F301162

General Info

Members Datasets Scaffolds Average Seq Length
196 121 392 247

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100133429|Ga0070711_1001334293
Length 264
Sequence MMVAVSRKFGGRMHWLALMLLNSPQIVFPEGATPHLQLLLRWIHFAAGITWVGLLYFFVLVNAKFLPALDPATRMKVVPLLMPRALWWFRWSSVVTVFAGIWYWMMIVGADARNAQASGGGAIGTFFGIWTIAFVVEMGLLMSPAEALKKGAVFGTAMALVVIAAAWLYLALNAHGWESNRLLAIGIGGGLGWFMLLNVWGIVWRMQKKIIRWTAESAANGTPMPPEAARIAXXXXLAARTNFVLSFPMLLMMAVASHYPIFRS

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.12
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 25.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100133429 3300005439 Unclassified 1852
2 Ga0070683_100028251 3300005329 Bacteria 5068
3 Ga0068868_100083768 3300005338 Bacteria 2560
4 Ga0070660_100369422 3300005339 Bacteria 1183
5 Ga0070709_10067657 3300005434 Bacteria 2294
6 Ga0070709_10472345 3300005434 Unclassified 948
7 Ga0070714_100569498 3300005435 Bacteria 1086
8 Ga0070713_100013602 3300005436 Bacteria 6016
9 Ga0070713_100016244 3300005436 Bacteria 5594
10 Ga0070713_100023341 3300005436 Bacteria 4798
11 Ga0070713_100104573 3300005436 Bacteria 2458
12 Ga0070713_100221255 3300005436 Bacteria 1717
13 Ga0070713_100458246 3300005436 Unclassified 1198
14 Ga0070710_10251485 3300005437 Unclassified 1136
15 Ga0070710_10330922 3300005437 Unclassified 1003
16 Ga0070711_100004488 3300005439 Bacteria 8246
17 Ga0070711_100155471 3300005439 Bacteria 1729
18 Ga0070711_100280579 3300005439 Bacteria 1318
19 Ga0070708_100017790 3300005445 Bacteria 5937
20 Ga0070708_100165860 3300005445 Unclassified 2060
21 Ga0070708_100186611 3300005445 Bacteria 1939
22 Ga0070708_100707750 3300005445 Bacteria 948
23 Ga0070707_100075529 3300005468 Bacteria 3250
24 Ga0070679_100464275 3300005530 Unclassified 1210
25 Ga0070684_100080445 3300005535 Bacteria 2882
26 Ga0070697_100023806 3300005536 Bacteria 4874
27 Ga0070697_100056551 3300005536 Bacteria 3191
28 Ga0068853_100273634 3300005539 Bacteria 1555
29 Ga0068853_100789460 3300005539 Unclassified 909
30 Ga0070696_100100742 3300005546 Bacteria 2070
31 Ga0070693_100042657 3300005547 Bacteria 2557
32 Ga0070693_100050347 3300005547 Bacteria 2380
33 Ga0068855_100028446 3300005563 Bacteria 6687
34 Ga0068857_100133298 3300005577 Bacteria 2242
35 Ga0068854_100017790 3300005578 Bacteria 4762
36 Ga0068856_100112342 3300005614 Bacteria 2722
37 Ga0068852_100030580 3300005616 Unclassified 4435
38 Ga0068851_10080941 3300005834 Bacteria 1696
39 Ga0068858_100615437 3300005842 Bacteria 1054
40 Ga0070717_10002096 3300006028 Bacteria 13983
41 Ga0070717_10011650 3300006028 Bacteria 6688
42 Ga0070717_10076094 3300006028 Bacteria 2809
43 Ga0070717_10139529 3300006028 Bacteria 2090
44 Ga0070717_10212392 3300006028 Bacteria 1699
45 Ga0070717_10557735 3300006028 Unclassified 1038
46 Ga0070715_10078339 3300006163 Unclassified 1494
47 Ga0070716_100148816 3300006173 Unclassified 1503
48 Ga0097621_100161339 3300006237 Unclassified 1927
49 Ga0068871_100038294 3300006358 Bacteria 3828
50 Ga0075434_100057652 3300006871 Bacteria 3860
51 Ga0075434_100149827 3300006871 Bacteria 2353
52 Ga0075434_100447940 3300006871 Bacteria 1312
53 Ga0075436_100115025 3300006914 Bacteria 1879
54 Ga0075436_100172613 3300006914 Bacteria 1527
55 Ga0075435_100154405 3300007076 Unclassified 1931
56 Ga0075435_100280544 3300007076 Bacteria 1422
57 Ga0105240_10087544 3300009093 Bacteria 3814
58 Ga0105240_10166096 3300009093 Bacteria 2618
59 Ga0105240_10795256 3300009093 Bacteria 1025
60 Ga0105245_10001633 3300009098 Bacteria 20408
61 Ga0105245_10070121 3300009098 Bacteria 3180
62 Ga0114129_10338713 3300009147 Unclassified 1995
63 Ga0105241_10075431 3300009174 Bacteria 2628
64 Ga0105241_10141146 3300009174 Bacteria 1961
65 Ga0105242_10047111 3300009176 Plasmid 3499
66 Ga0105239_10260522 3300010375 Bacteria 1949
67 Ga0157369_10000719 3300013105 Bacteria 42572
68 Ga0157369_10034909 3300013105 Bacteria 5516
69 Ga0157374_10178923 3300013296 Unclassified 2071
70 Ga0157374_10487256 3300013296 Bacteria 1236
71 Ga0157378_10032039 3300013297 Bacteria 4643
72 Ga0157372_10001782 3300013307 Bacteria 23374
73 Ga0157372_10044725 3300013307 Bacteria 4908
74 Ga0157372_10453212 3300013307 Bacteria 1495
75 Ga0157372_10519656 3300013307 Bacteria 1388
76 Ga0213873_10011323 3300021358 Unclassified 1906
77 Ga0207692_10061559 3300025898 Bacteria 1945
78 Ga0207699_10073262 3300025906 Unclassified 2100
79 Ga0207699_10098409 3300025906 Bacteria 1850
80 Ga0207699_10160792 3300025906 Bacteria 1495
81 Ga0207699_10181293 3300025906 Bacteria 1416
82 Ga0207699_10352124 3300025906 Unclassified 1040
83 Ga0207684_10340399 3300025910 Unclassified 1292
84 Ga0207654_10302918 3300025911 Unclassified 1087
85 Ga0207695_10034878 3300025913 Bacteria 5464
86 Ga0207695_10078553 3300025913 Bacteria 3348
87 Ga0207693_10014380 3300025915 Bacteria 6365
88 Ga0207693_10073179 3300025915 Bacteria 2683
89 Ga0207693_10075103 3300025915 Bacteria 2647
90 Ga0207663_10027335 3300025916 Bacteria 3324
91 Ga0207652_10169309 3300025921 Bacteria 1960
92 Ga0207646_10223889 3300025922 Bacteria 1699
93 Ga0207694_10179607 3300025924 Bacteria 1716
94 Ga0207687_10001007 3300025927 Bacteria 19122
95 Ga0207687_10176682 3300025927 Bacteria 1651
96 Ga0207700_10016705 3300025928 Bacteria 4884
97 Ga0207700_10039298 3300025928 Bacteria 3443
98 Ga0207700_10557838 3300025928 Unclassified 1017
99 Ga0207664_10180201 3300025929 Bacteria 1813
100 Ga0207664_10237939 3300025929 Unclassified 1585
101 Ga0207665_10006977 3300025939 Bacteria 7477
102 Ga0207661_10033606 3300025944 Plasmid 3982
103 Ga0207661_10105026 3300025944 Bacteria 2379
104 Ga0207667_10051320 3300025949 Bacteria 4349
105 Ga0207702_10047546 3300026078 Bacteria 3616
106 Ga0207702_10326035 3300026078 Unclassified 1464
107 Ga0207674_10091404 3300026116 Bacteria 3033
108 Ga0265338_10008769 3300028800 Bacteria 12224
109 Ga0265762_1018307 3300030760 Unclassified 1278
110 Ga0265332_10011070 3300031238 Unclassified 4009
111 Ga0265325_10009975 3300031241 Bacteria 5522
112 Ga0265340_10012851 3300031247 Bacteria 4414
113 Ga0265339_10001870 3300031249 Bacteria 15480
114 Ga0265331_10032045 3300031250 Bacteria 2607
115 Ga0265316_10068317 3300031344 Bacteria 2746
116 Ga0265316_10068934 3300031344 Unclassified 2730
117 Ga0307408_100022999 3300031548 Bacteria 4242
118 Ga0265313_10028809 3300031595 Bacteria 2881
119 Ga0307412_10342576 3300031911 Bacteria 1197
120 Ga0307416_100593592 3300032002 Bacteria 1186
121 Ga0373926_0000927 3300035083 Bacteria 8468
122 Ga0373926_0002796 3300035083 Bacteria 5568
123 Ga0373923_0058913 3300035111 Unclassified 1627
124 Ga0373936_0030099 3300035113 Bacteria 2141
125 Ga0373936_0047649 3300035113 Unclassified 1729
126 Ga0373945_0060629 3300035116 Bacteria 1411
127 Ga0373956_0033899 3300035119 Bacteria 2247
128 Ga0373956_0080409 3300035119 Unclassified 1495
129 Ga0373943_0006969 3300035170 Bacteria 5071
130 Ga0373946_0245011 3300035171 Unclassified 872
131 Ga0373955_0077655 3300035172 Unclassified 1870
132 Ga0373924_0001655 3300035410 Bacteria 7315
133 Ga0373935_0003822 3300035692 Bacteria 8780
134 Ga0373935_0103148 3300035692 Unclassified 1883
135 Ga0373927_0121025 3300035695 Bacteria 1708
136 Ga0373933_0119457 3300035724 Bacteria 1650
137 Ga0373947_0003756 3300035725 Bacteria 8961
138 Ga0373947_0013140 3300035725 Bacteria 4746
139 Ga0373947_0162976 3300035725 Bacteria 1443
140 Ga0373937_0000225 3300036401 Bacteria 54909
141 Ga0373937_0082137 3300036401 Unclassified 2981
142 Ga0373937_0553334 3300036401 Unclassified 1093
143 Ga0373925_0010901 3300037068 Bacteria 6594
144 Ga0373925_0259106 3300037068 Unclassified 1397
145 Ga0373925_0772136 3300037068 Unclassified 792
146 Ga0436363_1182231 3300039450 Bacteria 7926
147 Ga0436363_1702819 3300039450 Unclassified 1030
148 Ga0436362_0726210 3300039453 Bacteria 14957
149 Ga0451577_0001555 3300042876 Bacteria 30103
150 Ga0453683_0042031 3300044673 Unclassified 2870
151 Ga0453684_0000289 3300044712 Bacteria 215476
152 Ga0451576_0026981 3300045051 Bacteria 6172
153 Ga0451576_0091389 3300045051 Bacteria 3166
154 Ga0451576_0293196 3300045051 Bacteria 1701
155 Ga0466967_0082888 3300045976 Bacteria 2899
156 Ga0466967_0359487 3300045976 Unclassified 1410
157 Ga0495580_0004943 3300046472 Bacteria 11143
158 Ga0495580_0013269 3300046472 Bacteria 6297
159 Ga0495580_0023039 3300046472 Bacteria 4578
160 Ga0495582_0085930 3300046473 Unclassified 1750
161 Ga0495630_0057959 3300046517 Unclassified 2903
162 Ga0495630_0539630 3300046517 Bacteria 894
163 Ga0495652_0053076 3300046529 Bacteria 3456
164 Ga0495665_0045464 3300046531 Bacteria 2332
165 Ga0495667_0067479 3300046559 Bacteria 2337
166 Ga0495656_0071293 3300046615 Bacteria 1544
167 Ga0495657_0283025 3300046675 Unclassified 992
168 Ga0495581_0108860 3300047315 Unclassified 1611
169 Ga0495604_0243198 3300047317 Bacteria 1229
170 Ga0495680_0059279 3300047322 Bacteria 2956
171 Ga0495602_0255058 3300048088 Bacteria 1305
172 Ga0496102_0058450 3300048905 Unclassified 3524
173 Ga0496102_0089080 3300048905 Bacteria 2854
174 Ga0496102_0138526 3300048905 Bacteria 2281
175 Ga0496102_0302556 3300048905 Unclassified 1507
176 Ga0496104_0065736 3300048907 Bacteria 3442
177 Ga0496110_0010298 3300048913 Bacteria 7599
178 Ga0496111_0024152 3300048914 Bacteria 4277
179 Ga0496112_0009847 3300048915 Bacteria 8635
180 Ga0496112_0175374 3300048915 Unclassified 2109
181 Ga0496112_0228533 3300048915 Bacteria 1815
182 Ga0496112_0621861 3300048915 Unclassified 1011
183 Ga0496113_0003838 3300048916 Bacteria 9093
184 Ga0501298_026116 3300049521 Bacteria 1122
185 Ga0501299_023631 3300049522 Bacteria 1142
186 nmdc:mga0n895_2696_c1 3300050512 Bacteria 14014
187 nmdc:mga0n895_404923_c1 3300050512 Bacteria 1380
188 nmdc:mga0rr50_306026_c1 3300050513 Bacteria 1330
189 nmdc:mga0rr50_76768_c1 3300050513 Unclassified 2565
190 nmdc:mga08x19_18814_c1 3300050514 Bacteria 4234
191 nmdc:mga08x19_474412_c1 3300050514 Bacteria 882
192 nmdc:mga08x19_8802_c1 3300050514 Bacteria 6023
193 nmdc:mga0a205_22268_c1 3300050515 Bacteria 6000
194 Ga0495601_0132112 3300053077 Bacteria 1626
195 Ga0495619_0148149 3300053085 Unclassified 1619
196 Ga0501082_0141007 3300060353 Bacteria 2092
197 Ga0070711_100133429
198 Ga0070683_100028251
199 Ga0068868_100083768
200 Ga0070660_100369422
201 Ga0070709_10067657
202 Ga0070709_10472345
203 Ga0070714_100569498
204 Ga0070713_100013602
205 Ga0070713_100016244
206 Ga0070713_100023341
207 Ga0070713_100104573
208 Ga0070713_100221255
209 Ga0070713_100458246
210 Ga0070710_10251485
211 Ga0070710_10330922
212 Ga0070711_100004488
213 Ga0070711_100155471
214 Ga0070711_100280579
215 Ga0070708_100017790
216 Ga0070708_100165860
217 Ga0070708_100186611
218 Ga0070708_100707750
219 Ga0070707_100075529
220 Ga0070679_100464275
221 Ga0070684_100080445
222 Ga0070697_100023806
223 Ga0070697_100056551
224 Ga0068853_100273634
225 Ga0068853_100789460
226 Ga0070696_100100742
227 Ga0070693_100042657
228 Ga0070693_100050347
229 Ga0068855_100028446
230 Ga0068857_100133298
231 Ga0068854_100017790
232 Ga0068856_100112342
233 Ga0068852_100030580
234 Ga0068851_10080941
235 Ga0068858_100615437
236 Ga0070717_10002096
237 Ga0070717_10011650
238 Ga0070717_10076094
239 Ga0070717_10139529
240 Ga0070717_10212392
241 Ga0070717_10557735
242 Ga0070715_10078339
243 Ga0070716_100148816
244 Ga0097621_100161339
245 Ga0068871_100038294
246 Ga0075434_100057652
247 Ga0075434_100149827
248 Ga0075434_100447940
249 Ga0075436_100115025
250 Ga0075436_100172613
251 Ga0075435_100154405
252 Ga0075435_100280544
253 Ga0105240_10087544
254 Ga0105240_10166096
255 Ga0105240_10795256
256 Ga0105245_10001633
257 Ga0105245_10070121
258 Ga0114129_10338713
259 Ga0105241_10075431
260 Ga0105241_10141146
261 Ga0105242_10047111
262 Ga0105239_10260522
263 Ga0157369_10000719
264 Ga0157369_10034909
265 Ga0157374_10178923
266 Ga0157374_10487256
267 Ga0157378_10032039
268 Ga0157372_10001782
269 Ga0157372_10044725
270 Ga0157372_10453212
271 Ga0157372_10519656
272 Ga0213873_10011323
273 Ga0207692_10061559
274 Ga0207699_10073262
275 Ga0207699_10098409
276 Ga0207699_10160792
277 Ga0207699_10181293
278 Ga0207699_10352124
279 Ga0207684_10340399
280 Ga0207654_10302918
281 Ga0207695_10034878
282 Ga0207695_10078553
283 Ga0207693_10014380
284 Ga0207693_10073179
285 Ga0207693_10075103
286 Ga0207663_10027335
287 Ga0207652_10169309
288 Ga0207646_10223889
289 Ga0207694_10179607
290 Ga0207687_10001007
291 Ga0207687_10176682
292 Ga0207700_10016705
293 Ga0207700_10039298
294 Ga0207700_10557838
295 Ga0207664_10180201
296 Ga0207664_10237939
297 Ga0207665_10006977
298 Ga0207661_10033606
299 Ga0207661_10105026
300 Ga0207667_10051320
301 Ga0207702_10047546
302 Ga0207702_10326035
303 Ga0207674_10091404
304 Ga0265338_10008769
305 Ga0265762_1018307
306 Ga0265332_10011070
307 Ga0265325_10009975
308 Ga0265340_10012851
309 Ga0265339_10001870
310 Ga0265331_10032045
311 Ga0265316_10068317
312 Ga0265316_10068934
313 Ga0307408_100022999
314 Ga0265313_10028809
315 Ga0307412_10342576
316 Ga0307416_100593592
317 Ga0373926_0000927
318 Ga0373926_0002796
319 Ga0373923_0058913
320 Ga0373936_0030099
321 Ga0373936_0047649
322 Ga0373945_0060629
323 Ga0373956_0033899
324 Ga0373956_0080409
325 Ga0373943_0006969
326 Ga0373946_0245011
327 Ga0373955_0077655
328 Ga0373924_0001655
329 Ga0373935_0003822
330 Ga0373935_0103148
331 Ga0373927_0121025
332 Ga0373933_0119457
333 Ga0373947_0003756
334 Ga0373947_0013140
335 Ga0373947_0162976
336 Ga0373937_0000225
337 Ga0373937_0082137
338 Ga0373937_0553334
339 Ga0373925_0010901
340 Ga0373925_0259106
341 Ga0373925_0772136
342 Ga0436363_1182231
343 Ga0436363_1702819
344 Ga0436362_0726210
345 Ga0451577_0001555
346 Ga0453683_0042031
347 Ga0453684_0000289
348 Ga0451576_0026981
349 Ga0451576_0091389
350 Ga0451576_0293196
351 Ga0466967_0082888
352 Ga0466967_0359487
353 Ga0495580_0004943
354 Ga0495580_0013269
355 Ga0495580_0023039
356 Ga0495582_0085930
357 Ga0495630_0057959
358 Ga0495630_0539630
359 Ga0495652_0053076
360 Ga0495665_0045464
361 Ga0495667_0067479
362 Ga0495656_0071293
363 Ga0495657_0283025
364 Ga0495581_0108860
365 Ga0495604_0243198
366 Ga0495680_0059279
367 Ga0495602_0255058
368 Ga0496102_0058450
369 Ga0496102_0089080
370 Ga0496102_0138526
371 Ga0496102_0302556
372 Ga0496104_0065736
373 Ga0496110_0010298
374 Ga0496111_0024152
375 Ga0496112_0009847
376 Ga0496112_0175374
377 Ga0496112_0228533
378 Ga0496112_0621861
379 Ga0496113_0003838
380 Ga0501298_026116
381 Ga0501299_023631
382 nmdc:mga0n895_2696_c1
383 nmdc:mga0n895_404923_c1
384 nmdc:mga0rr50_306026_c1
385 nmdc:mga0rr50_76768_c1
386 nmdc:mga08x19_18814_c1
387 nmdc:mga08x19_474412_c1
388 nmdc:mga08x19_8802_c1
389 nmdc:mga0a205_22268_c1
390 Ga0495601_0132112
391 Ga0495619_0148149
392 Ga0501082_0141007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

71

264

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u3f-assembly2.cif.gz_B structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4904 110 252
3u3f-assembly2.cif.gz_B structural basis for the interaction of pyk2 pat domain with paxillin ld motifs 0.4783 110 252
4p79-assembly1.cif.gz_A crystal structure of mouse claudin-15 0.4645 108 242
7vvz-assembly1.cif.gz_V nua4 bound to the nucleosome 0.4442 169 247
3ir5-assembly1.cif.gz_C crystal structure of narghi mutant narg-h49c 0.4373 11 244
ID Description Score Start End Superfamily
af_Q8IIU4_1_132_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5127 110 245 1.20.140.150
af_Q54VP1_5_119_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.505 85 197 1.20.140.150
af_E9QFU3_39_397_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4941 169 247 1.20.1070.10
af_Q8IIU4_1_132_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4914 110 245 1.20.140.150
af_Q54VP1_5_119_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4828 85 197 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V9YC52-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9803 27 241 GO:0016020
AF-A0A2V9YC52-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9713 27 241 GO:0016020
AF-A0A7V8NWJ0-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9649 24 248 GO:0016020
AF-A0A2V8YD32-F1-model_v4 Uncharacterized protein 0.9614 26 248 GO:0016020
AF-A0A2V9WWF0-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9536 55 252 GO:0016020

Map