F301536

General Info

Members Datasets Scaffolds Average Seq Length
196 127 194 342

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10151654|Ga0105238_101516542
Length 380
Sequence MVLCGPRLYALDDNRLGGIARPAGYDSHAATGRHAKKELSMIRTAALVSGSCALLIASAGAQAPATHRLEATPSTVAYGYYWSEAKPVLRIASGDIIDVDTLLTSTPNALQQAGVPPEKIQESLRSIVAEVTGDRRGPGGHILTGPVYVEGAQPGDALEVKILSISFPIDYGYNGCNGFVPSNCDRTRRQKILPIDPKTMTSEFAPGIVIPLAPFFGSMGVAPAPELGRVNSSPPGRHAGNLDNRELVAGSTLYIPVFVAGALFEIGDGHAAQGDGEVDLTALETSLRGRLQLTVRKNMALTWPRAETPTDYISMGMDENLEKATTIAIQEMVDFLASAKKLTKHEAYQLVSMAGHVAITQLVDRPAYGVHVKMAKSIFK

Samples

Sample ID Description Type Environment
1 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
2 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.1
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001358 3300002459 Bacteria 5143
2 rootH1_10016962 3300003323 Bacteria 5160
3 Ga0070658_10036068 3300005327 Bacteria 3984
4 Ga0070658_10386351 3300005327 Bacteria 1201
5 Ga0070683_100000003 3300005329 Bacteria 375084
6 Ga0070683_100060880 3300005329 Bacteria 3509
7 Ga0070683_100228660 3300005329 Bacteria 1768
8 Ga0070670_100147035 3300005331 Bacteria 2039
9 Ga0070666_10181603 3300005335 Bacteria 1476
10 Ga0070689_100242133 3300005340 Bacteria 1486
11 Ga0070675_100111336 3300005354 Bacteria 2317
12 Ga0070671_100048541 3300005355 Bacteria 3530
13 Ga0070673_100089505 3300005364 Bacteria 2513
14 Ga0070667_100009733 3300005367 Bacteria 7969
15 Ga0070709_10013534 3300005434 Bacteria 4590
16 Ga0070713_100075467 3300005436 Bacteria 2859
17 Ga0070710_10022384 3300005437 Bacteria 3305
18 Ga0070707_100012403 3300005468 Bacteria 7959
19 Ga0070698_100205856 3300005471 Bacteria 1903
20 Ga0070698_100325049 3300005471 Bacteria 1469
21 Ga0070679_100025078 3300005530 Bacteria 5848
22 Ga0070684_100002780 3300005535 Bacteria 12959
23 Ga0070684_100099705 3300005535 Bacteria 2593
24 Ga0070684_100397652 3300005535 Bacteria 1270
25 Ga0070697_100082201 3300005536 Unclassified 2655
26 Ga0070672_100057564 3300005543 Bacteria 3051
27 Ga0070672_100085919 3300005543 Bacteria 2529
28 Ga0070696_100113440 3300005546 Bacteria 1954
29 Ga0070696_100234678 3300005546 Bacteria 1381
30 Ga0070665_100011679 3300005548 Bacteria 8874
31 Ga0070665_100022072 3300005548 Bacteria 6403
32 Ga0070704_100082234 3300005549 Bacteria 2374
33 Ga0068856_100009292 3300005614 Bacteria 9549
34 Ga0068859_100003285 3300005617 Bacteria 16442
35 Ga0068859_100359069 3300005617 Bacteria 1552
36 Ga0068864_100103880 3300005618 Unclassified 2523
37 Ga0068858_100016215 3300005842 Bacteria 6999
38 Ga0068858_100530558 3300005842 Bacteria 1139
39 Ga0068860_100162694 3300005843 Bacteria 2152
40 Ga0081455_10034597 3300005937 Bacteria 4525
41 Ga0070717_10014378 3300006028 Bacteria 6089
42 Ga0070717_10406843 3300006028 Bacteria 1223
43 Ga0097621_100168025 3300006237 Bacteria 1889
44 Ga0068871_100200648 3300006358 Bacteria 1722
45 Ga0068871_100225499 3300006358 Bacteria 1625
46 Ga0075428_100053611 3300006844 Bacteria 4419
47 Ga0075430_100168711 3300006846 Unclassified 1821
48 Ga0075431_100170589 3300006847 Bacteria 2236
49 Ga0075433_10136688 3300006852 Bacteria 2179
50 Ga0075433_10321088 3300006852 Bacteria 1370
51 Ga0075434_100006789 3300006871 Bacteria 10523
52 Ga0075429_100031558 3300006880 Bacteria 4605
53 Ga0068865_100077233 3300006881 Bacteria 2379
54 Ga0075436_100026809 3300006914 Bacteria 3967
55 Ga0097620_100003285 3300006931 Bacteria 16442
56 Ga0097620_100359065 3300006931 Bacteria 1552
57 Ga0075435_100000786 3300007076 Bacteria 19744
58 Ga0075435_100002651 3300007076 Bacteria 11930
59 Ga0105240_10000008 3300009093 Bacteria 618862
60 Ga0105240_10004773 3300009093 Bacteria 20456
61 Ga0105240_10011373 3300009093 Bacteria 12397
62 Ga0105240_10034436 3300009093 Bacteria 6532
63 Ga0105240_10060468 3300009093 Bacteria 4723
64 Ga0105240_10080959 3300009093 Bacteria 3992
65 Ga0105240_10120127 3300009093 Bacteria 3165
66 Ga0105240_10145444 3300009093 Bacteria 2829
67 Ga0105240_10424830 3300009093 Bacteria 1492
68 Ga0111539_10002591 3300009094 Bacteria 23946
69 Ga0111539_10004648 3300009094 Bacteria 17936
70 Ga0111539_10063198 3300009094 Bacteria 4381
71 Ga0105245_10096572 3300009098 Bacteria 2727
72 Ga0114129_10000291 3300009147 Bacteria 57858
73 Ga0114129_10005127 3300009147 Bacteria 18439
74 Ga0114129_10005647 3300009147 Bacteria 17708
75 Ga0114129_10070008 3300009147 Bacteria 4891
76 Ga0114129_10108681 3300009147 Bacteria 3829
77 Ga0114129_10109350 3300009147 Bacteria 3816
78 Ga0114129_10129854 3300009147 Bacteria 3462
79 Ga0105241_10005109 3300009174 Bacteria 9682
80 Ga0105241_10131705 3300009174 Bacteria 2025
81 Ga0105242_10066896 3300009176 Bacteria 2969
82 Ga0105248_10007081 3300009177 Bacteria 12284
83 Ga0105248_10068858 3300009177 Bacteria 3973
84 Ga0105248_10098998 3300009177 Bacteria 3285
85 Ga0105248_10179287 3300009177 Bacteria 2387
86 Ga0105248_10194483 3300009177 Bacteria 2285
87 Ga0105237_10009008 3300009545 Bacteria 10732
88 Ga0105237_10134412 3300009545 Bacteria 2468
89 Ga0105238_10056141 3300009551 Bacteria 3951
90 Ga0105238_10151654 3300009551 Bacteria 2293
91 Ga0105249_10020617 3300009553 Bacteria 5893
92 Ga0105239_10014759 3300010375 Bacteria 8664
93 Ga0105239_10090229 3300010375 Bacteria 3381
94 Ga0105239_10266591 3300010375 Bacteria 1926
95 Ga0157369_10234768 3300013105 Bacteria 1917
96 Ga0157378_10031722 3300013297 Bacteria 4667
97 Ga0157375_10400065 3300013308 Bacteria 1540
98 Ga0163163_10000023 3300014325 Bacteria 185843
99 Ga0163163_10010894 3300014325 Bacteria 8215
100 Ga0157380_10144424 3300014326 Bacteria 2049
101 Ga0157377_10039978 3300014745 Bacteria 2596
102 Ga0157379_10004572 3300014968 Bacteria 11871
103 Ga0207680_10129723 3300025903 Bacteria 1660
104 Ga0207685_10009334 3300025905 Bacteria 2845
105 Ga0207699_10017834 3300025906 Bacteria 3748
106 Ga0207695_10000488 3300025913 Bacteria 84750
107 Ga0207695_10043169 3300025913 Bacteria 4807
108 Ga0207695_10087655 3300025913 Bacteria 3135
109 Ga0207695_10147880 3300025913 Bacteria 2291
110 Ga0207695_10148732 3300025913 Bacteria 2283
111 Ga0207693_10000334 3300025915 Bacteria 43371
112 Ga0207646_10005698 3300025922 Bacteria 13066
113 Ga0207694_10084743 3300025924 Bacteria 2493
114 Ga0207650_10023934 3300025925 Bacteria 4336
115 Ga0207659_10160519 3300025926 Unclassified 1764
116 Ga0207687_10188848 3300025927 Bacteria 1602
117 Ga0207670_10100560 3300025936 Bacteria 2064
118 Ga0207670_10261918 3300025936 Bacteria 1341
119 Ga0207704_10093962 3300025938 Bacteria 1979
120 Ga0207665_10008777 3300025939 Bacteria 6648
121 Ga0207665_10078653 3300025939 Bacteria 2266
122 Ga0207691_10005924 3300025940 Bacteria 11801
123 Ga0207711_10231605 3300025941 Bacteria 1692
124 Ga0207711_10243238 3300025941 Bacteria 1650
125 Ga0207661_10000014 3300025944 Bacteria 322246
126 Ga0207661_10101437 3300025944 Bacteria 2418
127 Ga0207661_10219127 3300025944 Bacteria 1681
128 Ga0207658_10107771 3300025986 Bacteria 2196
129 Ga0207703_10146424 3300026035 Bacteria 2055
130 Ga0207703_10158857 3300026035 Bacteria 1978
131 Ga0207641_10003644 3300026088 Bacteria 13585
132 Ga0207648_10029480 3300026089 Bacteria 4866
133 Ga0207676_10005453 3300026095 Bacteria 9003
134 Ga0207428_10234781 3300027907 Bacteria 1371
135 Ga0268266_10002771 3300028379 Bacteria 18307
136 Ga0268266_10027716 3300028379 Bacteria 4816
137 Ga0307515_10009675 3300028794 Bacteria 18595
138 Ga0265340_10079041 3300031247 Unclassified 1551
139 Ga0307408_100077273 3300031548 Bacteria 2479
140 Ga0307508_10017030 3300031616 Bacteria 6609
141 Ga0307508_10238360 3300031616 Bacteria 1417
142 Ga0307413_10361664 3300031824 Bacteria 1124
143 Ga0307510_10012467 3300033180 Bacteria 10083
144 Ga0373954_0129133 3300035118 Bacteria 1230
145 Ga0373955_0017695 3300035172 Bacteria 3531
146 Ga0373924_0032297 3300035410 Bacteria 2109
147 Ga0373947_0009002 3300035725 Bacteria 5740
148 Ga0373947_0069995 3300035725 Bacteria 2149
149 Ga0373937_0041975 3300036401 Bacteria 4174
150 Ga0451804_0042174 3300041463 Archaea 1124
151 Ga0439462_0022258 3300042015 Unclassified 1658
152 Ga0466960_0002727 3300044901 Bacteria 6677
153 Ga0451576_0189755 3300045051 Bacteria 2146
154 Ga0466967_0067706 3300045976 Bacteria 3186
155 Ga0495580_0078686 3300046472 Bacteria 2300
156 Ga0495582_0131896 3300046473 Bacteria 1412
157 Ga0495585_0133676 3300046492 Bacteria 1304
158 Ga0495630_0175059 3300046517 Bacteria 1636
159 Ga0495587_0237941 3300046536 Bacteria 1025
160 Ga0495625_0211972 3300046660 Bacteria 1273
161 Ga0495613_0142302 3300046689 Bacteria 1713
162 Ga0495636_0010490 3300047318 Bacteria 3659
163 Ga0495674_0090834 3300047319 Bacteria 2609
164 Ga0495686_0000030 3300047472 Bacteria 365121
165 Ga0495686_0019276 3300047472 Bacteria 4561
166 Ga0495602_0174961 3300048088 Bacteria 1662
167 Ga0496105_0280545 3300048908 Bacteria 1343
168 Ga0496110_0100528 3300048913 Bacteria 2592
169 Ga0496111_0110835 3300048914 Bacteria 2021
170 Ga0496111_0117062 3300048914 Bacteria 1965
171 Ga0496112_0179879 3300048915 Bacteria 2079
172 Ga0496112_0521243 3300048915 Unclassified 1123
173 Ga0496114_0004428 3300048917 Bacteria 10900
174 Ga0496114_0089453 3300048917 Bacteria 2613
175 Ga0496115_0101265 3300048918 Bacteria 2362
176 Ga0501076_0196277 3300049592 Bacteria 1648
177 Ga0501079_0100823 3300049741 Bacteria 2239
178 nmdc:mga05p37_10601_c1 3300050507 Bacteria 10931
179 nmdc:mga05p37_174796_c1 3300050507 Bacteria 2617
180 nmdc:mga05p37_215244_c1 3300050507 Bacteria 2321
181 nmdc:mga05p37_232579_c1 3300050507 Bacteria 2220
182 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
183 nmdc:mga05p37_303088_c1 3300050507 Bacteria 1897
184 nmdc:mga05p37_899_c2 3300050507 Bacteria 30695
185 nmdc:mga09592_104937_c1 3300050508 Unclassified 2422
186 nmdc:mga08y16_181418_c1 3300050511 Bacteria 2186
187 nmdc:mga08y16_183158_c1 3300050511 Bacteria 2174
188 nmdc:mga08y16_5108_c1 3300050511 Bacteria 13711
189 nmdc:mga08y16_7499_c1 3300050511 Bacteria 11423
190 nmdc:mga0n895_10840_c1 3300050512 Bacteria 8089
191 nmdc:mga0rr50_77554_c1 3300050513 Bacteria 2554
192 nmdc:mga08x19_60467_c1 3300050514 Bacteria 2454
193 nmdc:mga0a205_111467_c1 3300050515 Bacteria 2635
194 nmdc:mga0a205_123745_c1 3300050515 Bacteria 2486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10014378 Ga0070717_100143785 296
2 3300044901 Ga0466960_0002727 Ga0466960_0002727_3786_4787 296
3 3300046536 Ga0495587_0237941 Ga0495587_0237941_73_1008 296
4 3300048088 Ga0495602_0174961 Ga0495602_0174961_406_1341 296
5 3300005471 Ga0070698_100205856 Ga0070698_1002058562 305
6 3300046492 Ga0495585_0133676 Ga0495585_0133676_11_1036 322
7 3300031247 Ga0265340_10079041 Ga0265340_100790412 325
8 3300005548 Ga0070665_100022072 Ga0070665_1000220723 327
9 3300009093 Ga0105240_10011373 Ga0105240_1001137311 327
10 3300009553 Ga0105249_10020617 Ga0105249_100206173 327
11 3300010375 Ga0105239_10266591 Ga0105239_102665912 327
12 3300025913 Ga0207695_10000488 Ga0207695_1000048821 327
13 3300025913 Ga0207695_10148732 Ga0207695_101487322 327
14 3300028379 Ga0268266_10002771 Ga0268266_1000277111 327
15 3300005329 Ga0070683_100000003 Ga0070683_10000000365 328
16 3300005329 Ga0070683_100228660 Ga0070683_1002286601 328
17 3300005535 Ga0070684_100002780 Ga0070684_1000027801 328
18 3300009093 Ga0105240_10120127 Ga0105240_101201272 328
19 3300009177 Ga0105248_10179287 Ga0105248_101792872 328
20 3300009545 Ga0105237_10009008 Ga0105237_100090089 328
21 3300010375 Ga0105239_10014759 Ga0105239_100147596 328
22 3300013105 Ga0157369_10234768 Ga0157369_102347682 328
23 3300025941 Ga0207711_10231605 Ga0207711_102316052 328
24 3300025944 Ga0207661_10000014 Ga0207661_1000001462 328
25 3300025944 Ga0207661_10219127 Ga0207661_102191272 328
26 3300033180 Ga0307510_10012467 Ga0307510_100124673 328
27 3300005327 Ga0070658_10036068 Ga0070658_100360682 329
28 3300006844 Ga0075428_100053611 Ga0075428_1000536114 329
29 3300009147 Ga0114129_10000291 Ga0114129_1000029142 329
30 3300031548 Ga0307408_100077273 Ga0307408_1000772732 329
31 3300050507 nmdc:mga05p37_29_c1 nmdc:mga05p37_29_c1_103481_104488 329
32 3300003323 rootH1_10016962 rootH1_100169624 330
33 3300006028 Ga0070717_10406843 Ga0070717_104068432 330
34 3300006880 Ga0075429_100031558 Ga0075429_1000315583 330
35 3300009094 Ga0111539_10002591 Ga0111539_100025918 330
36 3300009177 Ga0105248_10007081 Ga0105248_100070811 330
37 3300014745 Ga0157377_10039978 Ga0157377_100399781 330
38 3300046660 Ga0495625_0211972 Ga0495625_0211972_120_1118 330
39 3300048915 Ga0496112_0521243 Ga0496112_0521243_61_1065 330
40 3300050508 nmdc:mga09592_104937_c1 nmdc:mga09592_104937_c1_441_1445 330
41 3300050511 nmdc:mga08y16_5108_c1 nmdc:mga08y16_5108_c1_6020_7012 330
42 3300005329 Ga0070683_100060880 Ga0070683_1000608802 331
43 3300005471 Ga0070698_100325049 Ga0070698_1003250491 331
44 3300005535 Ga0070684_100099705 Ga0070684_1000997052 331
45 3300009093 Ga0105240_10004773 Ga0105240_100047734 331
46 3300009093 Ga0105240_10060468 Ga0105240_100604682 331
47 3300009545 Ga0105237_10134412 Ga0105237_101344122 331
48 3300009551 Ga0105238_10056141 Ga0105238_100561412 331
49 3300025913 Ga0207695_10043169 Ga0207695_100431692 331
50 3300025913 Ga0207695_10087655 Ga0207695_100876552 331
51 3300025924 Ga0207694_10084743 Ga0207694_100847432 331
52 3300025944 Ga0207661_10101437 Ga0207661_101014372 331
53 3300026035 Ga0207703_10146424 Ga0207703_101464241 331
54 3300006358 Ga0068871_100225499 Ga0068871_1002254991 332
55 3300009093 Ga0105240_10145444 Ga0105240_101454442 332
56 3300025913 Ga0207695_10147880 Ga0207695_101478801 332
57 3300006846 Ga0075430_100168711 Ga0075430_1001687112 333
58 3300006847 Ga0075431_100170589 Ga0075431_1001705892 333
59 3300050507 nmdc:mga05p37_215244_c1 nmdc:mga05p37_215244_c1_626_1636 333
60 3300005354 Ga0070675_100111336 Ga0070675_1001113362 334
61 3300009094 Ga0111539_10004648 Ga0111539_100046482 334
62 3300025926 Ga0207659_10160519 Ga0207659_101605191 334
63 3300025936 Ga0207670_10100560 Ga0207670_101005602 334
64 3300027907 Ga0207428_10234781 Ga0207428_102347812 334
65 3300047472 Ga0495686_0000030 Ga0495686_0000030_87780_88841 334
66 3300050511 nmdc:mga08y16_183158_c1 nmdc:mga08y16_183158_c1_881_1894 334
67 iso_pu_bacteria 2990265787 2990267626 334
68 iso_pu_bacteria 2993693658 2993695138 334
69 3300005548 Ga0070665_100011679 Ga0070665_1000116795 335
70 3300006358 Ga0068871_100200648 Ga0068871_1002006482 335
71 3300006881 Ga0068865_100077233 Ga0068865_1000772332 335
72 3300009093 Ga0105240_10424830 Ga0105240_104248302 335
73 3300009176 Ga0105242_10066896 Ga0105242_100668961 335
74 3300014968 Ga0157379_10004572 Ga0157379_100045725 335
75 3300025938 Ga0207704_10093962 Ga0207704_100939622 335
76 3300028379 Ga0268266_10027716 Ga0268266_100277163 335
77 3300028794 Ga0307515_10009675 Ga0307515_1000967513 335
78 3300048917 Ga0496114_0089453 Ga0496114_0089453_1201_2235 335
79 3300048918 Ga0496115_0101265 Ga0496115_0101265_1120_2154 335
80 3300049741 Ga0501079_0100823 Ga0501079_0100823_65_1072 335
81 3300050515 nmdc:mga0a205_111467_c1 nmdc:mga0a205_111467_c1_1589_2602 335
82 3300005468 Ga0070707_100012403 Ga0070707_1000124034 336
83 3300005546 Ga0070696_100113440 Ga0070696_1001134402 336
84 3300025922 Ga0207646_10005698 Ga0207646_1000569811 336
85 3300009093 Ga0105240_10000008 Ga0105240_10000008444 337
86 3300009147 Ga0114129_10108681 Ga0114129_101086812 337
87 3300009174 Ga0105241_10131705 Ga0105241_101317052 337
88 3300025903 Ga0207680_10129723 Ga0207680_101297232 337
89 3300050507 nmdc:mga05p37_899_c2 nmdc:mga05p37_899_c2_14194_15249 337
90 3300005530 Ga0070679_100025078 Ga0070679_1000250782 338
91 3300009093 Ga0105240_10034436 Ga0105240_100344364 338
92 3300035725 Ga0373947_0009002 Ga0373947_0009002_4682_5704 338
93 3300045976 Ga0466967_0067706 Ga0466967_0067706_1610_2632 338
94 3300046472 Ga0495580_0078686 Ga0495580_0078686_1170_2186 338
95 3300046689 Ga0495613_0142302 Ga0495613_0142302_112_1128 338
96 3300047472 Ga0495686_0019276 Ga0495686_0019276_164_1252 338
97 3300049592 Ga0501076_0196277 Ga0501076_0196277_275_1375 338
98 3300005546 Ga0070696_100234678 Ga0070696_1002346782 339
99 3300005549 Ga0070704_100082234 Ga0070704_1000822342 339
100 3300006237 Ga0097621_100168025 Ga0097621_1001680253 339
101 3300009177 Ga0105248_10098998 Ga0105248_100989982 339
102 3300025939 Ga0207665_10078653 Ga0207665_100786532 339
103 3300031824 Ga0307413_10361664 Ga0307413_103616641 339
104 3300042015 Ga0439462_0022258 Ga0439462_0022258_591_1610 339
105 3300005327 Ga0070658_10386351 Ga0070658_103863511 340
106 3300005331 Ga0070670_100147035 Ga0070670_1001470352 340
107 3300005335 Ga0070666_10181603 Ga0070666_101816032 340
108 3300005543 Ga0070672_100057564 Ga0070672_1000575642 340
109 3300005543 Ga0070672_100085919 Ga0070672_1000859192 340
110 3300009147 Ga0114129_10070008 Ga0114129_100700082 340
111 3300009551 Ga0105238_10151654 Ga0105238_101516542 340
112 3300025925 Ga0207650_10023934 Ga0207650_100239344 340
113 3300025940 Ga0207691_10005924 Ga0207691_100059242 340
114 3300025986 Ga0207658_10107771 Ga0207658_101077712 340
115 3300041463 Ga0451804_0042174 Ga0451804_0042174_22_1071 340
116 3300050507 nmdc:mga05p37_303088_c1 nmdc:mga05p37_303088_c1_827_1855 340
117 3300050511 nmdc:mga08y16_181418_c1 nmdc:mga08y16_181418_c1_23_1051 340
118 3300005340 Ga0070689_100242133 Ga0070689_1002421331 341
119 3300005355 Ga0070671_100048541 Ga0070671_1000485413 341
120 3300005367 Ga0070667_100009733 Ga0070667_1000097332 341
121 3300005434 Ga0070709_10013534 Ga0070709_100135342 341
122 3300005436 Ga0070713_100075467 Ga0070713_1000754673 341
123 3300005437 Ga0070710_10022384 Ga0070710_100223843 341
124 3300005614 Ga0068856_100009292 Ga0068856_1000092925 341
125 3300005617 Ga0068859_100359069 Ga0068859_1003590692 341
126 3300005842 Ga0068858_100016215 Ga0068858_1000162156 341
127 3300005843 Ga0068860_100162694 Ga0068860_1001626943 341
128 3300006931 Ga0097620_100359065 Ga0097620_1003590651 341
129 3300009094 Ga0111539_10063198 Ga0111539_100631983 341
130 3300009098 Ga0105245_10096572 Ga0105245_100965723 341
131 3300009147 Ga0114129_10109350 Ga0114129_101093501 341
132 3300009174 Ga0105241_10005109 Ga0105241_100051095 341
133 3300009177 Ga0105248_10068858 Ga0105248_100688582 341
134 3300009177 Ga0105248_10194483 Ga0105248_101944832 341
135 3300010375 Ga0105239_10090229 Ga0105239_100902293 341
136 3300013297 Ga0157378_10031722 Ga0157378_100317222 341
137 3300013308 Ga0157375_10400065 Ga0157375_104000652 341
138 3300025905 Ga0207685_10009334 Ga0207685_100093343 341
139 3300025906 Ga0207699_10017834 Ga0207699_100178342 341
140 3300025915 Ga0207693_10000334 Ga0207693_100003348 341
141 3300025927 Ga0207687_10188848 Ga0207687_101888482 341
142 3300025939 Ga0207665_10008777 Ga0207665_100087773 341
143 3300025941 Ga0207711_10243238 Ga0207711_102432382 341
144 3300026089 Ga0207648_10029480 Ga0207648_100294803 341
145 3300031616 Ga0307508_10017030 Ga0307508_100170305 341
146 3300031616 Ga0307508_10238360 Ga0307508_102383601 341
147 3300035118 Ga0373954_0129133 Ga0373954_0129133_95_1141 341
148 3300035172 Ga0373955_0017695 Ga0373955_0017695_300_1331 341
149 3300035410 Ga0373924_0032297 Ga0373924_0032297_62_1093 341
150 3300036401 Ga0373937_0041975 Ga0373937_0041975_3053_4084 341
151 3300046473 Ga0495582_0131896 Ga0495582_0131896_359_1390 341
152 3300046517 Ga0495630_0175059 Ga0495630_0175059_127_1152 341
153 3300047319 Ga0495674_0090834 Ga0495674_0090834_1356_2471 341
154 3300048908 Ga0496105_0280545 Ga0496105_0280545_37_1152 341
155 3300048913 Ga0496110_0100528 Ga0496110_0100528_283_1308 341
156 3300048914 Ga0496111_0110835 Ga0496111_0110835_888_2003 341
157 3300048914 Ga0496111_0117062 Ga0496111_0117062_45_1070 341
158 3300048917 Ga0496114_0004428 Ga0496114_0004428_7996_9111 341
159 3300050511 nmdc:mga08y16_7499_c1 nmdc:mga08y16_7499_c1_8555_9601 341
160 3300002459 JGI24751J29686_10001358 JGI24751J29686_100013584 342
161 3300005364 Ga0070673_100089505 Ga0070673_1000895052 342
162 3300005535 Ga0070684_100397652 Ga0070684_1003976521 342
163 3300005536 Ga0070697_100082201 Ga0070697_1000822011 342
164 3300005617 Ga0068859_100003285 Ga0068859_10000328524 342
165 3300005618 Ga0068864_100103880 Ga0068864_1001038804 342
166 3300005842 Ga0068858_100530558 Ga0068858_1005305581 342
167 3300005937 Ga0081455_10034597 Ga0081455_100345974 342
168 3300006852 Ga0075433_10136688 Ga0075433_101366882 342
169 3300006852 Ga0075433_10321088 Ga0075433_103210882 342
170 3300006871 Ga0075434_100006789 Ga0075434_10000678911 342
171 3300006914 Ga0075436_100026809 Ga0075436_1000268093 342
172 3300006931 Ga0097620_100003285 Ga0097620_1000032853 342
173 3300007076 Ga0075435_100000786 Ga0075435_10000078611 342
174 3300007076 Ga0075435_100002651 Ga0075435_1000026515 342
175 3300009093 Ga0105240_10080959 Ga0105240_100809595 342
176 3300009147 Ga0114129_10005127 Ga0114129_1000512717 342
177 3300009147 Ga0114129_10005647 Ga0114129_100056473 342
178 3300009147 Ga0114129_10129854 Ga0114129_101298544 342
179 3300014325 Ga0163163_10000023 Ga0163163_1000002344 342
180 3300014325 Ga0163163_10010894 Ga0163163_100108943 342
181 3300014326 Ga0157380_10144424 Ga0157380_101444241 342
182 3300025936 Ga0207670_10261918 Ga0207670_102619181 342
183 3300026035 Ga0207703_10158857 Ga0207703_101588571 342
184 3300026088 Ga0207641_10003644 Ga0207641_100036443 342
185 3300026095 Ga0207676_10005453 Ga0207676_100054531 342
186 3300035725 Ga0373947_0069995 Ga0373947_0069995_1077_2129 342
187 3300045051 Ga0451576_0189755 Ga0451576_0189755_10_1062 342
188 3300047318 Ga0495636_0010490 Ga0495636_0010490_631_1659 342
189 3300048915 Ga0496112_0179879 Ga0496112_0179879_358_1467 342
190 3300050507 nmdc:mga05p37_10601_c1 nmdc:mga05p37_10601_c1_9138_10181 342
191 3300050507 nmdc:mga05p37_174796_c1 nmdc:mga05p37_174796_c1_66_1094 342
192 3300050507 nmdc:mga05p37_232579_c1 nmdc:mga05p37_232579_c1_269_1312 342
193 3300050512 nmdc:mga0n895_10840_c1 nmdc:mga0n895_10840_c1_4361_5389 342
194 3300050513 nmdc:mga0rr50_77554_c1 nmdc:mga0rr50_77554_c1_784_1812 342
195 3300050514 nmdc:mga08x19_60467_c1 nmdc:mga08x19_60467_c1_1359_2387 342
196 3300050515 nmdc:mga0a205_123745_c1 nmdc:mga0a205_123745_c1_1103_2131 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

136

233

0.89

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

229

380

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4l-assembly1.cif.gz_B crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9301 29 342
2f4l-assembly1.cif.gz_B crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9268 29 342
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9266 29 342
4yft-assembly1.cif.gz_C huab-20bp 0.9228 291 315
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.921 29 342
ID Description Score Start End Superfamily
1s8nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9831 284 315 1.10.10.10
af_P9WGM3_143_205_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9662 287 315 1.10.10.10
af_Q8H1G4_155_289_2.60.120.580 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9574 192 247 2.60.120.580
af_Q4D748_1_97_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9514 291 315 3.40.50.300
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.9307 263 342 3.10.28.20
ID Description Score Start End GO Terms
AF-A0A2V8LIV8-F1-model_v4 Acetamidase 0.9983 206 342 GO:0016811
AF-A0A2V8F291-F1-model_v4 Acetamidase 0.9976 141 342 GO:0016811
AF-A0A1Q8AM77-F1-model_v4 Acetamidase 0.9975 21 342 GO:0016811
AF-A0A2V8BGS7-F1-model_v4 Acetamidase 0.9968 77 342 GO:0016811
AF-A0A2V7ZBG9-F1-model_v4 Acetamidase 0.9967 182 342 GO:0016811

Feature Viewer

pLDDT pTM Quality
93.63 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map