F301034

General Info

Members Datasets Scaffolds Average Seq Length
196 147 195 352

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100117510|Ga0070683_1001175102
Length 371
Sequence MSETTPIVTSEMERPTELPGTYPARAYAAKSATSGLAGSSIPRRNLQPQDIQIEILYCGVCHSDLHQVRDEWKSAAPTVYPCVPGHEIVGRVVKAGSAVRKFKEDELAAVGCMVGSCGVCANCRDGLEQYCDKFPVLTYNGQDKVLGGVTYGGYSESIVVDEAFALRVSDQLDPAGTAPLLCAGITTYSPLRHWNVRKGQKVGVVGLGGLGHMALKFANAFGAHVVLFTTSPNKAADALRLGAHEVVISKNEAEMRKHAGSFDFILDAVSADHDFNAYLSLLKRDGTLTLVGVPPNPVSVPAFGLIMGRRQLAGSAIGGIQETQEMLDFCAEKGITADIELIRIQQINEAYERMLKGDVKYRFVIDMASLK

Samples

Sample ID Description Type Environment
1 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.02
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.08
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 3.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000134 3300000545 Bacteria 13053
2 rootH1_10001236 3300003323 Bacteria 21179
3 Ga0070658_10238191 3300005327 Bacteria 1542
4 Ga0070683_100082886 3300005329 Bacteria 3004
5 Ga0070683_100117510 3300005329 Bacteria 2511
6 Ga0068868_100023901 3300005338 Bacteria 4631
7 Ga0070668_100000827 3300005347 Bacteria 21352
8 Ga0070673_100130207 3300005364 Bacteria 2110
9 Ga0070709_10084441 3300005434 Bacteria 2080
10 Ga0070709_10089565 3300005434 Bacteria 2026
11 Ga0070714_100326902 3300005435 Bacteria 1435
12 Ga0070713_100068694 3300005436 Bacteria 2986
13 Ga0070713_100142976 3300005436 Bacteria 2121
14 Ga0070711_100002332 3300005439 Bacteria 10785
15 Ga0070700_100116489 3300005441 Bacteria 1784
16 Ga0070708_100005146 3300005445 Bacteria 10353
17 Ga0070708_100007264 3300005445 Bacteria 8856
18 Ga0070708_100048377 3300005445 Bacteria 3758
19 Ga0070708_100125088 3300005445 Bacteria 2375
20 Ga0070681_10248694 3300005458 Bacteria 1691
21 Ga0070706_100033699 3300005467 Bacteria 4728
22 Ga0070707_100001189 3300005468 Bacteria 25625
23 Ga0070707_100003636 3300005468 Bacteria 14540
24 Ga0070707_100015721 3300005468 Bacteria 7105
25 Ga0070707_100082602 3300005468 Bacteria 3103
26 Ga0070707_100171159 3300005468 Bacteria 2116
27 Ga0070707_100193472 3300005468 Bacteria 1983
28 Ga0070707_100195584 3300005468 Bacteria 1971
29 Ga0070707_100308070 3300005468 Bacteria 1539
30 Ga0070698_100011394 3300005471 Bacteria 9435
31 Ga0070698_100184371 3300005471 Bacteria 2025
32 Ga0070699_100005153 3300005518 Bacteria 11495
33 Ga0070699_100021400 3300005518 Bacteria 5578
34 Ga0070679_100022053 3300005530 Bacteria 6220
35 Ga0070684_100150299 3300005535 Bacteria 2109
36 Ga0070697_100017787 3300005536 Bacteria 5597
37 Ga0070697_100067099 3300005536 Bacteria 2934
38 Ga0070672_100005916 3300005543 Bacteria 8159
39 Ga0070695_100064960 3300005545 Bacteria 2375
40 Ga0070665_100210298 3300005548 Bacteria 1946
41 Ga0070704_100024055 3300005549 Bacteria 3991
42 Ga0068856_100019723 3300005614 Bacteria 6544
43 Ga0068852_100049466 3300005616 Bacteria 3597
44 Ga0068859_100047676 3300005617 Bacteria 4305
45 Ga0068861_100062098 3300005719 Bacteria 2869
46 Ga0068861_100079740 3300005719 Bacteria 2560
47 Ga0068851_10037990 3300005834 Bacteria 2414
48 Ga0068863_100002324 3300005841 Bacteria 18900
49 Ga0068858_100182885 3300005842 Bacteria 1980
50 Ga0068860_100003071 3300005843 Bacteria 17254
51 Ga0068860_100205651 3300005843 Bacteria 1909
52 Ga0068862_100026482 3300005844 Bacteria 4874
53 Ga0070717_10015641 3300006028 Bacteria 5864
54 Ga0070717_10065052 3300006028 Bacteria 3030
55 Ga0070717_10089729 3300006028 Bacteria 2593
56 Ga0070717_10091002 3300006028 Bacteria 2575
57 Ga0070712_100085290 3300006175 Bacteria 2299
58 Ga0070712_100087291 3300006175 Bacteria 2275
59 Ga0097621_100038256 3300006237 Bacteria 3850
60 Ga0068871_100083343 3300006358 Bacteria 2652
61 Ga0075433_10281548 3300006852 Bacteria 1473
62 Ga0075434_100004374 3300006871 Bacteria 12722
63 Ga0097620_100047677 3300006931 Bacteria 4305
64 Ga0075435_100198479 3300007076 Bacteria 1700
65 Ga0105240_10038749 3300009093 Bacteria 6111
66 Ga0111539_10003380 3300009094 Bacteria 21049
67 Ga0105245_10188243 3300009098 Bacteria 1976
68 Ga0105245_10379012 3300009098 Bacteria 1408
69 Ga0114129_10384394 3300009147 Bacteria 1853
70 Ga0105241_10065021 3300009174 Bacteria 2818
71 Ga0105248_10162978 3300009177 Bacteria 2514
72 Ga0105248_10482205 3300009177 Bacteria 1398
73 Ga0105237_10041966 3300009545 Bacteria 4613
74 Ga0105238_10041874 3300009551 Bacteria 4639
75 Ga0099796_10021196 3300010159 Bacteria 1998
76 Ga0105239_10218797 3300010375 Bacteria 2135
77 Ga0157373_10014275 3300013100 Bacteria 5825
78 Ga0157370_10034737 3300013104 Bacteria 4906
79 Ga0157374_10038015 3300013296 Bacteria 4422
80 Ga0157378_10001669 3300013297 Bacteria 20038
81 Ga0163162_10024234 3300013306 Bacteria 5990
82 Ga0163162_10029780 3300013306 Bacteria 5404
83 Ga0157372_10002305 3300013307 Bacteria 20711
84 Ga0157372_10009623 3300013307 Bacteria 10272
85 Ga0157375_10538662 3300013308 Bacteria 1330
86 Ga0157376_10000014 3300014969 Bacteria 303001
87 Ga0182006_1046008 3300015261 Bacteria 1696
88 Ga0182007_10018989 3300015262 Bacteria 2479
89 Ga0206349_1928890 3300020075 Bacteria 1179
90 Ga0207642_10048578 3300025899 Bacteria 1903
91 Ga0207684_10000932 3300025910 Bacteria 33029
92 Ga0207684_10024072 3300025910 Bacteria 5195
93 Ga0207684_10048747 3300025910 Bacteria 3593
94 Ga0207707_10135193 3300025912 Bacteria 2156
95 Ga0207695_10013142 3300025913 Bacteria 9883
96 Ga0207693_10083128 3300025915 Bacteria 2508
97 Ga0207663_10025834 3300025916 Bacteria 3402
98 Ga0207652_10153415 3300025921 Bacteria 2063
99 Ga0207646_10000335 3300025922 Bacteria 63591
100 Ga0207646_10000594 3300025922 Bacteria 47141
101 Ga0207646_10010343 3300025922 Bacteria 9126
102 Ga0207646_10090917 3300025922 Bacteria 2732
103 Ga0207646_10098220 3300025922 Bacteria 2624
104 Ga0207646_10296271 3300025922 Bacteria 1461
105 Ga0207694_10032445 3300025924 Bacteria 3998
106 Ga0207700_10149721 3300025928 Bacteria 1927
107 Ga0207700_10302942 3300025928 Bacteria 1381
108 Ga0207700_10361151 3300025928 Bacteria 1266
109 Ga0207664_10105796 3300025929 Bacteria 2332
110 Ga0207665_10050557 3300025939 Bacteria 2795
111 Ga0207691_10003626 3300025940 Bacteria 14989
112 Ga0207691_10032370 3300025940 Bacteria 4875
113 Ga0207711_10178674 3300025941 Bacteria 1929
114 Ga0207661_10025481 3300025944 Bacteria 4496
115 Ga0207651_10058575 3300025960 Bacteria 2663
116 Ga0207677_10056023 3300026023 Bacteria 2698
117 Ga0207639_10158757 3300026041 Bacteria 1903
118 Ga0207678_10172489 3300026067 Bacteria 1847
119 Ga0207641_10018923 3300026088 Bacteria 5649
120 Ga0207648_10236168 3300026089 Bacteria 1627
121 Ga0207675_100122882 3300026118 Bacteria 2458
122 Ga0209998_10019277 3300027717 Bacteria 1452
123 Ga0207428_10027424 3300027907 Bacteria 4740
124 Ga0268266_10000072 3300028379 Bacteria 232245
125 Ga0268266_10110372 3300028379 Bacteria 2437
126 Ga0268265_10108382 3300028380 Bacteria 2261
127 Ga0268264_10110885 3300028381 Bacteria 2403
128 Ga0268264_10425495 3300028381 Bacteria 1281
129 Ga0265760_10003696 3300031090 Bacteria 4434
130 Ga0265340_10000414 3300031247 Bacteria 22882
131 Ga0307405_10007924 3300031731 Bacteria 5354
132 Ga0307413_10057285 3300031824 Bacteria 2382
133 Ga0307410_10061233 3300031852 Bacteria 2575
134 Ga0307407_10083632 3300031903 Bacteria 1937
135 Ga0307416_100061193 3300032002 Bacteria 3071
136 Ga0373934_0018312 3300035086 Bacteria 2679
137 Ga0373936_0014823 3300035113 Bacteria 2984
138 Ga0373956_0028213 3300035119 Bacteria 2441
139 Ga0373957_0011895 3300035120 Bacteria 2916
140 Ga0373955_0003930 3300035172 Bacteria 6553
141 Ga0373931_0029505 3300035691 Bacteria 2817
142 Ga0373935_0199395 3300035692 Bacteria 1382
143 Ga0373927_0016231 3300035695 Bacteria 4914
144 Ga0373927_0046684 3300035695 Bacteria 2802
145 Ga0373933_0004227 3300035724 Bacteria 7912
146 Ga0373937_0000506 3300036401 Bacteria 35587
147 Ga0373937_0042581 3300036401 Bacteria 4143
148 Ga0373925_0007794 3300037068 Bacteria 7796
149 Ga0373925_0050923 3300037068 Bacteria 3090
150 Ga0395900_0442020 3300037418 Bacteria 1258
151 Ga0436365_0037930 3300039437 Unclassified 3898
152 Ga0436365_0597857 3300039437 Bacteria 1229
153 Ga0436365_1378329 3300039437 Bacteria 6698
154 Ga0466958_0189875 3300045836 Bacteria 1306
155 Ga0466967_0341219 3300045976 Bacteria 1449
156 Ga0495592_0062007 3300046454 Bacteria 2747
157 Ga0495603_0074902 3300046455 Bacteria 1987
158 Ga0495580_0002826 3300046472 Bacteria 14924
159 Ga0495580_0062544 3300046472 Bacteria 2611
160 Ga0495582_0000738 3300046473 Bacteria 18063
161 Ga0495608_0137122 3300046511 Bacteria 1563
162 Ga0495665_0122465 3300046531 Bacteria 1362
163 Ga0495587_0007139 3300046536 Bacteria 7249
164 Ga0495645_0030539 3300046543 Bacteria 3924
165 Ga0495599_0136086 3300046678 Bacteria 1525
166 Ga0495623_0012480 3300046679 Bacteria 5498
167 Ga0495600_0106577 3300046809 Bacteria 1826
168 Ga0495604_0002408 3300047317 Bacteria 14975
169 Ga0495604_0047038 3300047317 Bacteria 3362
170 Ga0495675_0206127 3300047444 Bacteria 1195
171 Ga0495686_0002562 3300047472 Bacteria 16961
172 Ga0495602_0005050 3300048088 Bacteria 13818
173 Ga0496102_0006095 3300048905 Bacteria 10280
174 Ga0496102_0387047 3300048905 Bacteria 1316
175 Ga0496104_0357547 3300048907 Bacteria 1373
176 Ga0496112_0061259 3300048915 Bacteria 3709
177 Ga0496112_0081575 3300048915 Bacteria 3199
178 Ga0496114_0119429 3300048917 Bacteria 2266
179 Ga0496115_0046227 3300048918 Bacteria 3478
180 Ga0496115_0355057 3300048918 Bacteria 1195
181 Ga0496116_0079392 3300048919 Bacteria 2042
182 Ga0496124_0187025 3300048927 Bacteria 1589
183 Ga0501034_0063829 3300049571 Bacteria 3697
184 Ga0501047_0029503 3300049581 Bacteria 5288
185 Ga0501047_0163624 3300049581 Unclassified 2096
186 Ga0501035_0074547 3300049822 Bacteria 3002
187 Ga0501044_0010834 3300049823 Bacteria 9891
188 nmdc:mga05p37_206273_c1 3300050507 Bacteria 2377
189 nmdc:mga06r32_283669_c1 3300050510 Bacteria 1643
190 nmdc:mga08y16_2032_c1 3300050511 Bacteria 20723
191 nmdc:mga0n895_11593_c1 3300050512 Bacteria 7875
192 nmdc:mga0rr50_153549_c1 3300050513 Bacteria 1863
193 nmdc:mga0a205_152427_c1 3300050515 Bacteria 2210
194 Ga0495619_0191624 3300053085 Bacteria 1415
195 Ga0501084_0012992 3300054114 Bacteria 6892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0341219 Ga0466967_0341219_507_1424 289
2 3300050510 nmdc:mga06r32_283669_c1 nmdc:mga06r32_283669_c1_719_1633 290
3 3300005445 Ga0070708_100005146 Ga0070708_1000051467 301
4 3300005468 Ga0070707_100193472 Ga0070707_1001934721 301
5 3300005518 Ga0070699_100005153 Ga0070699_1000051537 301
6 3300026089 Ga0207648_10236168 Ga0207648_102361682 303
7 3300005471 Ga0070698_100184371 Ga0070698_1001843711 304
8 3300025922 Ga0207646_10090917 Ga0207646_100909173 304
9 3300048915 Ga0496112_0061259 Ga0496112_0061259_2331_3437 305
10 3300005435 Ga0070714_100326902 Ga0070714_1003269021 306
11 3300005614 Ga0068856_100019723 Ga0068856_1000197236 306
12 3300009545 Ga0105237_10041966 Ga0105237_100419661 306
13 3300013100 Ga0157373_10014275 Ga0157373_100142753 306
14 3300013104 Ga0157370_10034737 Ga0157370_100347373 306
15 3300013296 Ga0157374_10038015 Ga0157374_100380152 306
16 3300013307 Ga0157372_10002305 Ga0157372_1000230516 306
17 3300035691 Ga0373931_0029505 Ga0373931_0029505_439_1545 306
18 3300048905 Ga0496102_0387047 Ga0496102_0387047_36_1142 306
19 3300006175 Ga0070712_100087291 Ga0070712_1000872912 309
20 3300037068 Ga0373925_0007794 Ga0373925_0007794_3284_4390 310
21 3300048918 Ga0496115_0355057 Ga0496115_0355057_74_1039 317
22 3300049581 Ga0501047_0163624 Ga0501047_0163624_1090_2055 317
23 3300009093 Ga0105240_10038749 Ga0105240_100387493 318
24 3300013307 Ga0157372_10009623 Ga0157372_100096236 318
25 3300025913 Ga0207695_10013142 Ga0207695_100131424 318
26 3300031731 Ga0307405_10007924 Ga0307405_100079241 318
27 3300035695 Ga0373927_0046684 Ga0373927_0046684_516_1622 319
28 3300025928 Ga0207700_10302942 Ga0207700_103029421 320
29 3300039437 Ga0436365_0597857 Ga0436365_0597857_37_1074 321
30 3300006028 Ga0070717_10015641 Ga0070717_100156413 325
31 3300005434 Ga0070709_10084441 Ga0070709_100844411 327
32 3300005445 Ga0070708_100007264 Ga0070708_1000072643 333
33 3300005467 Ga0070706_100033699 Ga0070706_1000336993 333
34 3300005468 Ga0070707_100015721 Ga0070707_1000157219 333
35 3300005471 Ga0070698_100011394 Ga0070698_10001139411 333
36 3300005518 Ga0070699_100021400 Ga0070699_1000214003 333
37 3300005536 Ga0070697_100017787 Ga0070697_1000177874 333
38 3300025910 Ga0207684_10000932 Ga0207684_100009329 333
39 3300025910 Ga0207684_10048747 Ga0207684_100487472 333
40 3300025922 Ga0207646_10010343 Ga0207646_1001034310 333
41 3300025928 Ga0207700_10361151 Ga0207700_103611511 333
42 3300031090 Ga0265760_10003696 Ga0265760_100036962 336
43 3300046543 Ga0495645_0030539 Ga0495645_0030539_1604_2710 336
44 3300046678 Ga0495599_0136086 Ga0495599_0136086_374_1480 336
45 3300047472 Ga0495686_0002562 Ga0495686_0002562_11389_12432 336
46 3300003323 rootH1_10001236 rootH1_1000123610 337
47 3300005327 Ga0070658_10238191 Ga0070658_102381911 337
48 3300005338 Ga0068868_100023901 Ga0068868_1000239012 337
49 3300005434 Ga0070709_10089565 Ga0070709_100895653 337
50 3300005436 Ga0070713_100068694 Ga0070713_1000686944 337
51 3300005439 Ga0070711_100002332 Ga0070711_1000023322 337
52 3300005445 Ga0070708_100048377 Ga0070708_1000483772 337
53 3300005445 Ga0070708_100125088 Ga0070708_1001250882 337
54 3300005468 Ga0070707_100001189 Ga0070707_10000118920 337
55 3300005468 Ga0070707_100082602 Ga0070707_1000826022 337
56 3300005468 Ga0070707_100171159 Ga0070707_1001711591 337
57 3300005468 Ga0070707_100195584 Ga0070707_1001955842 337
58 3300005468 Ga0070707_100308070 Ga0070707_1003080701 337
59 3300005536 Ga0070697_100067099 Ga0070697_1000670993 337
60 3300005616 Ga0068852_100049466 Ga0068852_1000494664 337
61 3300005617 Ga0068859_100047676 Ga0068859_1000476765 337
62 3300005834 Ga0068851_10037990 Ga0068851_100379901 337
63 3300005841 Ga0068863_100002324 Ga0068863_1000023243 337
64 3300005842 Ga0068858_100182885 Ga0068858_1001828852 337
65 3300005843 Ga0068860_100003071 Ga0068860_10000307115 337
66 3300005843 Ga0068860_100205651 Ga0068860_1002056512 337
67 3300006028 Ga0070717_10065052 Ga0070717_100650524 337
68 3300006028 Ga0070717_10091002 Ga0070717_100910022 337
69 3300006237 Ga0097621_100038256 Ga0097621_1000382562 337
70 3300006358 Ga0068871_100083343 Ga0068871_1000833432 337
71 3300006852 Ga0075433_10281548 Ga0075433_102815481 337
72 3300006871 Ga0075434_100004374 Ga0075434_1000043744 337
73 3300006931 Ga0097620_100047677 Ga0097620_1000476775 337
74 3300007076 Ga0075435_100198479 Ga0075435_1001984792 337
75 3300009094 Ga0111539_10003380 Ga0111539_1000338014 337
76 3300009098 Ga0105245_10188243 Ga0105245_101882432 337
77 3300009147 Ga0114129_10384394 Ga0114129_103843942 337
78 3300009174 Ga0105241_10065021 Ga0105241_100650213 337
79 3300009551 Ga0105238_10041874 Ga0105238_100418742 337
80 3300010159 Ga0099796_10021196 Ga0099796_100211962 337
81 3300010375 Ga0105239_10218797 Ga0105239_102187972 337
82 3300013297 Ga0157378_10001669 Ga0157378_1000166921 337
83 3300013306 Ga0163162_10029780 Ga0163162_100297805 337
84 3300013308 Ga0157375_10538662 Ga0157375_105386621 337
85 3300014969 Ga0157376_10000014 Ga0157376_10000014231 337
86 3300015261 Ga0182006_1046008 Ga0182006_10460082 337
87 3300025899 Ga0207642_10048578 Ga0207642_100485781 337
88 3300025910 Ga0207684_10024072 Ga0207684_100240724 337
89 3300025916 Ga0207663_10025834 Ga0207663_100258343 337
90 3300025922 Ga0207646_10000335 Ga0207646_1000033531 337
91 3300025922 Ga0207646_10098220 Ga0207646_100982201 337
92 3300025922 Ga0207646_10296271 Ga0207646_102962711 337
93 3300025924 Ga0207694_10032445 Ga0207694_100324454 337
94 3300025928 Ga0207700_10149721 Ga0207700_101497212 337
95 3300025929 Ga0207664_10105796 Ga0207664_101057963 337
96 3300025939 Ga0207665_10050557 Ga0207665_100505573 337
97 3300026041 Ga0207639_10158757 Ga0207639_101587573 337
98 3300026088 Ga0207641_10018923 Ga0207641_100189235 337
99 3300027907 Ga0207428_10027424 Ga0207428_100274245 337
100 3300028379 Ga0268266_10000072 Ga0268266_1000007252 337
101 3300028381 Ga0268264_10110885 Ga0268264_101108852 337
102 3300028381 Ga0268264_10425495 Ga0268264_104254951 337
103 3300031247 Ga0265340_10000414 Ga0265340_1000041410 337
104 3300035086 Ga0373934_0018312 Ga0373934_0018312_1045_2148 337
105 3300035113 Ga0373936_0014823 Ga0373936_0014823_672_1778 337
106 3300035119 Ga0373956_0028213 Ga0373956_0028213_295_1398 337
107 3300035120 Ga0373957_0011895 Ga0373957_0011895_487_1590 337
108 3300035172 Ga0373955_0003930 Ga0373955_0003930_2962_4065 337
109 3300035695 Ga0373927_0016231 Ga0373927_0016231_1708_2817 337
110 3300035724 Ga0373933_0004227 Ga0373933_0004227_2641_3744 337
111 3300036401 Ga0373937_0000506 Ga0373937_0000506_33772_34875 337
112 3300036401 Ga0373937_0042581 Ga0373937_0042581_2590_3837 337
113 3300037068 Ga0373925_0050923 Ga0373925_0050923_331_1440 337
114 3300037418 Ga0395900_0442020 Ga0395900_0442020_38_1159 337
115 3300039437 Ga0436365_1378329 Ga0436365_1378329_2361_3470 337
116 3300046454 Ga0495592_0062007 Ga0495592_0062007_1321_2448 337
117 3300046455 Ga0495603_0074902 Ga0495603_0074902_623_1726 337
118 3300046472 Ga0495580_0002826 Ga0495580_0002826_3533_4639 337
119 3300046472 Ga0495580_0062544 Ga0495580_0062544_1318_2406 337
120 3300046473 Ga0495582_0000738 Ga0495582_0000738_7121_8209 337
121 3300046511 Ga0495608_0137122 Ga0495608_0137122_52_1155 337
122 3300046531 Ga0495665_0122465 Ga0495665_0122465_247_1335 337
123 3300046536 Ga0495587_0007139 Ga0495587_0007139_4530_5633 337
124 3300046679 Ga0495623_0012480 Ga0495623_0012480_2170_3273 337
125 3300046809 Ga0495600_0106577 Ga0495600_0106577_35_1138 337
126 3300047317 Ga0495604_0002408 Ga0495604_0002408_5399_6502 337
127 3300047317 Ga0495604_0047038 Ga0495604_0047038_855_1958 337
128 3300047444 Ga0495675_0206127 Ga0495675_0206127_61_1164 337
129 3300048088 Ga0495602_0005050 Ga0495602_0005050_1467_2570 337
130 3300048905 Ga0496102_0006095 Ga0496102_0006095_7133_8227 337
131 3300048907 Ga0496104_0357547 Ga0496104_0357547_99_1205 337
132 3300048915 Ga0496112_0081575 Ga0496112_0081575_183_1277 337
133 3300048917 Ga0496114_0119429 Ga0496114_0119429_281_1363 337
134 3300048918 Ga0496115_0046227 Ga0496115_0046227_237_1346 337
135 3300048919 Ga0496116_0079392 Ga0496116_0079392_930_1985 337
136 3300048927 Ga0496124_0187025 Ga0496124_0187025_514_1569 337
137 3300050507 nmdc:mga05p37_206273_c1 nmdc:mga05p37_206273_c1_968_2071 337
138 3300050511 nmdc:mga08y16_2032_c1 nmdc:mga08y16_2032_c1_18158_19267 337
139 3300050512 nmdc:mga0n895_11593_c1 nmdc:mga0n895_11593_c1_2844_3950 337
140 3300050513 nmdc:mga0rr50_153549_c1 nmdc:mga0rr50_153549_c1_521_1609 337
141 3300053085 Ga0495619_0191624 Ga0495619_0191624_75_1202 337
142 3300006175 Ga0070712_100085290 Ga0070712_1000852903 338
143 3300025915 Ga0207693_10083128 Ga0207693_100831282 338
144 iso_pu_bacteria 2585427594 2585842572 344
145 3300005436 Ga0070713_100142976 Ga0070713_1001429761 346
146 3300005468 Ga0070707_100003636 Ga0070707_1000036363 346
147 3300005844 Ga0068862_100026482 Ga0068862_1000264824 346
148 3300025922 Ga0207646_10000594 Ga0207646_100005943 346
149 3300028380 Ga0268265_10108382 Ga0268265_101083821 346
150 3300000545 CNXas_1000134 CNXas_10001346 347
151 3300005329 Ga0070683_100082886 Ga0070683_1000828863 347
152 3300005329 Ga0070683_100117510 Ga0070683_1001175102 347
153 3300005347 Ga0070668_100000827 Ga0070668_10000082720 347
154 3300005364 Ga0070673_100130207 Ga0070673_1001302072 347
155 3300005441 Ga0070700_100116489 Ga0070700_1001164891 347
156 3300005458 Ga0070681_10248694 Ga0070681_102486941 347
157 3300005530 Ga0070679_100022053 Ga0070679_1000220535 347
158 3300005535 Ga0070684_100150299 Ga0070684_1001502992 347
159 3300005543 Ga0070672_100005916 Ga0070672_1000059165 347
160 3300005545 Ga0070695_100064960 Ga0070695_1000649602 347
161 3300005548 Ga0070665_100210298 Ga0070665_1002102982 347
162 3300005549 Ga0070704_100024055 Ga0070704_1000240552 347
163 3300005719 Ga0068861_100062098 Ga0068861_1000620982 347
164 3300005719 Ga0068861_100079740 Ga0068861_1000797402 347
165 3300006028 Ga0070717_10089729 Ga0070717_100897292 347
166 3300009098 Ga0105245_10379012 Ga0105245_103790121 347
167 3300009177 Ga0105248_10162978 Ga0105248_101629782 347
168 3300009177 Ga0105248_10482205 Ga0105248_104822051 347
169 3300013306 Ga0163162_10024234 Ga0163162_100242344 347
170 3300015262 Ga0182007_10018989 Ga0182007_100189893 347
171 3300020075 Ga0206349_1928890 Ga0206349_19288901 347
172 3300025912 Ga0207707_10135193 Ga0207707_101351933 347
173 3300025921 Ga0207652_10153415 Ga0207652_101534152 347
174 3300025940 Ga0207691_10003626 Ga0207691_100036264 347
175 3300025940 Ga0207691_10032370 Ga0207691_100323706 347
176 3300025941 Ga0207711_10178674 Ga0207711_101786742 347
177 3300025944 Ga0207661_10025481 Ga0207661_100254812 347
178 3300025960 Ga0207651_10058575 Ga0207651_100585752 347
179 3300026023 Ga0207677_10056023 Ga0207677_100560232 347
180 3300026067 Ga0207678_10172489 Ga0207678_101724892 347
181 3300026118 Ga0207675_100122882 Ga0207675_1001228822 347
182 3300027717 Ga0209998_10019277 Ga0209998_100192771 347
183 3300028379 Ga0268266_10110372 Ga0268266_101103723 347
184 3300031824 Ga0307413_10057285 Ga0307413_100572852 347
185 3300031852 Ga0307410_10061233 Ga0307410_100612332 347
186 3300031903 Ga0307407_10083632 Ga0307407_100836322 347
187 3300032002 Ga0307416_100061193 Ga0307416_1000611931 347
188 3300035692 Ga0373935_0199395 Ga0373935_0199395_155_1258 347
189 3300039437 Ga0436365_0037930 Ga0436365_0037930_1108_2223 347
190 3300045836 Ga0466958_0189875 Ga0466958_0189875_15_1160 347
191 3300049571 Ga0501034_0063829 Ga0501034_0063829_252_1343 347
192 3300049581 Ga0501047_0029503 Ga0501047_0029503_1466_2557 347
193 3300049822 Ga0501035_0074547 Ga0501035_0074547_400_1494 347
194 3300049823 Ga0501044_0010834 Ga0501044_0010834_5609_6703 347
195 3300050515 nmdc:mga0a205_152427_c1 nmdc:mga0a205_152427_c1_941_2056 347
196 3300054114 Ga0501084_0012992 Ga0501084_0012992_1563_2672 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

209

332

0.97

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

47

170

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z0c-assembly1.cif.gz_A-2 nerol dehydrogenase from persicaria minor 0.9737 2 344
7cgu-assembly1.cif.gz_A crystal structure of abhar 0.9718 4 345
6k3g-assembly1.cif.gz_B crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with nadp+ 0.9669 1 345
8b26-assembly1.cif.gz_B dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga 0.9649 1 344
5vkt-assembly1.cif.gz_A cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) moench 0.964 2 345
ID Description Score Start End Superfamily
af_C6TB56_4_167_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9854 1 162 3.90.180.10
af_A0A0R0ITF2_16_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9813 8 116 3.90.180.10
af_P9WQC5_8_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.98 9 250 3.40.50.720
af_P9WQC5_159_311_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9746 160 312 3.40.50.720
5vktB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9725 2 345 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A388P776-F1-model_v4 NADP-dependent alcohol dehydrogenase C 0.9924 34 147 GO:0008270
GO:0016616
AF-A0A6N8R2N6-F1-model_v4 NADPH-dependent aldehyde reductase YahK (EC 1.1.1.2) 0.9917 2 98 GO:0008106
GO:0008270
AF-A0A087G393-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9856 2 157 GO:0008270
GO:0009809
GO:0016616
AF-A0A1S3ZT90-F1-model_v4 Probable cinnamyl alcohol dehydrogenase 6 0.9856 1 139 GO:0008270
GO:0016616
AF-A0A3A8H498-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9854 186 346 GO:0016616

Feature Viewer

pLDDT pTM Quality
93.86 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map