F301249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 196 | 126 | 195 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100238725|Ga0070686_1002387251 |
| Length | 363 |
| Sequence | MSKRIIIAGGGTGGHIFPAIAIAHALKKIDKDCNILFIGAKGKMEMEKVPQAGYEIKGLNISGFNRGSLIKNIGLPFKVLRSLFQVRSIMRKFKPDAVIGVGGYSSFPVLRTAQASGIPNFIHESNSFAGRSNIMLGKKATKIFTGTAGMEKFFPAGKIMVTGNPVRESISSSAVTRPEGIKFFSLEENRKTVLVVGGSLGARSINEAIAHGLDELVDKEGLQLIWQTGKNNSGHPLEKTKNRKGVWVNEFIGQMEFAYAAADIVVARAGAMTVAELCVAEKPVVFVPYPFAAEDHQTANAKQLVEQKAATMIKDSEVKEKLVPALIALAKDVLKQNELKKNIGRLGIKDADRKIAAEIMKLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 104 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 105 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 106 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 107 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 108 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 124 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.49 |
| Metatranscriptomes | 0 |
| Isolates | 0.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 95.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10001202 | 3300003320 | Bacteria | 51390 |
| 2 | rootH2_10011327 | 3300003320 | Bacteria | 6885 |
| 3 | rootL2_10048246 | 3300003322 | Bacteria | 1872 |
| 4 | Ga0065712_10005315 | 3300005290 | Bacteria | 3049 |
| 5 | Ga0065712_10007901 | 3300005290 | Bacteria | 3886 |
| 6 | Ga0065712_10012745 | 3300005290 | Bacteria | 2079 |
| 7 | Ga0070683_100035947 | 3300005329 | Bacteria | 4531 |
| 8 | Ga0070683_100070222 | 3300005329 | Bacteria | 3267 |
| 9 | Ga0070683_100099869 | 3300005329 | Bacteria | 2732 |
| 10 | Ga0070670_100009721 | 3300005331 | Bacteria | 8212 |
| 11 | Ga0070670_100031426 | 3300005331 | Bacteria | 4573 |
| 12 | Ga0070670_100155069 | 3300005331 | Bacteria | 1983 |
| 13 | Ga0068869_100039695 | 3300005334 | Bacteria | 3362 |
| 14 | Ga0070682_100054432 | 3300005337 | Bacteria | 2510 |
| 15 | Ga0070660_100054653 | 3300005339 | Bacteria | 3084 |
| 16 | Ga0070689_100105774 | 3300005340 | Bacteria | 2232 |
| 17 | Ga0070669_100005537 | 3300005353 | Bacteria | 9117 |
| 18 | Ga0070669_100069732 | 3300005353 | Bacteria | 2597 |
| 19 | Ga0070675_100003793 | 3300005354 | Bacteria | 11478 |
| 20 | Ga0070675_100114171 | 3300005354 | Bacteria | 2289 |
| 21 | Ga0070671_100203203 | 3300005355 | Bacteria | 1680 |
| 22 | Ga0070674_100255040 | 3300005356 | Bacteria | 1379 |
| 23 | Ga0070673_100017210 | 3300005364 | Bacteria | 5133 |
| 24 | Ga0070673_100024484 | 3300005364 | Bacteria | 4427 |
| 25 | Ga0070688_100000309 | 3300005365 | Bacteria | 24809 |
| 26 | Ga0070663_100191453 | 3300005455 | Unclassified | 1592 |
| 27 | Ga0070662_100012206 | 3300005457 | Bacteria | 5690 |
| 28 | Ga0068867_100012035 | 3300005459 | Bacteria | 6110 |
| 29 | Ga0068867_100033804 | 3300005459 | Bacteria | 3705 |
| 30 | Ga0070685_10040916 | 3300005466 | Bacteria | 2639 |
| 31 | Ga0070698_100058852 | 3300005471 | Bacteria | 3883 |
| 32 | Ga0070698_100321985 | 3300005471 | Bacteria | 1477 |
| 33 | Ga0070679_100020299 | 3300005530 | Bacteria | 6475 |
| 34 | Ga0070679_100205002 | 3300005530 | Bacteria | 1936 |
| 35 | Ga0070679_100352634 | 3300005530 | Bacteria | 1419 |
| 36 | Ga0070684_100009604 | 3300005535 | Bacteria | 7626 |
| 37 | Ga0070684_100114994 | 3300005535 | Bacteria | 2415 |
| 38 | Ga0068853_100146128 | 3300005539 | Bacteria | 2125 |
| 39 | Ga0068853_100223404 | 3300005539 | Bacteria | 1721 |
| 40 | Ga0070672_100019930 | 3300005543 | Unclassified | 4881 |
| 41 | Ga0070686_100238725 | 3300005544 | Bacteria | 1322 |
| 42 | Ga0068855_100001432 | 3300005563 | Bacteria | 29672 |
| 43 | Ga0070664_100305207 | 3300005564 | Bacteria | 1439 |
| 44 | Ga0068857_100129920 | 3300005577 | Bacteria | 2272 |
| 45 | Ga0068857_100165726 | 3300005577 | Bacteria | 2007 |
| 46 | Ga0068854_100083126 | 3300005578 | Unclassified | 2367 |
| 47 | Ga0068854_100087794 | 3300005578 | Bacteria | 2308 |
| 48 | Ga0068856_100070267 | 3300005614 | Bacteria | 3463 |
| 49 | Ga0068852_100033134 | 3300005616 | Bacteria | 4287 |
| 50 | Ga0068852_100137627 | 3300005616 | Bacteria | 2256 |
| 51 | Ga0068852_100182743 | 3300005616 | Unclassified | 1973 |
| 52 | Ga0068859_100006844 | 3300005617 | Bacteria | 11581 |
| 53 | Ga0068859_100040133 | 3300005617 | Bacteria | 4698 |
| 54 | Ga0068859_100512396 | 3300005617 | Bacteria | 1295 |
| 55 | Ga0068861_100001200 | 3300005719 | Bacteria | 16129 |
| 56 | Ga0068861_100022262 | 3300005719 | Bacteria | 4564 |
| 57 | Ga0068870_10026366 | 3300005840 | Bacteria | 2897 |
| 58 | Ga0068863_100013646 | 3300005841 | Bacteria | 7838 |
| 59 | Ga0068860_100026046 | 3300005843 | Bacteria | 5641 |
| 60 | Ga0068862_100004144 | 3300005844 | Bacteria | 12282 |
| 61 | Ga0068862_100342715 | 3300005844 | Unclassified | 1385 |
| 62 | Ga0081540_1001649 | 3300005983 | Bacteria | 18988 |
| 63 | Ga0081539_10001587 | 3300005985 | Bacteria | 37564 |
| 64 | Ga0081539_10026371 | 3300005985 | Bacteria | 3709 |
| 65 | Ga0097621_100095183 | 3300006237 | Bacteria | 2497 |
| 66 | Ga0097621_100129039 | 3300006237 | Bacteria | 2150 |
| 67 | Ga0097621_100299439 | 3300006237 | Bacteria | 1420 |
| 68 | Ga0068871_100124596 | 3300006358 | Bacteria | 2179 |
| 69 | Ga0068871_100148254 | 3300006358 | Bacteria | 1999 |
| 70 | Ga0075428_100051381 | 3300006844 | Bacteria | 4520 |
| 71 | Ga0068865_100200939 | 3300006881 | Bacteria | 1547 |
| 72 | Ga0097620_100006844 | 3300006931 | Bacteria | 11581 |
| 73 | Ga0097620_100040133 | 3300006931 | Bacteria | 4698 |
| 74 | Ga0097620_100512393 | 3300006931 | Bacteria | 1295 |
| 75 | Ga0105240_10003829 | 3300009093 | Bacteria | 23261 |
| 76 | Ga0105240_10013277 | 3300009093 | Bacteria | 11325 |
| 77 | Ga0111539_10016212 | 3300009094 | Bacteria | 9243 |
| 78 | Ga0114129_10107388 | 3300009147 | Bacteria | 3855 |
| 79 | Ga0105241_10017701 | 3300009174 | Bacteria | 5239 |
| 80 | Ga0105242_10057544 | 3300009176 | Bacteria | 3185 |
| 81 | Ga0105242_10312977 | 3300009176 | Unclassified | 1437 |
| 82 | Ga0105242_10459597 | 3300009176 | Unclassified | 1202 |
| 83 | Ga0105237_10008097 | 3300009545 | Bacteria | 11421 |
| 84 | Ga0105237_10020422 | 3300009545 | Bacteria | 6828 |
| 85 | Ga0105237_10021338 | 3300009545 | Bacteria | 6659 |
| 86 | Ga0105238_10003096 | 3300009551 | Bacteria | 16583 |
| 87 | Ga0105249_10003587 | 3300009553 | Bacteria | 13426 |
| 88 | Ga0105249_10004323 | 3300009553 | Bacteria | 12288 |
| 89 | Ga0105249_10026949 | 3300009553 | Bacteria | 5183 |
| 90 | Ga0105249_10083992 | 3300009553 | Bacteria | 2965 |
| 91 | Ga0105249_10200620 | 3300009553 | Bacteria | 1952 |
| 92 | Ga0105239_10015248 | 3300010375 | Bacteria | 8515 |
| 93 | Ga0157373_10034361 | 3300013100 | Bacteria | 3642 |
| 94 | Ga0157373_10074938 | 3300013100 | Bacteria | 2387 |
| 95 | Ga0157371_10042487 | 3300013102 | Bacteria | 3240 |
| 96 | Ga0157371_10155571 | 3300013102 | Bacteria | 1631 |
| 97 | Ga0157370_10003787 | 3300013104 | Bacteria | 17651 |
| 98 | Ga0157369_10027357 | 3300013105 | Bacteria | 6322 |
| 99 | Ga0157369_10119641 | 3300013105 | Bacteria | 2795 |
| 100 | Ga0157369_10129712 | 3300013105 | Bacteria | 2672 |
| 101 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 102 | Ga0157378_10078366 | 3300013297 | Bacteria | 2980 |
| 103 | Ga0157378_10247314 | 3300013297 | Bacteria | 1706 |
| 104 | Ga0163162_10090697 | 3300013306 | Bacteria | 3138 |
| 105 | Ga0163162_10207208 | 3300013306 | Bacteria | 2090 |
| 106 | Ga0157372_10085345 | 3300013307 | Bacteria | 3580 |
| 107 | Ga0157372_10151763 | 3300013307 | Bacteria | 2674 |
| 108 | Ga0157375_10039405 | 3300013308 | Bacteria | 4548 |
| 109 | Ga0157375_10207663 | 3300013308 | Bacteria | 2115 |
| 110 | Ga0157380_10000709 | 3300014326 | Bacteria | 20825 |
| 111 | Ga0157380_10081660 | 3300014326 | Unclassified | 2645 |
| 112 | Ga0157377_10002380 | 3300014745 | Bacteria | 8297 |
| 113 | Ga0157379_10323025 | 3300014968 | Bacteria | 1409 |
| 114 | Ga0157376_10032939 | 3300014969 | Bacteria | 4167 |
| 115 | Ga0157376_10252623 | 3300014969 | Unclassified | 1647 |
| 116 | Ga0157376_10351492 | 3300014969 | Bacteria | 1411 |
| 117 | Ga0207697_10033889 | 3300025315 | Bacteria | 2090 |
| 118 | Ga0207643_10004866 | 3300025908 | Bacteria | 7197 |
| 119 | Ga0207705_10242684 | 3300025909 | Bacteria | 1373 |
| 120 | Ga0207684_10269225 | 3300025910 | Unclassified | 1470 |
| 121 | Ga0207695_10000282 | 3300025913 | Bacteria | 126242 |
| 122 | Ga0207695_10001411 | 3300025913 | Bacteria | 40483 |
| 123 | Ga0207695_10035895 | 3300025913 | Bacteria | 5367 |
| 124 | Ga0207671_10012912 | 3300025914 | Bacteria | 6686 |
| 125 | Ga0207652_10076379 | 3300025921 | Bacteria | 2921 |
| 126 | Ga0207652_10145618 | 3300025921 | Bacteria | 2120 |
| 127 | Ga0207681_10002847 | 3300025923 | Bacteria | 10943 |
| 128 | Ga0207681_10056691 | 3300025923 | Bacteria | 2673 |
| 129 | Ga0207681_10231701 | 3300025923 | Bacteria | 1434 |
| 130 | Ga0207659_10017376 | 3300025926 | Bacteria | 4699 |
| 131 | Ga0207644_10186001 | 3300025931 | Bacteria | 1631 |
| 132 | Ga0207706_10039214 | 3300025933 | Bacteria | 4199 |
| 133 | Ga0207686_10022146 | 3300025934 | Bacteria | 3657 |
| 134 | Ga0207669_10181898 | 3300025937 | Bacteria | 1508 |
| 135 | Ga0207661_10114737 | 3300025944 | Unclassified | 2284 |
| 136 | Ga0207667_10002943 | 3300025949 | Bacteria | 21138 |
| 137 | Ga0207667_10017869 | 3300025949 | Bacteria | 7971 |
| 138 | Ga0207651_10015271 | 3300025960 | Bacteria | 4458 |
| 139 | Ga0207651_10040541 | 3300025960 | Bacteria | 3082 |
| 140 | Ga0207712_10162065 | 3300025961 | Bacteria | 1739 |
| 141 | Ga0207668_10250016 | 3300025972 | Unclassified | 1439 |
| 142 | Ga0207640_10063593 | 3300025981 | Unclassified | 2453 |
| 143 | Ga0207658_10070772 | 3300025986 | Unclassified | 2640 |
| 144 | Ga0207639_10058668 | 3300026041 | Bacteria | 2961 |
| 145 | Ga0207678_10183817 | 3300026067 | Bacteria | 1785 |
| 146 | Ga0207702_10224926 | 3300026078 | Bacteria | 1750 |
| 147 | Ga0207641_10000549 | 3300026088 | Bacteria | 42051 |
| 148 | Ga0207641_10085438 | 3300026088 | Bacteria | 2749 |
| 149 | Ga0207648_10002577 | 3300026089 | Bacteria | 19412 |
| 150 | Ga0207648_10158279 | 3300026089 | Bacteria | 2000 |
| 151 | Ga0207676_10136992 | 3300026095 | Bacteria | 2090 |
| 152 | Ga0207674_10031145 | 3300026116 | Bacteria | 5605 |
| 153 | Ga0207674_10051902 | 3300026116 | Bacteria | 4183 |
| 154 | Ga0207674_10092813 | 3300026116 | Bacteria | 3008 |
| 155 | Ga0207674_10121654 | 3300026116 | Bacteria | 2577 |
| 156 | Ga0207675_100025046 | 3300026118 | Bacteria | 5553 |
| 157 | Ga0207675_100033021 | 3300026118 | Bacteria | 4822 |
| 158 | Ga0207675_100043761 | 3300026118 | Bacteria | 4182 |
| 159 | Ga0207675_100053923 | 3300026118 | Bacteria | 3751 |
| 160 | Ga0207698_10050455 | 3300026142 | Bacteria | 3174 |
| 161 | Ga0207698_10203840 | 3300026142 | Unclassified | 1774 |
| 162 | Ga0207698_10278432 | 3300026142 | Bacteria | 1546 |
| 163 | Ga0268265_10034372 | 3300028380 | Bacteria | 3694 |
| 164 | Ga0268264_10037024 | 3300028381 | Bacteria | 4021 |
| 165 | Ga0268264_10160860 | 3300028381 | Bacteria | 2022 |
| 166 | Ga0307511_10000228 | 3300030521 | Bacteria | 57237 |
| 167 | Ga0265327_10000099 | 3300031251 | Bacteria | 190474 |
| 168 | Ga0307509_10151521 | 3300031507 | Bacteria | 2233 |
| 169 | Ga0436365_0021153 | 3300039437 | Bacteria | 19582 |
| 170 | Ga0466969_0016272 | 3300044656 | Bacteria | 3895 |
| 171 | Ga0466966_0000054 | 3300044684 | Bacteria | 82352 |
| 172 | Ga0466961_0016792 | 3300044693 | Unclassified | 4706 |
| 173 | Ga0453684_0112658 | 3300044712 | Bacteria | 3302 |
| 174 | Ga0466959_0000012 | 3300045049 | Bacteria | 168961 |
| 175 | Ga0466959_0007579 | 3300045049 | Bacteria | 7628 |
| 176 | Ga0495608_0109464 | 3300046511 | Bacteria | 1777 |
| 177 | Ga0495632_0123025 | 3300046519 | Bacteria | 1211 |
| 178 | Ga0495587_0107156 | 3300046536 | Bacteria | 1607 |
| 179 | Ga0495668_0000114 | 3300046616 | Bacteria | 127503 |
| 180 | Ga0495634_0049003 | 3300046642 | Bacteria | 2842 |
| 181 | Ga0495635_0073976 | 3300046663 | Bacteria | 2334 |
| 182 | Ga0495658_0037375 | 3300046683 | Bacteria | 2683 |
| 183 | Ga0495674_0072951 | 3300047319 | Bacteria | 2960 |
| 184 | Ga0495676_0071233 | 3300047321 | Bacteria | 2673 |
| 185 | Ga0495680_0143866 | 3300047322 | Bacteria | 1743 |
| 186 | Ga0495684_0073811 | 3300047471 | Bacteria | 2592 |
| 187 | Ga0495686_0000128 | 3300047472 | Bacteria | 156223 |
| 188 | Ga0501037_0037806 | 3300049573 | Bacteria | 3559 |
| 189 | Ga0501035_0322330 | 3300049822 | Bacteria | 1298 |
| 190 | Ga0501044_0004615 | 3300049823 | Bacteria | 15414 |
| 191 | Ga0501044_0025223 | 3300049823 | Bacteria | 6304 |
| 192 | Ga0501226_002443 | 3300049853 | Bacteria | 2272 |
| 193 | nmdc:mga05p37_226667_c1 | 3300050507 | Unclassified | 2253 |
| 194 | nmdc:mga08y16_67226_c1 | 3300050511 | Unclassified | 3739 |
| 195 | Ga0500583_0000048 | 3300053092 | Bacteria | 78503 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10323025 | Ga0157379_103230252 | 339 |
| 2 | 3300044712 | Ga0453684_0112658 | Ga0453684_0112658_1726_2802 | 343 |
| 3 | 3300014326 | Ga0157380_10081660 | Ga0157380_100816602 | 344 |
| 4 | 3300046616 | Ga0495668_0000114 | Ga0495668_0000114_84960_86069 | 347 |
| 5 | 3300005844 | Ga0068862_100342715 | Ga0068862_1003427152 | 350 |
| 6 | 3300046519 | Ga0495632_0123025 | Ga0495632_0123025_38_1183 | 350 |
| 7 | 3300053092 | Ga0500583_0000048 | Ga0500583_0000048_70414_71559 | 350 |
| 8 | 3300025972 | Ga0207668_10250016 | Ga0207668_102500162 | 352 |
| 9 | 3300026118 | Ga0207675_100053923 | Ga0207675_1000539232 | 352 |
| 10 | 3300003322 | rootL2_10048246 | rootL2_100482462 | 353 |
| 11 | 3300049823 | Ga0501044_0025223 | Ga0501044_0025223_4266_5354 | 353 |
| 12 | 3300025923 | Ga0207681_10231701 | Ga0207681_102317013 | 354 |
| 13 | 3300005459 | Ga0068867_100033804 | Ga0068867_1000338043 | 355 |
| 14 | 3300005334 | Ga0068869_100039695 | Ga0068869_1000396952 | 356 |
| 15 | 3300005356 | Ga0070674_100255040 | Ga0070674_1002550401 | 356 |
| 16 | 3300005459 | Ga0068867_100012035 | Ga0068867_1000120352 | 356 |
| 17 | 3300025937 | Ga0207669_10181898 | Ga0207669_101818982 | 356 |
| 18 | 3300026089 | Ga0207648_10002577 | Ga0207648_100025777 | 356 |
| 19 | 3300049853 | Ga0501226_002443 | Ga0501226_002443_299_1453 | 357 |
| 20 | 3300005617 | Ga0068859_100006844 | Ga0068859_1000068446 | 358 |
| 21 | 3300006931 | Ga0097620_100006844 | Ga0097620_1000068446 | 358 |
| 22 | 3300025923 | Ga0207681_10056691 | Ga0207681_100566912 | 358 |
| 23 | 3300005985 | Ga0081539_10026371 | Ga0081539_100263712 | 361 |
| 24 | 3300005290 | Ga0065712_10005315 | Ga0065712_100053153 | 362 |
| 25 | 3300005290 | Ga0065712_10012745 | Ga0065712_100127452 | 362 |
| 26 | 3300005329 | Ga0070683_100035947 | Ga0070683_1000359472 | 362 |
| 27 | 3300005337 | Ga0070682_100054432 | Ga0070682_1000544322 | 362 |
| 28 | 3300005339 | Ga0070660_100054653 | Ga0070660_1000546532 | 362 |
| 29 | 3300005353 | Ga0070669_100069732 | Ga0070669_1000697322 | 362 |
| 30 | 3300005354 | Ga0070675_100114171 | Ga0070675_1001141712 | 362 |
| 31 | 3300005355 | Ga0070671_100203203 | Ga0070671_1002032032 | 362 |
| 32 | 3300005364 | Ga0070673_100017210 | Ga0070673_1000172104 | 362 |
| 33 | 3300005466 | Ga0070685_10040916 | Ga0070685_100409162 | 362 |
| 34 | 3300005471 | Ga0070698_100058852 | Ga0070698_1000588524 | 362 |
| 35 | 3300005471 | Ga0070698_100321985 | Ga0070698_1003219851 | 362 |
| 36 | 3300005535 | Ga0070684_100114994 | Ga0070684_1001149942 | 362 |
| 37 | 3300005539 | Ga0068853_100223404 | Ga0068853_1002234042 | 362 |
| 38 | 3300005544 | Ga0070686_100238725 | Ga0070686_1002387251 | 362 |
| 39 | 3300005577 | Ga0068857_100165726 | Ga0068857_1001657262 | 362 |
| 40 | 3300005578 | Ga0068854_100087794 | Ga0068854_1000877942 | 362 |
| 41 | 3300005614 | Ga0068856_100070267 | Ga0068856_1000702672 | 362 |
| 42 | 3300005616 | Ga0068852_100033134 | Ga0068852_1000331342 | 362 |
| 43 | 3300005719 | Ga0068861_100022262 | Ga0068861_1000222623 | 362 |
| 44 | 3300005841 | Ga0068863_100013646 | Ga0068863_1000136462 | 362 |
| 45 | 3300006237 | Ga0097621_100095183 | Ga0097621_1000951832 | 362 |
| 46 | 3300006237 | Ga0097621_100299439 | Ga0097621_1002994392 | 362 |
| 47 | 3300006358 | Ga0068871_100124596 | Ga0068871_1001245962 | 362 |
| 48 | 3300006844 | Ga0075428_100051381 | Ga0075428_1000513813 | 362 |
| 49 | 3300009176 | Ga0105242_10057544 | Ga0105242_100575443 | 362 |
| 50 | 3300009176 | Ga0105242_10312977 | Ga0105242_103129772 | 362 |
| 51 | 3300009176 | Ga0105242_10459597 | Ga0105242_104595971 | 362 |
| 52 | 3300009553 | Ga0105249_10004323 | Ga0105249_100043235 | 362 |
| 53 | 3300009553 | Ga0105249_10083992 | Ga0105249_100839923 | 362 |
| 54 | 3300009553 | Ga0105249_10200620 | Ga0105249_102006201 | 362 |
| 55 | 3300013100 | Ga0157373_10074938 | Ga0157373_100749382 | 362 |
| 56 | 3300013102 | Ga0157371_10155571 | Ga0157371_101555712 | 362 |
| 57 | 3300013104 | Ga0157370_10003787 | Ga0157370_100037875 | 362 |
| 58 | 3300013105 | Ga0157369_10119641 | Ga0157369_101196412 | 362 |
| 59 | 3300013308 | Ga0157375_10207663 | Ga0157375_102076632 | 362 |
| 60 | 3300014969 | Ga0157376_10252623 | Ga0157376_102526232 | 362 |
| 61 | 3300025910 | Ga0207684_10269225 | Ga0207684_102692252 | 362 |
| 62 | 3300025921 | Ga0207652_10076379 | Ga0207652_100763792 | 362 |
| 63 | 3300025931 | Ga0207644_10186001 | Ga0207644_101860012 | 362 |
| 64 | 3300025934 | Ga0207686_10022146 | Ga0207686_100221463 | 362 |
| 65 | 3300025960 | Ga0207651_10040541 | Ga0207651_100405412 | 362 |
| 66 | 3300025961 | Ga0207712_10162065 | Ga0207712_101620652 | 362 |
| 67 | 3300025986 | Ga0207658_10070772 | Ga0207658_100707722 | 362 |
| 68 | 3300026041 | Ga0207639_10058668 | Ga0207639_100586682 | 362 |
| 69 | 3300026078 | Ga0207702_10224926 | Ga0207702_102249262 | 362 |
| 70 | 3300026088 | Ga0207641_10000549 | Ga0207641_1000054938 | 362 |
| 71 | 3300026088 | Ga0207641_10085438 | Ga0207641_100854382 | 362 |
| 72 | 3300026095 | Ga0207676_10136992 | Ga0207676_101369922 | 362 |
| 73 | 3300026116 | Ga0207674_10051902 | Ga0207674_100519023 | 362 |
| 74 | 3300026116 | Ga0207674_10121654 | Ga0207674_101216542 | 362 |
| 75 | 3300026118 | Ga0207675_100025046 | Ga0207675_1000250464 | 362 |
| 76 | 3300026118 | Ga0207675_100043761 | Ga0207675_1000437612 | 362 |
| 77 | 3300026142 | Ga0207698_10050455 | Ga0207698_100504551 | 362 |
| 78 | 3300028381 | Ga0268264_10160860 | Ga0268264_101608602 | 362 |
| 79 | 3300030521 | Ga0307511_10000228 | Ga0307511_1000022842 | 362 |
| 80 | 3300005290 | Ga0065712_10007901 | Ga0065712_100079012 | 363 |
| 81 | 3300005331 | Ga0070670_100009721 | Ga0070670_1000097213 | 363 |
| 82 | 3300005331 | Ga0070670_100031426 | Ga0070670_1000314262 | 363 |
| 83 | 3300005340 | Ga0070689_100105774 | Ga0070689_1001057742 | 363 |
| 84 | 3300005353 | Ga0070669_100005537 | Ga0070669_1000055372 | 363 |
| 85 | 3300005354 | Ga0070675_100003793 | Ga0070675_10000379310 | 363 |
| 86 | 3300005364 | Ga0070673_100024484 | Ga0070673_1000244841 | 363 |
| 87 | 3300005365 | Ga0070688_100000309 | Ga0070688_10000030911 | 363 |
| 88 | 3300005457 | Ga0070662_100012206 | Ga0070662_1000122063 | 363 |
| 89 | 3300005530 | Ga0070679_100020299 | Ga0070679_1000202995 | 363 |
| 90 | 3300005530 | Ga0070679_100205002 | Ga0070679_1002050022 | 363 |
| 91 | 3300005539 | Ga0068853_100146128 | Ga0068853_1001461281 | 363 |
| 92 | 3300005543 | Ga0070672_100019930 | Ga0070672_1000199303 | 363 |
| 93 | 3300005577 | Ga0068857_100129920 | Ga0068857_1001299202 | 363 |
| 94 | 3300005617 | Ga0068859_100040133 | Ga0068859_1000401333 | 363 |
| 95 | 3300005617 | Ga0068859_100512396 | Ga0068859_1005123962 | 363 |
| 96 | 3300005719 | Ga0068861_100001200 | Ga0068861_1000012001 | 363 |
| 97 | 3300005840 | Ga0068870_10026366 | Ga0068870_100263662 | 363 |
| 98 | 3300005843 | Ga0068860_100026046 | Ga0068860_1000260462 | 363 |
| 99 | 3300005844 | Ga0068862_100004144 | Ga0068862_1000041449 | 363 |
| 100 | 3300006881 | Ga0068865_100200939 | Ga0068865_1002009392 | 363 |
| 101 | 3300006931 | Ga0097620_100040133 | Ga0097620_1000401333 | 363 |
| 102 | 3300006931 | Ga0097620_100512393 | Ga0097620_1005123932 | 363 |
| 103 | 3300009093 | Ga0105240_10013277 | Ga0105240_100132775 | 363 |
| 104 | 3300009094 | Ga0111539_10016212 | Ga0111539_100162125 | 363 |
| 105 | 3300009147 | Ga0114129_10107388 | Ga0114129_101073883 | 363 |
| 106 | 3300009174 | Ga0105241_10017701 | Ga0105241_100177013 | 363 |
| 107 | 3300009545 | Ga0105237_10008097 | Ga0105237_100080972 | 363 |
| 108 | 3300009553 | Ga0105249_10003587 | Ga0105249_100035872 | 363 |
| 109 | 3300009553 | Ga0105249_10026949 | Ga0105249_100269493 | 363 |
| 110 | 3300010375 | Ga0105239_10015248 | Ga0105239_100152485 | 363 |
| 111 | 3300013100 | Ga0157373_10034361 | Ga0157373_100343612 | 363 |
| 112 | 3300013102 | Ga0157371_10042487 | Ga0157371_100424872 | 363 |
| 113 | 3300013105 | Ga0157369_10027357 | Ga0157369_100273574 | 363 |
| 114 | 3300013297 | Ga0157378_10247314 | Ga0157378_102473142 | 363 |
| 115 | 3300013308 | Ga0157375_10039405 | Ga0157375_100394052 | 363 |
| 116 | 3300014326 | Ga0157380_10000709 | Ga0157380_100007092 | 363 |
| 117 | 3300014745 | Ga0157377_10002380 | Ga0157377_100023805 | 363 |
| 118 | 3300014969 | Ga0157376_10351492 | Ga0157376_103514922 | 363 |
| 119 | 3300025315 | Ga0207697_10033889 | Ga0207697_100338892 | 363 |
| 120 | 3300025908 | Ga0207643_10004866 | Ga0207643_100048662 | 363 |
| 121 | 3300025913 | Ga0207695_10035895 | Ga0207695_100358954 | 363 |
| 122 | 3300025923 | Ga0207681_10002847 | Ga0207681_100028476 | 363 |
| 123 | 3300025926 | Ga0207659_10017376 | Ga0207659_100173762 | 363 |
| 124 | 3300025933 | Ga0207706_10039214 | Ga0207706_100392142 | 363 |
| 125 | 3300025949 | Ga0207667_10017869 | Ga0207667_100178697 | 363 |
| 126 | 3300025960 | Ga0207651_10015271 | Ga0207651_100152714 | 363 |
| 127 | 3300026116 | Ga0207674_10031145 | Ga0207674_100311452 | 363 |
| 128 | 3300026116 | Ga0207674_10092813 | Ga0207674_100928132 | 363 |
| 129 | 3300026118 | Ga0207675_100033021 | Ga0207675_1000330212 | 363 |
| 130 | 3300028380 | Ga0268265_10034372 | Ga0268265_100343721 | 363 |
| 131 | 3300028381 | Ga0268264_10037024 | Ga0268264_100370242 | 363 |
| 132 | 3300031251 | Ga0265327_10000099 | Ga0265327_10000099136 | 363 |
| 133 | 3300031507 | Ga0307509_10151521 | Ga0307509_101515212 | 363 |
| 134 | 3300046511 | Ga0495608_0109464 | Ga0495608_0109464_235_1356 | 363 |
| 135 | 3300046536 | Ga0495587_0107156 | Ga0495587_0107156_199_1320 | 363 |
| 136 | 3300046642 | Ga0495634_0049003 | Ga0495634_0049003_1146_2267 | 363 |
| 137 | 3300046663 | Ga0495635_0073976 | Ga0495635_0073976_185_1306 | 363 |
| 138 | 3300046683 | Ga0495658_0037375 | Ga0495658_0037375_662_1783 | 363 |
| 139 | 3300047319 | Ga0495674_0072951 | Ga0495674_0072951_1008_2129 | 363 |
| 140 | 3300047321 | Ga0495676_0071233 | Ga0495676_0071233_662_1783 | 363 |
| 141 | 3300047322 | Ga0495680_0143866 | Ga0495680_0143866_642_1733 | 363 |
| 142 | 3300047471 | Ga0495684_0073811 | Ga0495684_0073811_1128_2249 | 363 |
| 143 | 3300047472 | Ga0495686_0000128 | Ga0495686_0000128_121327_122418 | 363 |
| 144 | 3300050507 | nmdc:mga05p37_226667_c1 | nmdc:mga05p37_226667_c1_106_1197 | 363 |
| 145 | 3300050511 | nmdc:mga08y16_67226_c1 | nmdc:mga08y16_67226_c1_406_1497 | 363 |
| 146 | 3300003320 | rootH2_10001202 | rootH2_1000120210 | 364 |
| 147 | 3300003320 | rootH2_10011327 | rootH2_100113275 | 364 |
| 148 | 3300005329 | Ga0070683_100070222 | Ga0070683_1000702222 | 364 |
| 149 | 3300005329 | Ga0070683_100099869 | Ga0070683_1000998692 | 364 |
| 150 | 3300005331 | Ga0070670_100155069 | Ga0070670_1001550692 | 364 |
| 151 | 3300005455 | Ga0070663_100191453 | Ga0070663_1001914532 | 364 |
| 152 | 3300005530 | Ga0070679_100352634 | Ga0070679_1003526342 | 364 |
| 153 | 3300005535 | Ga0070684_100009604 | Ga0070684_1000096044 | 364 |
| 154 | 3300005563 | Ga0068855_100001432 | Ga0068855_1000014327 | 364 |
| 155 | 3300005564 | Ga0070664_100305207 | Ga0070664_1003052072 | 364 |
| 156 | 3300005578 | Ga0068854_100083126 | Ga0068854_1000831262 | 364 |
| 157 | 3300005616 | Ga0068852_100137627 | Ga0068852_1001376272 | 364 |
| 158 | 3300005616 | Ga0068852_100182743 | Ga0068852_1001827432 | 364 |
| 159 | 3300005983 | Ga0081540_1001649 | Ga0081540_10016494 | 364 |
| 160 | 3300005985 | Ga0081539_10001587 | Ga0081539_100015871 | 364 |
| 161 | 3300006237 | Ga0097621_100129039 | Ga0097621_1001290392 | 364 |
| 162 | 3300006358 | Ga0068871_100148254 | Ga0068871_1001482542 | 364 |
| 163 | 3300009093 | Ga0105240_10003829 | Ga0105240_100038293 | 364 |
| 164 | 3300009545 | Ga0105237_10020422 | Ga0105237_100204225 | 364 |
| 165 | 3300009545 | Ga0105237_10021338 | Ga0105237_100213381 | 364 |
| 166 | 3300009551 | Ga0105238_10003096 | Ga0105238_100030969 | 364 |
| 167 | 3300013105 | Ga0157369_10129712 | Ga0157369_101297122 | 364 |
| 168 | 3300013296 | Ga0157374_10000025 | Ga0157374_1000002553 | 364 |
| 169 | 3300013297 | Ga0157378_10078366 | Ga0157378_100783662 | 364 |
| 170 | 3300013306 | Ga0163162_10090697 | Ga0163162_100906972 | 364 |
| 171 | 3300013306 | Ga0163162_10207208 | Ga0163162_102072082 | 364 |
| 172 | 3300013307 | Ga0157372_10085345 | Ga0157372_100853453 | 364 |
| 173 | 3300013307 | Ga0157372_10151763 | Ga0157372_101517632 | 364 |
| 174 | 3300014969 | Ga0157376_10032939 | Ga0157376_100329392 | 364 |
| 175 | 3300025909 | Ga0207705_10242684 | Ga0207705_102426842 | 364 |
| 176 | 3300025913 | Ga0207695_10000282 | Ga0207695_1000028276 | 364 |
| 177 | 3300025913 | Ga0207695_10001411 | Ga0207695_1000141129 | 364 |
| 178 | 3300025914 | Ga0207671_10012912 | Ga0207671_100129122 | 364 |
| 179 | 3300025921 | Ga0207652_10145618 | Ga0207652_101456182 | 364 |
| 180 | 3300025944 | Ga0207661_10114737 | Ga0207661_101147372 | 364 |
| 181 | 3300025949 | Ga0207667_10002943 | Ga0207667_100029433 | 364 |
| 182 | 3300025981 | Ga0207640_10063593 | Ga0207640_100635932 | 364 |
| 183 | 3300026067 | Ga0207678_10183817 | Ga0207678_101838172 | 364 |
| 184 | 3300026089 | Ga0207648_10158279 | Ga0207648_101582792 | 364 |
| 185 | 3300026142 | Ga0207698_10203840 | Ga0207698_102038401 | 364 |
| 186 | 3300026142 | Ga0207698_10278432 | Ga0207698_102784322 | 364 |
| 187 | 3300039437 | Ga0436365_0021153 | Ga0436365_0021153_14676_15836 | 364 |
| 188 | 3300044656 | Ga0466969_0016272 | Ga0466969_0016272_2346_3440 | 364 |
| 189 | 3300044684 | Ga0466966_0000054 | Ga0466966_0000054_17460_18554 | 364 |
| 190 | 3300044693 | Ga0466961_0016792 | Ga0466961_0016792_974_2083 | 364 |
| 191 | 3300045049 | Ga0466959_0000012 | Ga0466959_0000012_88311_89405 | 364 |
| 192 | 3300045049 | Ga0466959_0007579 | Ga0466959_0007579_2697_3806 | 364 |
| 193 | 3300049573 | Ga0501037_0037806 | Ga0501037_0037806_1290_2489 | 364 |
| 194 | 3300049822 | Ga0501035_0322330 | Ga0501035_0322330_32_1189 | 364 |
| 195 | 3300049823 | Ga0501044_0004615 | Ga0501044_0004615_6926_8083 | 364 |
| 196 | iso_pu_bacteria | 2818991444 | 2819589902 | 364 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.8697 | 4 | 360 |
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.8599 | 4 | 360 |
| 1nlm-assembly1.cif.gz_B | crystal structure of murg:glcnac complex | 0.8311 | 3 | 364 |
| 1nlm-assembly1.cif.gz_B | crystal structure of murg:glcnac complex | 0.8289 | 3 | 364 |
| 7d1i-assembly1.cif.gz_A-2 | crystal structure of acinetobacter baumannii murg | 0.8026 | 3 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0N7KD23_242_363_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.927 | 190 | 288 | 3.40.50.2000 |
| af_K7L509_198_322_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9203 | 222 | 344 | 3.40.50.2000 |
| af_P17443_6_162_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9077 | 3 | 166 | 3.40.50.2000 |
| 3s2uA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9062 | 4 | 164 | 3.40.50.2000 |
| af_K7KRG7_39_192_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9061 | 6 | 164 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6A9S4-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9864 | 203 | 363 |
GO:0003677
GO:0006304 GO:0016758 |
| AF-A0A258MD91-F1-model_v4 | Glycosyl transferase family 28 C-terminal domain-containing protein | 0.9835 | 160 | 361 |
GO:0016758
|
| AF-A0A257W761-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9793 | 162 | 363 |
GO:0016758
|
| AF-A0A4Q5TSW4-F1-model_v4 | UDP-N-acetylglucosamine--N-acetylmuramyl-(Pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | 0.9704 | 193 | 364 |
GO:0016758
|
| AF-A0A258MD91-F1-model_v4 | Glycosyl transferase family 28 C-terminal domain-containing protein | 0.9692 | 160 | 361 |
GO:0016758
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar