F302581
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 197 | 142 | 196 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10751341|Ga0070692_107513412 |
| Length | 121 |
| Sequence | MPRQYVLGMTKFLVLYKASTEAFEKMMKSATPEQQQAGMDAWMAWSKKAASSIVDMGAPLGKSLRVAKGGAATPVVNDLGGYSIMQAESKEALAAAMKDHPHFMMPDSSIEIVELMPNPIM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 77 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 78 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 79 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 82 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 84 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 86 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 88 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 89 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 92 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 93 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 95 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 99 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 102 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 103 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 107 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 112 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 113 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 114 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 115 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 116 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 139 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 141 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 142 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 0 |
| Rhizoplane | 2.54 |
| Rhizosphere | 90.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10244775 | 3300003203 | Bacteria | 526 |
| 2 | Ga0070676_10554694 | 3300005328 | Bacteria | 823 |
| 3 | Ga0070683_100154975 | 3300005329 | Unclassified | 2173 |
| 4 | Ga0070690_100005821 | 3300005330 | Bacteria | 6948 |
| 5 | Ga0070690_101732233 | 3300005330 | Bacteria | 508 |
| 6 | Ga0070682_100176055 | 3300005337 | Bacteria | 1490 |
| 7 | Ga0070682_100214937 | 3300005337 | Bacteria | 1365 |
| 8 | Ga0070689_100093409 | 3300005340 | Bacteria | 2374 |
| 9 | Ga0070691_10510061 | 3300005341 | Bacteria | 696 |
| 10 | Ga0070687_100401776 | 3300005343 | Bacteria | 899 |
| 11 | Ga0070692_10751341 | 3300005345 | Bacteria | 661 |
| 12 | Ga0070669_100016619 | 3300005353 | Bacteria | 5252 |
| 13 | Ga0070674_100176678 | 3300005356 | Bacteria | 1632 |
| 14 | Ga0070688_100447171 | 3300005365 | Bacteria | 965 |
| 15 | Ga0070709_10911979 | 3300005434 | Unclassified | 695 |
| 16 | Ga0070713_100225983 | 3300005436 | Bacteria | 1700 |
| 17 | Ga0070710_10017863 | 3300005437 | Bacteria | 3641 |
| 18 | Ga0070701_10226042 | 3300005438 | Unclassified | 1118 |
| 19 | Ga0070701_10933229 | 3300005438 | Bacteria | 601 |
| 20 | Ga0070700_100011241 | 3300005441 | Bacteria | 4956 |
| 21 | Ga0070700_100243525 | 3300005441 | Unclassified | 1286 |
| 22 | Ga0070694_100276036 | 3300005444 | Unclassified | 1280 |
| 23 | Ga0070678_100007118 | 3300005456 | Bacteria | 6617 |
| 24 | Ga0070678_101271150 | 3300005456 | Unclassified | 684 |
| 25 | Ga0070681_10447131 | 3300005458 | Bacteria | 1204 |
| 26 | Ga0070681_10616885 | 3300005458 | Bacteria | 999 |
| 27 | Ga0068867_100026284 | 3300005459 | Bacteria | 4179 |
| 28 | Ga0070706_100095807 | 3300005467 | Bacteria | 2755 |
| 29 | Ga0070698_100516234 | 3300005471 | Unclassified | 1133 |
| 30 | Ga0070684_100240767 | 3300005535 | Bacteria | 1653 |
| 31 | Ga0068853_100560258 | 3300005539 | Bacteria | 1083 |
| 32 | Ga0070672_100012529 | 3300005543 | Bacteria | 5958 |
| 33 | Ga0070686_100226599 | 3300005544 | Unclassified | 1353 |
| 34 | Ga0070686_101688220 | 3300005544 | Unclassified | 537 |
| 35 | Ga0070695_100584315 | 3300005545 | Bacteria | 875 |
| 36 | Ga0070695_101732145 | 3300005545 | Unclassified | 523 |
| 37 | Ga0070704_101947221 | 3300005549 | Unclassified | 545 |
| 38 | Ga0068859_102706765 | 3300005617 | Bacteria | 545 |
| 39 | Ga0068864_101528507 | 3300005618 | Unclassified | 671 |
| 40 | Ga0068861_100131861 | 3300005719 | Unclassified | 2029 |
| 41 | Ga0068863_100312061 | 3300005841 | Bacteria | 1526 |
| 42 | Ga0068863_100482459 | 3300005841 | Bacteria | 1219 |
| 43 | Ga0081539_10019553 | 3300005985 | Bacteria | 4628 |
| 44 | Ga0070717_10470124 | 3300006028 | Bacteria | 1135 |
| 45 | Ga0070712_100730633 | 3300006175 | Bacteria | 846 |
| 46 | Ga0097621_100157813 | 3300006237 | Bacteria | 1948 |
| 47 | Ga0097621_100615609 | 3300006237 | Bacteria | 994 |
| 48 | Ga0068871_100320492 | 3300006358 | Bacteria | 1365 |
| 49 | Ga0068871_100499346 | 3300006358 | Unclassified | 1096 |
| 50 | Ga0075433_11557120 | 3300006852 | Bacteria | 570 |
| 51 | Ga0075429_100701664 | 3300006880 | Bacteria | 886 |
| 52 | Ga0068865_100095613 | 3300006881 | Bacteria | 2165 |
| 53 | Ga0097620_102705757 | 3300006931 | Bacteria | 545 |
| 54 | Ga0075435_100006400 | 3300007076 | Bacteria | 8325 |
| 55 | Ga0105240_10047404 | 3300009093 | Bacteria | 5438 |
| 56 | Ga0111539_10048384 | 3300009094 | Bacteria | 5077 |
| 57 | Ga0114129_12172739 | 3300009147 | Unclassified | 668 |
| 58 | Ga0157378_10746006 | 3300013297 | Unclassified | 1001 |
| 59 | Ga0157378_11078053 | 3300013297 | Bacteria | 840 |
| 60 | Ga0163163_12294503 | 3300014325 | Unclassified | 598 |
| 61 | Ga0157380_11090456 | 3300014326 | Unclassified | 837 |
| 62 | Ga0157377_10722685 | 3300014745 | Unclassified | 726 |
| 63 | Ga0157376_11961083 | 3300014969 | Unclassified | 623 |
| 64 | Ga0157376_12237839 | 3300014969 | Unclassified | 586 |
| 65 | Ga0207682_10577733 | 3300025893 | Bacteria | 530 |
| 66 | Ga0207688_10693756 | 3300025901 | Bacteria | 644 |
| 67 | Ga0207699_10426938 | 3300025906 | Bacteria | 947 |
| 68 | Ga0207699_10718353 | 3300025906 | Unclassified | 732 |
| 69 | Ga0207645_10348504 | 3300025907 | Unclassified | 991 |
| 70 | Ga0207684_10030921 | 3300025910 | Bacteria | 4557 |
| 71 | Ga0207707_10286601 | 3300025912 | Bacteria | 1425 |
| 72 | Ga0207695_10123837 | 3300025913 | Bacteria | 2550 |
| 73 | Ga0207663_11387998 | 3300025916 | Bacteria | 566 |
| 74 | Ga0207662_10381953 | 3300025918 | Bacteria | 952 |
| 75 | Ga0207681_10000285 | 3300025923 | Bacteria | 37414 |
| 76 | Ga0207670_10084939 | 3300025936 | Bacteria | 2223 |
| 77 | Ga0207669_10353506 | 3300025937 | Bacteria | 1136 |
| 78 | Ga0207691_10092549 | 3300025940 | Bacteria | 2707 |
| 79 | Ga0207691_10943674 | 3300025940 | Bacteria | 721 |
| 80 | Ga0207661_10132679 | 3300025944 | Bacteria | 2136 |
| 81 | Ga0207661_10622950 | 3300025944 | Unclassified | 991 |
| 82 | Ga0207668_10133415 | 3300025972 | Bacteria | 1899 |
| 83 | Ga0207677_12206327 | 3300026023 | Unclassified | 512 |
| 84 | Ga0207639_10286856 | 3300026041 | Bacteria | 1450 |
| 85 | Ga0207708_10262708 | 3300026075 | Unclassified | 1394 |
| 86 | Ga0207708_10913952 | 3300026075 | Unclassified | 760 |
| 87 | Ga0207641_10375765 | 3300026088 | Bacteria | 1360 |
| 88 | Ga0207648_10031251 | 3300026089 | Bacteria | 4708 |
| 89 | Ga0207676_10254098 | 3300026095 | Bacteria | 1584 |
| 90 | Ga0207676_11810895 | 3300026095 | Unclassified | 609 |
| 91 | Ga0207675_100652678 | 3300026118 | Archaea | 1058 |
| 92 | Ga0207683_10528394 | 3300026121 | Bacteria | 1090 |
