 Bacteria 840
60 Ga0163163_12294503 3300014325 Unclassified 598
61 Ga0157380_11090456 3300014326 Unclassified 837
62 Ga0157377_10722685 3300014745 Unclassified 726
63 Ga0157376_11961083 3300014969 Unclassified 623
64 Ga0157376_12237839 3300014969 Unclassified 586
65 Ga0207682_10577733 3300025893 Bacteria 530
66 Ga0207688_10693756 3300025901 Bacteria 644
67 Ga0207699_10426938 3300025906 Bacteria 947
68 Ga0207699_10718353 3300025906 Unclassified 732
69 Ga0207645_10348504 3300025907 Unclassified 991
70 Ga0207684_10030921 3300025910 Bacteria 4557
71 Ga0207707_10286601 3300025912 Bacteria 1425
72 Ga0207695_10123837 3300025913 Bacteria 2550
73 Ga0207663_11387998 3300025916 Bacteria 566
74 Ga0207662_10381953 3300025918 Bacteria 952
75 Ga0207681_10000285 3300025923 Bacteria 37414
76 Ga0207670_10084939 3300025936 Bacteria 2223
77 Ga0207669_10353506 3300025937 Bacteria 1136
78 Ga0207691_10092549 3300025940 Bacteria 2707
79 Ga0207691_10943674 3300025940 Bacteria 721
80 Ga0207661_10132679 3300025944 Bacteria 2136
81 Ga0207661_10622950 3300025944 Unclassified 991
82 Ga0207668_10133415 3300025972 Bacteria 1899
83 Ga0207677_12206327 3300026023 Unclassified 512
84 Ga0207639_10286856 3300026041 Bacteria 1450
85 Ga0207708_10262708 3300026075 Unclassified 1394
86 Ga0207708_10913952 3300026075 Unclassified 760
87 Ga0207641_10375765 3300026088 Bacteria 1360
88 Ga0207648_10031251 3300026089 Bacteria 4708
89 Ga0207676_10254098 3300026095 Bacteria 1584
90 Ga0207676_11810895 3300026095 Unclassified 609
91 Ga0207675_100652678 3300026118 Archaea 1058
92 Ga0207683_10528394 3300026121 Bacteria 1090
93 Ga0207428_10082161 3300027907 Bacteria 2514
94 Ga0265337_1062816 3300028556 Bacteria 1027
95 Ga0265319_1159470 3300028563 Unclassified 697
96 Ga0265334_10053474 3300028573 Bacteria 1542
97 Ga0265318_10000116 3300028577 Bacteria 73597
98 Ga0265318_10049087 3300028577 Bacteria 1588
99 Ga0265336_10005380 3300028666 Bacteria 4730
100 Ga0265336_10025213 3300028666 Bacteria 1874
101 Ga0307515_10020711 3300028794 Bacteria 11713
102 Ga0265338_10005710 3300028800 Bacteria 16094
103 Ga0265330_10000285 3300031235 Bacteria 37301
104 Ga0265332_10000307 3300031238 Bacteria 37860
105 Ga0265332_10045651 3300031238 Bacteria 1888
106 Ga0265328_10002419 3300031239 Bacteria 8372
107 Ga0265328_10006582 3300031239 Unclassified 4896
108 Ga0265320_10000640 3300031240 Bacteria 26770
109 Ga0265320_10001313 3300031240 Bacteria 18175
110 Ga0265320_10002737 3300031240 Bacteria 12191
111 Ga0265320_10140158 3300031240 Unclassified 1095
112 Ga0265329_10062736 3300031242 Bacteria 1176
113 Ga0265340_10165942 3300031247 Bacteria 1002
114 Ga0265340_10175167 3300031247 Bacteria 971
115 Ga0265339_10007251 3300031249 Bacteria 7184
116 Ga0265339_10017129 3300031249 Bacteria 4297
117 Ga0265339_10104453 3300031249 Unclassified 1471
118 Ga0265331_10000027 3300031250 Bacteria 220058
119 Ga0265316_10508521 3300031344 Bacteria 860
120 Ga0265316_10998597 3300031344 Unclassified 582
121 Ga0307509_10010924 3300031507 Bacteria 11066
122 Ga0307509_10029412 3300031507 Bacteria 6098
123 Ga0265313_10001030 3300031595 Bacteria 27101
124 Ga0307508_10034580 3300031616 Bacteria 4556
125 Ga0265314_10000333 3300031711 Bacteria 66259
126 Ga0265314_10004876 3300031711 Bacteria 12263
127 Ga0265314_10044290 3300031711 Bacteria 3155
128 Ga0265342_10000289 3300031712 Bacteria 56888
129 Ga0265342_10004556 3300031712 Bacteria 10840
130 Ga0265342_10033943 3300031712 Unclassified 3133
131 Ga0265342_10063076 3300031712 Bacteria 2179
132 Ga0307415_101303624 3300032126 Unclassified 688
133 Ga0373936_0000003 3300035113 Bacteria 401675
134 Ga0373936_0257297 3300035113 Bacteria 781
135 Ga0373954_0047033 3300035118 Bacteria 2018
136 Ga0373956_0322333 3300035119 Bacteria 736
137 Ga0373957_0016617 3300035120 Bacteria 2550
138 Ga0373957_0274057 3300035120 Bacteria 713
139 Ga0373957_0521831 3300035120 Unclassified 518
140 Ga0373943_0192397 3300035170 Bacteria 1126
141 Ga0373946_0106663 3300035171 Bacteria 1263
142 Ga0373955_0015397 3300035172 Bacteria 3744
143 Ga0373955_0038602 3300035172 Bacteria 2545
144 Ga0373955_0292864 3300035172 Unclassified 981
145 Ga0373955_0312733 3300035172 Bacteria 948
146 Ga0373955_0975012 3300035172 Bacteria 522
147 Ga0373961_0328924 3300035241 Unclassified 572
148 Ga0373933_0045273 3300035724 Bacteria 2609
149 Ga0373933_0532667 3300035724 Unclassified 770
150 Ga0373933_0682609 3300035724 Unclassified 675
151 Ga0373947_0305422 3300035725 Bacteria 1062
152 Ga0373937_0004614 3300036401 Bacteria 11700
153 Ga0373937_0080078 3300036401 Bacteria 3020
154 Ga0373937_0128047 3300036401 Bacteria 2370
155 Ga0373937_1672802 3300036401 Unclassified 583
156 Ga0373937_1973757 3300036401 Unclassified 530
157 Ga0373925_0021405 3300037068 Bacteria 4711
158 Ga0373925_0054407 3300037068 Bacteria 2994
159 Ga0373925_0139713 3300037068 Bacteria 1895
160 Ga0436365_1388533 3300039437 Bacteria 3132
161 Ga0436360_0357999 3300039438 Unclassified 741
162 Ga0451833_1000729 3300041491 Unclassified 776
163 Ga0451847_0161601 3300041503 Bacteria 1600
164 Ga0451849_0512069 3300041505 Bacteria 3239
165 Ga0451853_0502947 3300041512 Bacteria 33087
166 Ga0495650_0028158 3300046471 Unclassified 2585
167 Ga0495664_0010833 3300046477 Bacteria 5126
168 Ga0495618_0112419 3300046514 Bacteria 1744
169 Ga0495630_0068302 3300046517 Bacteria 2672
170 Ga0495630_0750243 3300046517 Bacteria 746
171 Ga0495652_0252527 3300046529 Bacteria 1306
172 Ga0495652_0649418 3300046529 Bacteria 715
173 Ga0495586_0031212 3300046535 Bacteria 2852
174 Ga0495668_0745138 3300046616 Bacteria 542
175 Ga0495634_0012370 3300046642 Bacteria 6180
176 Ga0495635_0291429 3300046663 Bacteria 1095
177 Ga0495657_0098934 3300046675 Bacteria 1861
178 Ga0495599_0287432 3300046678 Bacteria 995
179 Ga0495604_0505078 3300047317 Bacteria 784
180 Ga0495674_0014701 3300047319 Bacteria 7325
181 Ga0496100_0030613 3300048903 Bacteria 3340
182 Ga0496101_0016313 3300048904 Bacteria 5015
183 Ga0496112_0645010 3300048915 Bacteria 989
184 Ga0496114_0005429 3300048917 Bacteria 9972
185 Ga0496115_0011013 3300048918 Bacteria 6774
186 Ga0501067_0003333 3300049583 Bacteria 8834
187 Ga0501073_0004567 3300049589 Bacteria 10407
188 nmdc:mga08y16_24165_c1 3300050511 Bacteria 6415
189 nmdc:mga0rr50_103288_c1 3300050513 Bacteria 2243
190 nmdc:mga0rr50_42738_c1 3300050513 Bacteria 3312
191 nmdc:mga0rr50_689208_c1 3300050513 Bacteria 872
192 Ga0500635_0231288 3300053080 Bacteria 723
193 Ga0495595_0140257 3300053084 Bacteria 1186
194 Ga0500583_0003177 3300053092 Bacteria 5110
195 Ga0500650_0049616 3300053098 Bacteria 1948
196 Ga0500642_0229785 3300053130 Bacteria 857

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100006400 Ga0075435_1000064008 93
2 3300035171 Ga0373946_0106663 Ga0373946_0106663_23_304 93
3 3300035172 Ga0373955_0975012 Ga0373955_0975012_205_492 93
4 3300050513 nmdc:mga0rr50_42738_c1 nmdc:mga0rr50_42738_c1_2541_2843 93
5 3300028563 Ga0265319_1159470 Ga0265319_11594702 97
6 3300028577 Ga0265318_10049087 Ga0265318_100490872 97
7 3300035170 Ga0373943_0192397 Ga0373943_0192397_563_892 109
8 3300003203 JGI25406J46586_10244775 JGI25406J46586_102447751 111
9 3300005328 Ga0070676_10554694 Ga0070676_105546941 111
10 3300005329 Ga0070683_100154975 Ga0070683_1001549752 111
11 3300005330 Ga0070690_100005821 Ga0070690_1000058214 111
12 3300005330 Ga0070690_101732233 Ga0070690_1017322331 111
13 3300005337 Ga0070682_100176055 Ga0070682_1001760551 111
14 3300005337 Ga0070682_100214937 Ga0070682_1002149372 111
15 3300005340 Ga0070689_100093409 Ga0070689_1000934093 111
16 3300005341 Ga0070691_10510061 Ga0070691_105100611 111
17 3300005343 Ga0070687_100401776 Ga0070687_1004017761 111
18 3300005345 Ga0070692_10751341 Ga0070692_107513412 111
19 3300005353 Ga0070669_100016619 Ga0070669_1000166191 111
20 3300005356 Ga0070674_100176678 Ga0070674_1001766782 111
21 3300005365 Ga0070688_100447171 Ga0070688_1004471711 111
22 3300005434 Ga0070709_10911979 Ga0070709_109119792 111
23 3300005436 Ga0070713_100225983 Ga0070713_1002259832 111
24 3300005437 Ga0070710_10017863 Ga0070710_100178634 111
25 3300005438 Ga0070701_10226042 Ga0070701_102260422 111
26 3300005438 Ga0070701_10933229 Ga0070701_109332292 111
27 3300005441 Ga0070700_100011241 Ga0070700_1000112412 111
28 3300005441 Ga0070700_100243525 Ga0070700_1002435252 111
29 3300005444 Ga0070694_100276036 Ga0070694_1002760362 111
30 3300005456 Ga0070678_100007118 Ga0070678_1000071183 111
31 3300005456 Ga0070678_101271150 Ga0070678_1012711502 111
32 3300005458 Ga0070681_10447131 Ga0070681_104471312 111
33 3300005458 Ga0070681_10616885 Ga0070681_106168852 111
34 3300005459 Ga0068867_100026284 Ga0068867_1000262841 111
35 3300005467 Ga0070706_100095807 Ga0070706_1000958073 111
36 3300005471 Ga0070698_100516234 Ga0070698_1005162341 111
37 3300005535 Ga0070684_100240767 Ga0070684_1002407673 111
38 3300005539 Ga0068853_100560258 Ga0068853_1005602581 111
39 3300005543 Ga0070672_100012529 Ga0070672_1000125292 111
40 3300005544 Ga0070686_100226599 Ga0070686_1002265992 111
41 3300005544 Ga0070686_101688220 Ga0070686_1016882201 111
42 3300005545 Ga0070695_100584315 Ga0070695_1005843151 111
43 3300005545 Ga0070695_101732145 Ga0070695_1017321451 111
44 3300005549 Ga0070704_101947221 Ga0070704_1019472211 111
45 3300005617 Ga0068859_102706765 Ga0068859_1027067651 111
46 3300005618 Ga0068864_101528507 Ga0068864_1015285071 111
47 3300005719 Ga0068861_100131861 Ga0068861_1001318613 111
48 3300005841 Ga0068863_100312061 Ga0068863_1003120612 111
49 3300005841 Ga0068863_100482459 Ga0068863_1004824591 111
50 3300005985 Ga0081539_10019553 Ga0081539_100195534 111
51 3300006028 Ga0070717_10470124 Ga0070717_104701242 111
52 3300006175 Ga0070712_100730633 Ga0070712_1007306332 111
53 3300006237 Ga0097621_100157813 Ga0097621_1001578133 111
54 3300006237 Ga0097621_100615609 Ga0097621_1006156092 111
55 3300006358 Ga0068871_100320492 Ga0068871_1003204921 111
56 3300006358 Ga0068871_100499346 Ga0068871_1004993463 111
57 3300006852 Ga0075433_11557120 Ga0075433_115571201 111
58 3300006880 Ga0075429_100701664 Ga0075429_1007016641 111
59 3300006881 Ga0068865_100095613 Ga0068865_1000956133 111
60 3300006931 Ga0097620_102705757 Ga0097620_1027057571 111
61 3300007076 Ga0075435_100006400 Ga0075435_1000064002 111
62 3300009093 Ga0105240_10047404 Ga0105240_100474043 111
63 3300009094 Ga0111539_10048384 Ga0111539_100483845 111
64 3300009147 Ga0114129_12172739 Ga0114129_121727391 111
65 3300013297 Ga0157378_10746006 Ga0157378_107460061 111
66 3300013297 Ga0157378_11078053 Ga0157378_110780532 111
67 3300014325 Ga0163163_12294503 Ga0163163_122945031 111
68 3300014326 Ga0157380_11090456 Ga0157380_110904562 111
69 3300014745 Ga0157377_10722685 Ga0157377_107226851 111
70 3300014969 Ga0157376_11961083 Ga0157376_119610832 111
71 3300014969 Ga0157376_12237839 Ga0157376_122378392 111
72 3300025893 Ga0207682_10577733 Ga0207682_105777331 111
73 3300025901 Ga0207688_10693756 Ga0207688_106937562 111
74 3300025906 Ga0207699_10426938 Ga0207699_104269382 111
75 3300025906 Ga0207699_10718353 Ga0207699_107183532 111
76 3300025907 Ga0207645_10348504 Ga0207645_103485042 111
77 3300025910 Ga0207684_10030921 Ga0207684_100309213 111
78 3300025912 Ga0207707_10286601 Ga0207707_102866012 111
79 3300025913 Ga0207695_10123837 Ga0207695_101238372 111
80 3300025916 Ga0207663_11387998 Ga0207663_113879982 111
81 3300025918 Ga0207662_10381953 Ga0207662_103819532 111
82 3300025923 Ga0207681_10000285 Ga0207681_100002859 111
83 3300025936 Ga0207670_10084939 Ga0207670_100849391 111
84 3300025937 Ga0207669_10353506 Ga0207669_103535062 111
85 3300025940 Ga0207691_10092549 Ga0207691_100925494 111
86 3300025940 Ga0207691_10943674 Ga0207691_109436742 111
87 3300025944 Ga0207661_10132679 Ga0207661_101326792 111
88 3300025944 Ga0207661_10622950 Ga0207661_106229502 111
89 3300025972 Ga0207668_10133415 Ga0207668_101334153 111
90 3300026023 Ga0207677_12206327 Ga0207677_122063271 111
91 3300026041 Ga0207639_10286856 Ga0207639_102868562 111
92 3300026075 Ga0207708_10262708 Ga0207708_102627081 111
93 3300026075 Ga0207708_10913952 Ga0207708_109139521 111
94 3300026088 Ga0207641_10375765 Ga0207641_103757651 111
95 3300026089 Ga0207648_10031251 Ga0207648_100312511 111
96 3300026095 Ga0207676_10254098 Ga0207676_102540982 111
97 3300026095 Ga0207676_11810895 Ga0207676_118108951 111
98 3300026118 Ga0207675_100652678 Ga0207675_1006526782 111
99 3300026121 Ga0207683_10528394 Ga0207683_105283941 111
100 3300027907 Ga0207428_10082161 Ga0207428_100821613 111
101 3300028556 Ga0265337_1062816 Ga0265337_10628162 111
102 3300028573 Ga0265334_10053474 Ga0265334_100534741 111
103 3300028577 Ga0265318_10000116 Ga0265318_100001163 111
104 3300028666 Ga0265336_10005380 Ga0265336_100053805 111
105 3300028666 Ga0265336_10025213 Ga0265336_100252132 111
106 3300028794 Ga0307515_10020711 Ga0307515_100207118 111
107 3300028800 Ga0265338_10005710 Ga0265338_100057109 111
108 3300031235 Ga0265330_10000285 Ga0265330_100002853 111
109 3300031238 Ga0265332_10000307 Ga0265332_1000030728 111
110 3300031238 Ga0265332_10045651 Ga0265332_100456512 111
111 3300031239 Ga0265328_10002419 Ga0265328_100024196 111
112 3300031239 Ga0265328_10006582 Ga0265328_100065823 111
113 3300031240 Ga0265320_10000640 Ga0265320_1000064021 111
114 3300031240 Ga0265320_10001313 Ga0265320_1000131312 111
115 3300031240 Ga0265320_10002737 Ga0265320_1000273712 111
116 3300031240 Ga0265320_10140158 Ga0265320_101401581 111
117 3300031242 Ga0265329_10062736 Ga0265329_100627361 111
118 3300031247 Ga0265340_10165942 Ga0265340_101659422 111
119 3300031247 Ga0265340_10175167 Ga0265340_101751672 111
120 3300031249 Ga0265339_10007251 Ga0265339_100072517 111
121 3300031249 Ga0265339_10017129 Ga0265339_100171292 111
122 3300031249 Ga0265339_10104453 Ga0265339_101044532 111
123 3300031250 Ga0265331_10000027 Ga0265331_100000273 111
124 3300031344 Ga0265316_10508521 Ga0265316_105085212 111
125 3300031344 Ga0265316_10998597 Ga0265316_109985971 111
126 3300031507 Ga0307509_10010924 Ga0307509_1001092410 111
127 3300031507 Ga0307509_10029412 Ga0307509_100294126 111
128 3300031595 Ga0265313_10001030 Ga0265313_100010303 111
129 3300031616 Ga0307508_10034580 Ga0307508_100345801 111
130 3300031711 Ga0265314_10000333 Ga0265314_100003333 111
131 3300031711 Ga0265314_10004876 Ga0265314_1000487610 111
132 3300031711 Ga0265314_10044290 Ga0265314_100442901 111
133 3300031712 Ga0265342_10000289 Ga0265342_1000028951 111
134 3300031712 Ga0265342_10004556 Ga0265342_100045563 111
135 3300031712 Ga0265342_10033943 Ga0265342_100339433 111
136 3300031712 Ga0265342_10063076 Ga0265342_100630762 111
137 3300032126 Ga0307415_101303624 Ga0307415_1013036242 111
138 3300035113 Ga0373936_0000003 Ga0373936_0000003_129016_129354 111
139 3300035113 Ga0373936_0257297 Ga0373936_0257297_352_687 111
140 3300035118 Ga0373954_0047033 Ga0373954_0047033_1583_1918 111
141 3300035119 Ga0373956_0322333 Ga0373956_0322333_292_627 111
142 3300035120 Ga0373957_0016617 Ga0373957_0016617_1060_1395 111
143 3300035120 Ga0373957_0274057 Ga0373957_0274057_288_626 111
144 3300035120 Ga0373957_0521831 Ga0373957_0521831_67_402 111
145 3300035172 Ga0373955_0015397 Ga0373955_0015397_367_702 111
146 3300035172 Ga0373955_0038602 Ga0373955_0038602_1414_1749 111
147 3300035172 Ga0373955_0292864 Ga0373955_0292864_77_412 111
148 3300035172 Ga0373955_0312733 Ga0373955_0312733_65_403 111
149 3300035241 Ga0373961_0328924 Ga0373961_0328924_104_439 111
150 3300035724 Ga0373933_0045273 Ga0373933_0045273_1513_1854 111
151 3300035724 Ga0373933_0532667 Ga0373933_0532667_223_561 111
152 3300035724 Ga0373933_0682609 Ga0373933_0682609_215_550 111
153 3300035725 Ga0373947_0305422 Ga0373947_0305422_555_890 111
154 3300036401 Ga0373937_0004614 Ga0373937_0004614_8173_8508 111
155 3300036401 Ga0373937_0080078 Ga0373937_0080078_1904_2239 111
156 3300036401 Ga0373937_0128047 Ga0373937_0128047_1908_2246 111
157 3300036401 Ga0373937_1672802 Ga0373937_1672802_106_441 111
158 3300036401 Ga0373937_1973757 Ga0373937_1973757_79_414 111
159 3300037068 Ga0373925_0021405 Ga0373925_0021405_1358_1693 111
160 3300037068 Ga0373925_0054407 Ga0373925_0054407_1549_1884 111
161 3300037068 Ga0373925_0139713 Ga0373925_0139713_238_573 111
162 3300039437 Ga0436365_1388533 Ga0436365_1388533_364_792 111
163 3300039438 Ga0436360_0357999 Ga0436360_0357999_125_466 111
164 3300041491 Ga0451833_1000729 Ga0451833_1000729_206_541 111
165 3300041503 Ga0451847_0161601 Ga0451847_0161601_1182_1517 111
166 3300041505 Ga0451849_0512069 Ga0451849_0512069_2136_2471 111
167 3300041512 Ga0451853_0502947 Ga0451853_0502947_27179_27514 111
168 3300046471 Ga0495650_0028158 Ga0495650_0028158_1610_1948 111
169 3300046477 Ga0495664_0010833 Ga0495664_0010833_2971_3306 111
170 3300046514 Ga0495618_0112419 Ga0495618_0112419_304_639 111
171 3300046517 Ga0495630_0068302 Ga0495630_0068302_710_1045 111
172 3300046517 Ga0495630_0750243 Ga0495630_0750243_228_563 111
173 3300046529 Ga0495652_0252527 Ga0495652_0252527_645_980 111
174 3300046529 Ga0495652_0649418 Ga0495652_0649418_264_599 111
175 3300046535 Ga0495586_0031212 Ga0495586_0031212_1125_1460 111
176 3300046616 Ga0495668_0745138 Ga0495668_0745138_182_517 111
177 3300046642 Ga0495634_0012370 Ga0495634_0012370_293_628 111
178 3300046663 Ga0495635_0291429 Ga0495635_0291429_639_974 111
179 3300046675 Ga0495657_0098934 Ga0495657_0098934_13_348 111
180 3300046678 Ga0495599_0287432 Ga0495599_0287432_465_800 111
181 3300047317 Ga0495604_0505078 Ga0495604_0505078_199_534 111
182 3300047319 Ga0495674_0014701 Ga0495674_0014701_2808_3143 111
183 3300048903 Ga0496100_0030613 Ga0496100_0030613_2752_3093 111
184 3300048904 Ga0496101_0016313 Ga0496101_0016313_4106_4447 111
185 3300048915 Ga0496112_0645010 Ga0496112_0645010_298_633 111
186 3300048917 Ga0496114_0005429 Ga0496114_0005429_9392_9733 111
187 3300048918 Ga0496115_0011013 Ga0496115_0011013_1138_1479 111
188 3300049583 Ga0501067_0003333 Ga0501067_0003333_5812_6153 111
189 3300049589 Ga0501073_0004567 Ga0501073_0004567_103_444 111
190 3300050511 nmdc:mga08y16_24165_c1 nmdc:mga08y16_24165_c1_4435_4770 111
191 3300050513 nmdc:mga0rr50_103288_c1 nmdc:mga0rr50_103288_c1_1088_1423 111
192 3300050513 nmdc:mga0rr50_689208_c1 nmdc:mga0rr50_689208_c1_457_798 111
193 3300053080 Ga0500635_0231288 Ga0500635_0231288_292_675 111
194 3300053084 Ga0495595_0140257 Ga0495595_0140257_437_772 111
195 3300053092 Ga0500583_0003177 Ga0500583_0003177_2819_3157 111
196 3300053098 Ga0500650_0049616 Ga0500650_0049616_1301_1735 111
197 3300053130 Ga0500642_0229785 Ga0500642_0229785_42_380 111

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7004 2 111
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6898 2 111
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6683 3 111
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6653 3 111
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6601 3 111
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7004 2 111 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6898 2 111 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.661 3 111 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6262 3 111 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6108 3 108 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A1G6EMT4-F1-model_v4 YCII-related domain-containing protein 0.9576 1 108
AF-A0A538PHK1-F1-model_v4 YCII-related domain-containing protein 0.9492 1 111
AF-A0A2H0UBW2-F1-model_v4 YCII-related domain-containing protein 0.9459 1 108
AF-A0A538PHK1-F1-model_v4 YCII-related domain-containing protein 0.941 1 111
AF-A0A1G2SMC4-F1-model_v4 YCII-related domain-containing protein 0.9392 1 111

Feature Viewer

pLDDT pTM Quality
94.38 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map