| 93 | Ga0207428_10082161 | 3300027907 | Bacteria | 2514 |
| 94 | Ga0265337_1062816 | 3300028556 | Bacteria | 1027 |
| 95 | Ga0265319_1159470 | 3300028563 | Unclassified | 697 |
| 96 | Ga0265334_10053474 | 3300028573 | Bacteria | 1542 |
| 97 | Ga0265318_10000116 | 3300028577 | Bacteria | 73597 |
| 98 | Ga0265318_10049087 | 3300028577 | Bacteria | 1588 |
| 99 | Ga0265336_10005380 | 3300028666 | Bacteria | 4730 |
| 100 | Ga0265336_10025213 | 3300028666 | Bacteria | 1874 |
| 101 | Ga0307515_10020711 | 3300028794 | Bacteria | 11713 |
| 102 | Ga0265338_10005710 | 3300028800 | Bacteria | 16094 |
| 103 | Ga0265330_10000285 | 3300031235 | Bacteria | 37301 |
| 104 | Ga0265332_10000307 | 3300031238 | Bacteria | 37860 |
| 105 | Ga0265332_10045651 | 3300031238 | Bacteria | 1888 |
| 106 | Ga0265328_10002419 | 3300031239 | Bacteria | 8372 |
| 107 | Ga0265328_10006582 | 3300031239 | Unclassified | 4896 |
| 108 | Ga0265320_10000640 | 3300031240 | Bacteria | 26770 |
| 109 | Ga0265320_10001313 | 3300031240 | Bacteria | 18175 |
| 110 | Ga0265320_10002737 | 3300031240 | Bacteria | 12191 |
| 111 | Ga0265320_10140158 | 3300031240 | Unclassified | 1095 |
| 112 | Ga0265329_10062736 | 3300031242 | Bacteria | 1176 |
| 113 | Ga0265340_10165942 | 3300031247 | Bacteria | 1002 |
| 114 | Ga0265340_10175167 | 3300031247 | Bacteria | 971 |
| 115 | Ga0265339_10007251 | 3300031249 | Bacteria | 7184 |
| 116 | Ga0265339_10017129 | 3300031249 | Bacteria | 4297 |
| 117 | Ga0265339_10104453 | 3300031249 | Unclassified | 1471 |
| 118 | Ga0265331_10000027 | 3300031250 | Bacteria | 220058 |
| 119 | Ga0265316_10508521 | 3300031344 | Bacteria | 860 |
| 120 | Ga0265316_10998597 | 3300031344 | Unclassified | 582 |
| 121 | Ga0307509_10010924 | 3300031507 | Bacteria | 11066 |
| 122 | Ga0307509_10029412 | 3300031507 | Bacteria | 6098 |
| 123 | Ga0265313_10001030 | 3300031595 | Bacteria | 27101 |
| 124 | Ga0307508_10034580 | 3300031616 | Bacteria | 4556 |
| 125 | Ga0265314_10000333 | 3300031711 | Bacteria | 66259 |
| 126 | Ga0265314_10004876 | 3300031711 | Bacteria | 12263 |
| 127 | Ga0265314_10044290 | 3300031711 | Bacteria | 3155 |
| 128 | Ga0265342_10000289 | 3300031712 | Bacteria | 56888 |
| 129 | Ga0265342_10004556 | 3300031712 | Bacteria | 10840 |
| 130 | Ga0265342_10033943 | 3300031712 | Unclassified | 3133 |
| 131 | Ga0265342_10063076 | 3300031712 | Bacteria | 2179 |
| 132 | Ga0307415_101303624 | 3300032126 | Unclassified | 688 |
| 133 | Ga0373936_0000003 | 3300035113 | Bacteria | 401675 |
| 134 | Ga0373936_0257297 | 3300035113 | Bacteria | 781 |
| 135 | Ga0373954_0047033 | 3300035118 | Bacteria | 2018 |
| 136 | Ga0373956_0322333 | 3300035119 | Bacteria | 736 |
| 137 | Ga0373957_0016617 | 3300035120 | Bacteria | 2550 |
| 138 | Ga0373957_0274057 | 3300035120 | Bacteria | 713 |
| 139 | Ga0373957_0521831 | 3300035120 | Unclassified | 518 |
| 140 | Ga0373943_0192397 | 3300035170 | Bacteria | 1126 |
| 141 | Ga0373946_0106663 | 3300035171 | Bacteria | 1263 |
| 142 | Ga0373955_0015397 | 3300035172 | Bacteria | 3744 |
| 143 | Ga0373955_0038602 | 3300035172 | Bacteria | 2545 |
| 144 | Ga0373955_0292864 | 3300035172 | Unclassified | 981 |
| 145 | Ga0373955_0312733 | 3300035172 | Bacteria | 948 |
| 146 | Ga0373955_0975012 | 3300035172 | Bacteria | 522 |
| 147 | Ga0373961_0328924 | 3300035241 | Unclassified | 572 |
| 148 | Ga0373933_0045273 | 3300035724 | Bacteria | 2609 |
| 149 | Ga0373933_0532667 | 3300035724 | Unclassified | 770 |
| 150 | Ga0373933_0682609 | 3300035724 | Unclassified | 675 |
| 151 | Ga0373947_0305422 | 3300035725 | Bacteria | 1062 |
| 152 | Ga0373937_0004614 | 3300036401 | Bacteria | 11700 |
| 153 | Ga0373937_0080078 | 3300036401 | Bacteria | 3020 |
| 154 | Ga0373937_0128047 | 3300036401 | Bacteria | 2370 |
| 155 | Ga0373937_1672802 | 3300036401 | Unclassified | 583 |
| 156 | Ga0373937_1973757 | 3300036401 | Unclassified | 530 |
| 157 | Ga0373925_0021405 | 3300037068 | Bacteria | 4711 |
| 158 | Ga0373925_0054407 | 3300037068 | Bacteria | 2994 |
| 159 | Ga0373925_0139713 | 3300037068 | Bacteria | 1895 |
| 160 | Ga0436365_1388533 | 3300039437 | Bacteria | 3132 |
| 161 | Ga0436360_0357999 | 3300039438 | Unclassified | 741 |
| 162 | Ga0451833_1000729 | 3300041491 | Unclassified | 776 |
| 163 | Ga0451847_0161601 | 3300041503 | Bacteria | 1600 |
| 164 | Ga0451849_0512069 | 3300041505 | Bacteria | 3239 |
| 165 | Ga0451853_0502947 | 3300041512 | Bacteria | 33087 |
| 166 | Ga0495650_0028158 | 3300046471 | Unclassified | 2585 |
| 167 | Ga0495664_0010833 | 3300046477 | Bacteria | 5126 |
| 168 | Ga0495618_0112419 | 3300046514 | Bacteria | 1744 |
| 169 | Ga0495630_0068302 | 3300046517 | Bacteria | 2672 |
| 170 | Ga0495630_0750243 | 3300046517 | Bacteria | 746 |
| 171 | Ga0495652_0252527 | 3300046529 | Bacteria | 1306 |
| 172 | Ga0495652_0649418 | 3300046529 | Bacteria | 715 |
| 173 | Ga0495586_0031212 | 3300046535 | Bacteria | 2852 |
| 174 | Ga0495668_0745138 | 3300046616 | Bacteria | 542 |
| 175 | Ga0495634_0012370 | 3300046642 | Bacteria | 6180 |
| 176 | Ga0495635_0291429 | 3300046663 | Bacteria | 1095 |
| 177 | Ga0495657_0098934 | 3300046675 | Bacteria | 1861 |
| 178 | Ga0495599_0287432 | 3300046678 | Bacteria | 995 |
| 179 | Ga0495604_0505078 | 3300047317 | Bacteria | 784 |
| 180 | Ga0495674_0014701 | 3300047319 | Bacteria | 7325 |
| 181 | Ga0496100_0030613 | 3300048903 | Bacteria | 3340 |
| 182 | Ga0496101_0016313 | 3300048904 | Bacteria | 5015 |
| 183 | Ga0496112_0645010 | 3300048915 | Bacteria | 989 |
| 184 | Ga0496114_0005429 | 3300048917 | Bacteria | 9972 |
| 185 | Ga0496115_0011013 | 3300048918 | Bacteria | 6774 |
| 186 | Ga0501067_0003333 | 3300049583 | Bacteria | 8834 |
| 187 | Ga0501073_0004567 | 3300049589 | Bacteria | 10407 |
| 188 | nmdc:mga08y16_24165_c1 | 3300050511 | Bacteria | 6415 |
| 189 | nmdc:mga0rr50_103288_c1 | 3300050513 | Bacteria | 2243 |
| 190 | nmdc:mga0rr50_42738_c1 | 3300050513 | Bacteria | 3312 |
| 191 | nmdc:mga0rr50_689208_c1 | 3300050513 | Bacteria | 872 |
| 192 | Ga0500635_0231288 | 3300053080 | Bacteria | 723 |
| 193 | Ga0495595_0140257 | 3300053084 | Bacteria | 1186 |
| 194 | Ga0500583_0003177 | 3300053092 | Bacteria | 5110 |
| 195 | Ga0500650_0049616 | 3300053098 | Bacteria | 1948 |
| 196 | Ga0500642_0229785 | 3300053130 | Bacteria | 857 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007076 | Ga0075435_100006400 | Ga0075435_1000064008 | 93 |
| 2 | 3300035171 | Ga0373946_0106663 | Ga0373946_0106663_23_304 | 93 |
| 3 | 3300035172 | Ga0373955_0975012 | Ga0373955_0975012_205_492 | 93 |
| 4 | 3300050513 | nmdc:mga0rr50_42738_c1 | nmdc:mga0rr50_42738_c1_2541_2843 | 93 |
| 5 | 3300028563 | Ga0265319_1159470 | Ga0265319_11594702 | 97 |
| 6 | 3300028577 | Ga0265318_10049087 | Ga0265318_100490872 | 97 |
| 7 | 3300035170 | Ga0373943_0192397 | Ga0373943_0192397_563_892 | 109 |
| 8 | 3300003203 | JGI25406J46586_10244775 | JGI25406J46586_102447751 | 111 |
| 9 | 3300005328 | Ga0070676_10554694 | Ga0070676_105546941 | 111 |
| 10 | 3300005329 | Ga0070683_100154975 | Ga0070683_1001549752 | 111 |
| 11 | 3300005330 | Ga0070690_100005821 | Ga0070690_1000058214 | 111 |
| 12 | 3300005330 | Ga0070690_101732233 | Ga0070690_1017322331 | 111 |
| 13 | 3300005337 | Ga0070682_100176055 | Ga0070682_1001760551 | 111 |
| 14 | 3300005337 | Ga0070682_100214937 | Ga0070682_1002149372 | 111 |
| 15 | 3300005340 | Ga0070689_100093409 | Ga0070689_1000934093 | 111 |
| 16 | 3300005341 | Ga0070691_10510061 | Ga0070691_105100611 | 111 |
| 17 | 3300005343 | Ga0070687_100401776 | Ga0070687_1004017761 | 111 |
| 18 | 3300005345 | Ga0070692_10751341 | Ga0070692_107513412 | 111 |
| 19 | 3300005353 | Ga0070669_100016619 | Ga0070669_1000166191 | 111 |
| 20 | 3300005356 | Ga0070674_100176678 | Ga0070674_1001766782 | 111 |
| 21 | 3300005365 | Ga0070688_100447171 | Ga0070688_1004471711 | 111 |
| 22 | 3300005434 | Ga0070709_10911979 | Ga0070709_109119792 | 111 |
| 23 | 3300005436 | Ga0070713_100225983 | Ga0070713_1002259832 | 111 |
| 24 | 3300005437 | Ga0070710_10017863 | Ga0070710_100178634 | 111 |
| 25 | 3300005438 | Ga0070701_10226042 | Ga0070701_102260422 | 111 |
| 26 | 3300005438 | Ga0070701_10933229 | Ga0070701_109332292 | 111 |
| 27 | 3300005441 | Ga0070700_100011241 | Ga0070700_1000112412 | 111 |
| 28 | 3300005441 | Ga0070700_100243525 | Ga0070700_1002435252 | 111 |
| 29 | 3300005444 | Ga0070694_100276036 | Ga0070694_1002760362 | 111 |
| 30 | 3300005456 | Ga0070678_100007118 | Ga0070678_1000071183 | 111 |
| 31 | 3300005456 | Ga0070678_101271150 | Ga0070678_1012711502 | 111 |
| 32 | 3300005458 | Ga0070681_10447131 | Ga0070681_104471312 | 111 |
| 33 | 3300005458 | Ga0070681_10616885 | Ga0070681_106168852 | 111 |
| 34 | 3300005459 | Ga0068867_100026284 | Ga0068867_1000262841 | 111 |
| 35 | 3300005467 | Ga0070706_100095807 | Ga0070706_1000958073 | 111 |
| 36 | 3300005471 | Ga0070698_100516234 | Ga0070698_1005162341 | 111 |
| 37 | 3300005535 | Ga0070684_100240767 | Ga0070684_1002407673 | 111 |
| 38 | 3300005539 | Ga0068853_100560258 | Ga0068853_1005602581 | 111 |
| 39 | 3300005543 | Ga0070672_100012529 | Ga0070672_1000125292 | 111 |
| 40 | 3300005544 | Ga0070686_100226599 | Ga0070686_1002265992 | 111 |
| 41 | 3300005544 | Ga0070686_101688220 | Ga0070686_1016882201 | 111 |
| 42 | 3300005545 | Ga0070695_100584315 | Ga0070695_1005843151 | 111 |
| 43 | 3300005545 | Ga0070695_101732145 | Ga0070695_1017321451 | 111 |
| 44 | 3300005549 | Ga0070704_101947221 | Ga0070704_1019472211 | 111 |
| 45 | 3300005617 | Ga0068859_102706765 | Ga0068859_1027067651 | 111 |
| 46 | 3300005618 | Ga0068864_101528507 | Ga0068864_1015285071 | 111 |
| 47 | 3300005719 | Ga0068861_100131861 | Ga0068861_1001318613 | 111 |
| 48 | 3300005841 | Ga0068863_100312061 | Ga0068863_1003120612 | 111 |
| 49 | 3300005841 | Ga0068863_100482459 | Ga0068863_1004824591 | 111 |
| 50 | 3300005985 | Ga0081539_10019553 | Ga0081539_100195534 | 111 |
| 51 | 3300006028 | Ga0070717_10470124 | Ga0070717_104701242 | 111 |
| 52 | 3300006175 | Ga0070712_100730633 | Ga0070712_1007306332 | 111 |
| 53 | 3300006237 | Ga0097621_100157813 | Ga0097621_1001578133 | 111 |
| 54 | 3300006237 | Ga0097621_100615609 | Ga0097621_1006156092 | 111 |
| 55 | 3300006358 | Ga0068871_100320492 | Ga0068871_1003204921 | 111 |
| 56 | 3300006358 | Ga0068871_100499346 | Ga0068871_1004993463 | 111 |
| 57 | 3300006852 | Ga0075433_11557120 | Ga0075433_115571201 | 111 |
| 58 | 3300006880 | Ga0075429_100701664 | Ga0075429_1007016641 | 111 |
| 59 | 3300006881 | Ga0068865_100095613 | Ga0068865_1000956133 | 111 |
| 60 | 3300006931 | Ga0097620_102705757 | Ga0097620_1027057571 | 111 |
| 61 | 3300007076 | Ga0075435_100006400 | Ga0075435_1000064002 | 111 |
| 62 | 3300009093 | Ga0105240_10047404 | Ga0105240_100474043 | 111 |
| 63 | 3300009094 | Ga0111539_10048384 | Ga0111539_100483845 | 111 |
| 64 | 3300009147 | Ga0114129_12172739 | Ga0114129_121727391 | 111 |
| 65 | 3300013297 | Ga0157378_10746006 | Ga0157378_107460061 | 111 |
| 66 | 3300013297 | Ga0157378_11078053 | Ga0157378_110780532 | 111 |
| 67 | 3300014325 | Ga0163163_12294503 | Ga0163163_122945031 | 111 |
| 68 | 3300014326 | Ga0157380_11090456 | Ga0157380_110904562 | 111 |
| 69 | 3300014745 | Ga0157377_10722685 | Ga0157377_107226851 | 111 |
| 70 | 3300014969 | Ga0157376_11961083 | Ga0157376_119610832 | 111 |
| 71 | 3300014969 | Ga0157376_12237839 | Ga0157376_122378392 | 111 |
| 72 | 3300025893 | Ga0207682_10577733 | Ga0207682_105777331 | 111 |
| 73 | 3300025901 | Ga0207688_10693756 | Ga0207688_106937562 | 111 |
| 74 | 3300025906 | Ga0207699_10426938 | Ga0207699_104269382 | 111 |
| 75 | 3300025906 | Ga0207699_10718353 | Ga0207699_107183532 | 111 |
| 76 | 3300025907 | Ga0207645_10348504 | Ga0207645_103485042 | 111 |
| 77 | 3300025910 | Ga0207684_10030921 | Ga0207684_100309213 | 111 |
| 78 | 3300025912 | Ga0207707_10286601 | Ga0207707_102866012 | 111 |
| 79 | 3300025913 | Ga0207695_10123837 | Ga0207695_101238372 | 111 |
| 80 | 3300025916 | Ga0207663_11387998 | Ga0207663_113879982 | 111 |
| 81 | 3300025918 | Ga0207662_10381953 | Ga0207662_103819532 | 111 |
| 82 | 3300025923 | Ga0207681_10000285 | Ga0207681_100002859 | 111 |
| 83 | 3300025936 | Ga0207670_10084939 | Ga0207670_100849391 | 111 |
| 84 | 3300025937 | Ga0207669_10353506 | Ga0207669_103535062 | 111 |
| 85 | 3300025940 | Ga0207691_10092549 | Ga0207691_100925494 | 111 |
| 86 | 3300025940 | Ga0207691_10943674 | Ga0207691_109436742 | 111 |
| 87 | 3300025944 | Ga0207661_10132679 | Ga0207661_101326792 | 111 |
| 88 | 3300025944 | Ga0207661_10622950 | Ga0207661_106229502 | 111 |
| 89 | 3300025972 | Ga0207668_10133415 | Ga0207668_101334153 | 111 |
| 90 | 3300026023 | Ga0207677_12206327 | Ga0207677_122063271 | 111 |
| 91 | 3300026041 | Ga0207639_10286856 | Ga0207639_102868562 | 111 |
| 92 | 3300026075 | Ga0207708_10262708 | Ga0207708_102627081 | 111 |
| 93 | 3300026075 | Ga0207708_10913952 | Ga0207708_109139521 | 111 |
| 94 | 3300026088 | Ga0207641_10375765 | Ga0207641_103757651 | 111 |
| 95 | 3300026089 | Ga0207648_10031251 | Ga0207648_100312511 | 111 |
| 96 | 3300026095 | Ga0207676_10254098 | Ga0207676_102540982 | 111 |
| 97 | 3300026095 | Ga0207676_11810895 | Ga0207676_118108951 | 111 |
| 98 | 3300026118 | Ga0207675_100652678 | Ga0207675_1006526782 | 111 |
| 99 | 3300026121 | Ga0207683_10528394 | Ga0207683_105283941 | 111 |
| 100 | 3300027907 | Ga0207428_10082161 | Ga0207428_100821613 | 111 |
| 101 | 3300028556 | Ga0265337_1062816 | Ga0265337_10628162 | 111 |
| 102 | 3300028573 | Ga0265334_10053474 | Ga0265334_100534741 | 111 |
| 103 | 3300028577 | Ga0265318_10000116 | Ga0265318_100001163 | 111 |
| 104 | 3300028666 | Ga0265336_10005380 | Ga0265336_100053805 | 111 |
| 105 | 3300028666 | Ga0265336_10025213 | Ga0265336_100252132 | 111 |
| 106 | 3300028794 | Ga0307515_10020711 | Ga0307515_100207118 | 111 |
| 107 | 3300028800 | Ga0265338_10005710 | Ga0265338_100057109 | 111 |
| 108 | 3300031235 | Ga0265330_10000285 | Ga0265330_100002853 | 111 |
| 109 | 3300031238 | Ga0265332_10000307 | Ga0265332_1000030728 | 111 |
| 110 | 3300031238 | Ga0265332_10045651 | Ga0265332_100456512 | 111 |
| 111 | 3300031239 | Ga0265328_10002419 | Ga0265328_100024196 | 111 |
| 112 | 3300031239 | Ga0265328_10006582 | Ga0265328_100065823 | 111 |
| 113 | 3300031240 | Ga0265320_10000640 | Ga0265320_1000064021 | 111 |
| 114 | 3300031240 | Ga0265320_10001313 | Ga0265320_1000131312 | 111 |
| 115 | 3300031240 | Ga0265320_10002737 | Ga0265320_1000273712 | 111 |
| 116 | 3300031240 | Ga0265320_10140158 | Ga0265320_101401581 | 111 |
| 117 | 3300031242 | Ga0265329_10062736 | Ga0265329_100627361 | 111 |
| 118 | 3300031247 | Ga0265340_10165942 | Ga0265340_101659422 | 111 |
| 119 | 3300031247 | Ga0265340_10175167 | Ga0265340_101751672 | 111 |
| 120 | 3300031249 | Ga0265339_10007251 | Ga0265339_100072517 | 111 |
| 121 | 3300031249 | Ga0265339_10017129 | Ga0265339_100171292 | 111 |
| 122 | 3300031249 | Ga0265339_10104453 | Ga0265339_101044532 | 111 |
| 123 | 3300031250 | Ga0265331_10000027 | Ga0265331_100000273 | 111 |
| 124 | 3300031344 | Ga0265316_10508521 | Ga0265316_105085212 | 111 |
| 125 | 3300031344 | Ga0265316_10998597 | Ga0265316_109985971 | 111 |
| 126 | 3300031507 | Ga0307509_10010924 | Ga0307509_1001092410 | 111 |
| 127 | 3300031507 | Ga0307509_10029412 | Ga0307509_100294126 | 111 |
| 128 | 3300031595 | Ga0265313_10001030 | Ga0265313_100010303 | 111 |
| 129 | 3300031616 | Ga0307508_10034580 | Ga0307508_100345801 | 111 |
| 130 | 3300031711 | Ga0265314_10000333 | Ga0265314_100003333 | 111 |
| 131 | 3300031711 | Ga0265314_10004876 | Ga0265314_1000487610 | 111 |
| 132 | 3300031711 | Ga0265314_10044290 | Ga0265314_100442901 | 111 |
| 133 | 3300031712 | Ga0265342_10000289 | Ga0265342_1000028951 | 111 |
| 134 | 3300031712 | Ga0265342_10004556 | Ga0265342_100045563 | 111 |
| 135 | 3300031712 | Ga0265342_10033943 | Ga0265342_100339433 | 111 |
| 136 | 3300031712 | Ga0265342_10063076 | Ga0265342_100630762 | 111 |
| 137 | 3300032126 | Ga0307415_101303624 | Ga0307415_1013036242 | 111 |
| 138 | 3300035113 | Ga0373936_0000003 | Ga0373936_0000003_129016_129354 | 111 |
| 139 | 3300035113 | Ga0373936_0257297 | Ga0373936_0257297_352_687 | 111 |
| 140 | 3300035118 | Ga0373954_0047033 | Ga0373954_0047033_1583_1918 | 111 |
| 141 | 3300035119 | Ga0373956_0322333 | Ga0373956_0322333_292_627 | 111 |
| 142 | 3300035120 | Ga0373957_0016617 | Ga0373957_0016617_1060_1395 | 111 |
| 143 | 3300035120 | Ga0373957_0274057 | Ga0373957_0274057_288_626 | 111 |
| 144 | 3300035120 | Ga0373957_0521831 | Ga0373957_0521831_67_402 | 111 |
| 145 | 3300035172 | Ga0373955_0015397 | Ga0373955_0015397_367_702 | 111 |
| 146 | 3300035172 | Ga0373955_0038602 | Ga0373955_0038602_1414_1749 | 111 |
| 147 | 3300035172 | Ga0373955_0292864 | Ga0373955_0292864_77_412 | 111 |
| 148 | 3300035172 | Ga0373955_0312733 | Ga0373955_0312733_65_403 | 111 |
| 149 | 3300035241 | Ga0373961_0328924 | Ga0373961_0328924_104_439 | 111 |
| 150 | 3300035724 | Ga0373933_0045273 | Ga0373933_0045273_1513_1854 | 111 |
| 151 | 3300035724 | Ga0373933_0532667 | Ga0373933_0532667_223_561 | 111 |
| 152 | 3300035724 | Ga0373933_0682609 | Ga0373933_0682609_215_550 | 111 |
| 153 | 3300035725 | Ga0373947_0305422 | Ga0373947_0305422_555_890 | 111 |
| 154 | 3300036401 | Ga0373937_0004614 | Ga0373937_0004614_8173_8508 | 111 |
| 155 | 3300036401 | Ga0373937_0080078 | Ga0373937_0080078_1904_2239 | 111 |
| 156 | 3300036401 | Ga0373937_0128047 | Ga0373937_0128047_1908_2246 | 111 |
| 157 | 3300036401 | Ga0373937_1672802 | Ga0373937_1672802_106_441 | 111 |
| 158 | 3300036401 | Ga0373937_1973757 | Ga0373937_1973757_79_414 | 111 |
| 159 | 3300037068 | Ga0373925_0021405 | Ga0373925_0021405_1358_1693 | 111 |
| 160 | 3300037068 | Ga0373925_0054407 | Ga0373925_0054407_1549_1884 | 111 |
| 161 | 3300037068 | Ga0373925_0139713 | Ga0373925_0139713_238_573 | 111 |
| 162 | 3300039437 | Ga0436365_1388533 | Ga0436365_1388533_364_792 | 111 |
| 163 | 3300039438 | Ga0436360_0357999 | Ga0436360_0357999_125_466 | 111 |
| 164 | 3300041491 | Ga0451833_1000729 | Ga0451833_1000729_206_541 | 111 |
| 165 | 3300041503 | Ga0451847_0161601 | Ga0451847_0161601_1182_1517 | 111 |
| 166 | 3300041505 | Ga0451849_0512069 | Ga0451849_0512069_2136_2471 | 111 |
| 167 | 3300041512 | Ga0451853_0502947 | Ga0451853_0502947_27179_27514 | 111 |
| 168 | 3300046471 | Ga0495650_0028158 | Ga0495650_0028158_1610_1948 | 111 |
| 169 | 3300046477 | Ga0495664_0010833 | Ga0495664_0010833_2971_3306 | 111 |
| 170 | 3300046514 | Ga0495618_0112419 | Ga0495618_0112419_304_639 | 111 |
| 171 | 3300046517 | Ga0495630_0068302 | Ga0495630_0068302_710_1045 | 111 |
| 172 | 3300046517 | Ga0495630_0750243 | Ga0495630_0750243_228_563 | 111 |
| 173 | 3300046529 | Ga0495652_0252527 | Ga0495652_0252527_645_980 | 111 |
| 174 | 3300046529 | Ga0495652_0649418 | Ga0495652_0649418_264_599 | 111 |
| 175 | 3300046535 | Ga0495586_0031212 | Ga0495586_0031212_1125_1460 | 111 |
| 176 | 3300046616 | Ga0495668_0745138 | Ga0495668_0745138_182_517 | 111 |
| 177 | 3300046642 | Ga0495634_0012370 | Ga0495634_0012370_293_628 | 111 |
| 178 | 3300046663 | Ga0495635_0291429 | Ga0495635_0291429_639_974 | 111 |
| 179 | 3300046675 | Ga0495657_0098934 | Ga0495657_0098934_13_348 | 111 |
| 180 | 3300046678 | Ga0495599_0287432 | Ga0495599_0287432_465_800 | 111 |
| 181 | 3300047317 | Ga0495604_0505078 | Ga0495604_0505078_199_534 | 111 |
| 182 | 3300047319 | Ga0495674_0014701 | Ga0495674_0014701_2808_3143 | 111 |
| 183 | 3300048903 | Ga0496100_0030613 | Ga0496100_0030613_2752_3093 | 111 |
| 184 | 3300048904 | Ga0496101_0016313 | Ga0496101_0016313_4106_4447 | 111 |
| 185 | 3300048915 | Ga0496112_0645010 | Ga0496112_0645010_298_633 | 111 |
| 186 | 3300048917 | Ga0496114_0005429 | Ga0496114_0005429_9392_9733 | 111 |
| 187 | 3300048918 | Ga0496115_0011013 | Ga0496115_0011013_1138_1479 | 111 |
| 188 | 3300049583 | Ga0501067_0003333 | Ga0501067_0003333_5812_6153 | 111 |
| 189 | 3300049589 | Ga0501073_0004567 | Ga0501073_0004567_103_444 | 111 |
| 190 | 3300050511 | nmdc:mga08y16_24165_c1 | nmdc:mga08y16_24165_c1_4435_4770 | 111 |
| 191 | 3300050513 | nmdc:mga0rr50_103288_c1 | nmdc:mga0rr50_103288_c1_1088_1423 | 111 |
| 192 | 3300050513 | nmdc:mga0rr50_689208_c1 | nmdc:mga0rr50_689208_c1_457_798 | 111 |
| 193 | 3300053080 | Ga0500635_0231288 | Ga0500635_0231288_292_675 | 111 |
| 194 | 3300053084 | Ga0495595_0140257 | Ga0495595_0140257_437_772 | 111 |
| 195 | 3300053092 | Ga0500583_0003177 | Ga0500583_0003177_2819_3157 | 111 |
| 196 | 3300053098 | Ga0500650_0049616 | Ga0500650_0049616_1301_1735 | 111 |
| 197 | 3300053130 | Ga0500642_0229785 | Ga0500642_0229785_42_380 | 111 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7004 | 2 | 111 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.6898 | 2 | 111 |
| 3zo7-assembly1.cif.gz_F | crystal structure of clcfe27a with substrate | 0.6683 | 3 | 111 |
| 3znj-assembly3.cif.gz_9 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.6653 | 3 | 111 |
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.6601 | 3 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7004 | 2 | 111 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6898 | 2 | 111 | 3.30.70.1060 |
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.661 | 3 | 111 | 3.30.70.1060 |
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6262 | 3 | 111 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6108 | 3 | 108 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G6EMT4-F1-model_v4 | YCII-related domain-containing protein | 0.9576 | 1 | 108 |
|
| AF-A0A538PHK1-F1-model_v4 | YCII-related domain-containing protein | 0.9492 | 1 | 111 |
|
| AF-A0A2H0UBW2-F1-model_v4 | YCII-related domain-containing protein | 0.9459 | 1 | 108 |
|
| AF-A0A538PHK1-F1-model_v4 | YCII-related domain-containing protein | 0.941 | 1 | 111 |
|
| AF-A0A1G2SMC4-F1-model_v4 | YCII-related domain-containing protein | 0.9392 | 1 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar