F300081
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 195 | 127 | 186 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10147457|Ga0157371_101474572 |
| Length | 218 |
| Sequence | MNNLWIKDRKKPVRLSFMTSAKHRYFIINKPPNMVSQFISPDAVGLLGDLNYDFPEGIHAIGRLDSHSEGLLILTTNKKVTRLLFQGEVPHKRTYVVHVKHVITQEKLDLLRTGIPILVKGNTEYITTPCEVDIVEKPKGWLKLSKEPEDVPHTWLKITLTEGKYHQIRKMVLAAGHKCKRLIRMSIEDLEIGDLPPGGVLELEEEDFFRKLKIKNWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 4 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 5 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 6 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 7 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 8 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 9 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 83 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 84 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 85 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 87 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 88 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 89 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 90 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 91 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 92 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 95 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 96 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 97 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 98 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 99 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 100 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 111 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 112 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 113 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 117 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 120 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 121 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 122 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 123 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 124 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 125 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 126 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 127 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.38 |
| Metatranscriptomes | 0 |
| Isolates | 4.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.74 |
| Nodule | 0 |
| Rhizoplane | 1.54 |
| Rhizosphere | 79.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10055237 | 3300003316 | Bacteria | 1072 |
| 2 | rootH2_10057638 | 3300003320 | Bacteria | 2156 |
| 3 | rootL2_10306156 | 3300003322 | Bacteria | 3154 |
| 4 | rootH1_10112441 | 3300003323 | Bacteria | 9263 |
| 5 | rootH1_10377488 | 3300003323 | Bacteria | 1519 |
| 6 | Ga0055536_1010481 | 3300003781 | Bacteria | 3668 |
| 7 | Ga0065165_1000185 | 3300005262 | Bacteria | 108984 |
| 8 | Ga0065714_10086960 | 3300005288 | Bacteria | 2080 |
| 9 | Ga0070680_100036633 | 3300005336 | Bacteria | 3963 |
| 10 | Ga0070680_100286315 | 3300005336 | Bacteria | 1396 |
| 11 | Ga0070680_100298732 | 3300005336 | Bacteria | 1365 |
| 12 | Ga0070660_100006923 | 3300005339 | Bacteria | 7863 |
| 13 | Ga0070660_100013445 | 3300005339 | Bacteria | 5872 |
| 14 | Ga0070660_100028631 | 3300005339 | Bacteria | 4170 |
| 15 | Ga0070660_100211552 | 3300005339 | Bacteria | 1574 |
| 16 | Ga0070668_100681300 | 3300005347 | Bacteria | 905 |
| 17 | Ga0070675_100016703 | 3300005354 | Bacteria | 5826 |
| 18 | Ga0070673_100071804 | 3300005364 | Unclassified | 2782 |
| 19 | Ga0070659_100017829 | 3300005366 | Bacteria | 5348 |
| 20 | Ga0070678_100200449 | 3300005456 | Bacteria | 1647 |
| 21 | Ga0070678_100513124 | 3300005456 | Bacteria | 1059 |
| 22 | Ga0070681_10082279 | 3300005458 | Bacteria | 3174 |
| 23 | Ga0070681_10818282 | 3300005458 | Bacteria | 849 |
| 24 | Ga0068867_100170935 | 3300005459 | Bacteria | 1721 |
| 25 | Ga0068867_100354541 | 3300005459 | Bacteria | 1225 |
| 26 | Ga0070679_100079487 | 3300005530 | Bacteria | 3269 |
| 27 | Ga0070679_100375526 | 3300005530 | Bacteria | 1368 |
| 28 | Ga0070679_100397381 | 3300005530 | Bacteria | 1324 |
| 29 | Ga0070679_100626711 | 3300005530 | Bacteria | 1018 |
| 30 | Ga0068853_100016341 | 3300005539 | Bacteria | 6106 |
| 31 | Ga0068853_100538668 | 3300005539 | Bacteria | 1105 |
| 32 | Ga0070672_100288996 | 3300005543 | Bacteria | 1388 |
| 33 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 34 | Ga0070665_101146873 | 3300005548 | Unclassified | 788 |
| 35 | Ga0068855_100027625 | 3300005563 | Bacteria | 6787 |
| 36 | Ga0068855_100040646 | 3300005563 | Bacteria | 5519 |
| 37 | Ga0068855_100043938 | 3300005563 | Bacteria | 5290 |
| 38 | Ga0068857_100042604 | 3300005577 | Bacteria | 4028 |
| 39 | Ga0068857_100145188 | 3300005577 | Bacteria | 2147 |
| 40 | Ga0068856_100110065 | 3300005614 | Bacteria | 2751 |
| 41 | Ga0068856_100218727 | 3300005614 | Bacteria | 1920 |
| 42 | Ga0068852_100002354 | 3300005616 | Bacteria | 13017 |
| 43 | Ga0068852_100812090 | 3300005616 | Bacteria | 950 |
| 44 | Ga0068870_10223218 | 3300005840 | Bacteria | 1154 |
| 45 | Ga0068860_100000019 | 3300005843 | Bacteria | 299860 |
| 46 | Ga0068860_101049951 | 3300005843 | Bacteria | 833 |
| 47 | Ga0068865_100698239 | 3300006881 | Bacteria | 867 |
| 48 | Ga0105240_10047577 | 3300009093 | Bacteria | 5427 |
| 49 | Ga0105240_10379000 | 3300009093 | Bacteria | 1598 |
| 50 | Ga0105241_10010223 | 3300009174 | Bacteria | 6893 |
| 51 | Ga0105241_10186649 | 3300009174 | Bacteria | 1724 |
| 52 | Ga0105242_10937173 | 3300009176 | Bacteria | 869 |
| 53 | Ga0105237_10000238 | 3300009545 | Bacteria | 78411 |
| 54 | Ga0105237_10003156 | 3300009545 | Bacteria | 19825 |
| 55 | Ga0105239_10002336 | 3300010375 | Bacteria | 24195 |
| 56 | Ga0105239_10003044 | 3300010375 | Bacteria | 20839 |
| 57 | Ga0105239_10267372 | 3300010375 | Bacteria | 1923 |
| 58 | Ga0105239_10428471 | 3300010375 | Bacteria | 1499 |
| 59 | Ga0157373_10007859 | 3300013100 | Bacteria | 7934 |
| 60 | Ga0157371_10012508 | 3300013102 | Bacteria | 6486 |
| 61 | Ga0157371_10024873 | 3300013102 | Bacteria | 4369 |
| 62 | Ga0157371_10102764 | 3300013102 | Bacteria | 2028 |
| 63 | Ga0157371_10112871 | 3300013102 | Bacteria | 1929 |
| 64 | Ga0157371_10147457 | 3300013102 | Bacteria | 1677 |
| 65 | Ga0157370_10008635 | 3300013104 | Bacteria | 10965 |
| 66 | Ga0157370_10169327 | 3300013104 | Unclassified | 2031 |
| 67 | Ga0157370_10231515 | 3300013104 | Bacteria | 1710 |
| 68 | Ga0157370_10234953 | 3300013104 | Bacteria | 1696 |
| 69 | Ga0157370_10254608 | 3300013104 | Bacteria | 1623 |
| 70 | Ga0157370_10345075 | 3300013104 | Bacteria | 1372 |
| 71 | Ga0157370_10777914 | 3300013104 | Unclassified | 871 |
| 72 | Ga0157369_10030664 | 3300013105 | Bacteria | 5929 |
| 73 | Ga0157369_10054754 | 3300013105 | Bacteria | 4307 |
| 74 | Ga0157374_10449992 | 3300013296 | Unclassified | 1289 |
| 75 | Ga0157378_10021958 | 3300013297 | Bacteria | 5613 |
| 76 | Ga0157378_10665796 | 3300013297 | Unclassified | 1058 |
| 77 | Ga0163162_10003984 | 3300013306 | Bacteria | 14163 |
| 78 | Ga0163162_10010101 | 3300013306 | Bacteria | 9177 |
| 79 | Ga0163162_10059409 | 3300013306 | Bacteria | 3855 |
| 80 | Ga0163162_10283030 | 3300013306 | Bacteria | 1790 |
| 81 | Ga0157372_10043009 | 3300013307 | Bacteria | 5000 |
| 82 | Ga0157372_10149022 | 3300013307 | Bacteria | 2699 |
| 83 | Ga0157372_10526908 | 3300013307 | Bacteria | 1377 |
| 84 | Ga0157375_10161263 | 3300013308 | Bacteria | 2384 |
| 85 | Ga0157375_11664484 | 3300013308 | Bacteria | 755 |
| 86 | Ga0163163_10470741 | 3300014325 | Bacteria | 1317 |
| 87 | Ga0163163_10779431 | 3300014325 | Unclassified | 1019 |
| 88 | Ga0157380_10306818 | 3300014326 | Bacteria | 1465 |
| 89 | Ga0182005_1000732 | 3300015265 | Bacteria | 15016 |
| 90 | Ga0209436_104165 | 3300025208 | Bacteria | 3633 |
| 91 | Ga0209130_1002546 | 3300025284 | Bacteria | 8920 |
| 92 | Ga0209676_1000810 | 3300025292 | Bacteria | 40868 |
| 93 | Ga0209758_1055992 | 3300025297 | Bacteria | 1335 |
| 94 | Ga0207426_1000729 | 3300025302 | Bacteria | 37672 |
| 95 | Ga0207426_1018392 | 3300025302 | Bacteria | 2462 |
| 96 | Ga0207707_10056369 | 3300025912 | Bacteria | 3419 |
| 97 | Ga0207695_10007644 | 3300025913 | Bacteria | 13696 |
| 98 | Ga0207671_10000325 | 3300025914 | Bacteria | 70129 |
| 99 | Ga0207671_10022150 | 3300025914 | Bacteria | 4808 |
| 100 | Ga0207660_10036723 | 3300025917 | Bacteria | 3408 |
| 101 | Ga0207660_10056087 | 3300025917 | Unclassified | 2818 |
| 102 | Ga0207660_10349708 | 3300025917 | Bacteria | 1184 |
| 103 | Ga0207660_10465377 | 3300025917 | Bacteria | 1023 |
| 104 | Ga0207657_10005438 | 3300025919 | Bacteria | 13306 |
| 105 | Ga0207657_10009552 | 3300025919 | Bacteria | 9737 |
| 106 | Ga0207657_10196091 | 3300025919 | Bacteria | 1627 |
| 107 | Ga0207649_10186781 | 3300025920 | Bacteria | 1455 |
| 108 | Ga0207652_10044903 | 3300025921 | Bacteria | 3766 |
| 109 | Ga0207652_10078623 | 3300025921 | Bacteria | 2880 |
| 110 | Ga0207681_10604023 | 3300025923 | Unclassified | 907 |
| 111 | Ga0207690_10079249 | 3300025932 | Bacteria | 2288 |
| 112 | Ga0207690_10096328 | 3300025932 | Bacteria | 2104 |
| 113 | Ga0207691_10011017 | 3300025940 | Bacteria | 8674 |
| 114 | Ga0207691_10192200 | 3300025940 | Bacteria | 1780 |
| 115 | Ga0207661_10308149 | 3300025944 | Bacteria | 1421 |
| 116 | Ga0207667_10038141 | 3300025949 | Bacteria | 5133 |
| 117 | Ga0207668_10447264 | 3300025972 | Bacteria | 1102 |
| 118 | Ga0207640_10256501 | 3300025981 | Bacteria | 1360 |
| 119 | Ga0207703_10795077 | 3300026035 | Bacteria | 903 |
| 120 | Ga0207639_10101165 | 3300026041 | Bacteria | 2330 |
| 121 | Ga0207641_10232497 | 3300026088 | Unclassified | 1714 |
| 122 | Ga0207648_10051150 | 3300026089 | Bacteria | 3611 |
| 123 | Ga0207648_10078744 | 3300026089 | Unclassified | 2875 |
| 124 | Ga0207674_10103728 | 3300026116 | Bacteria | 2822 |
| 125 | Ga0207674_10355916 | 3300026116 | Bacteria | 1415 |
| 126 | Ga0207683_10202269 | 3300026121 | Bacteria | 1806 |
| 127 | Ga0207683_10250263 | 3300026121 | Bacteria | 1617 |
| 128 | Ga0207698_10004845 | 3300026142 | Bacteria | 8243 |
| 129 | Ga0207698_10806490 | 3300026142 | Bacteria | 941 |
| 130 | Ga0268266_10000022 | 3300028379 | Bacteria | 508060 |
| 131 | Ga0268266_10777977 | 3300028379 | Unclassified | 924 |
| 132 | Ga0268264_10000254 | 3300028381 | Bacteria | 98371 |
| 133 | Ga0307517_10097202 | 3300028786 | Unclassified | 2353 |
| 134 | Ga0307408_100449585 | 3300031548 | Bacteria | 1117 |
| 135 | Ga0307516_10001745 | 3300031730 | Bacteria | 29897 |
| 136 | Ga0307405_10006861 | 3300031731 | Bacteria | 5645 |
| 137 | Ga0307412_10533736 | 3300031911 | Unclassified | 982 |
| 138 | Ga0307507_10168978 | 3300033179 | Unclassified | 1594 |
| 139 | Ga0307510_10008151 | 3300033180 | Bacteria | 12477 |
| 140 | Ga0395899_0052377 | 3300037312 | Bacteria | 3025 |
| 141 | Ga0395899_0375581 | 3300037312 | Bacteria | 946 |
| 142 | Ga0395900_0424693 | 3300037418 | Bacteria | 1289 |
| 143 | Ga0395898_0029824 | 3300037466 | Bacteria | 5460 |
| 144 | Ga0395905_0196430 | 3300037471 | Bacteria | 1892 |
| 145 | Ga0395901_0038964 | 3300038443 | Bacteria | 4916 |
| 146 | Ga0451789_1082362 | 3300041443 | Bacteria | 1068 |
| 147 | Ga0451795_1526924 | 3300041456 | Bacteria | 839 |
| 148 | Ga0451833_0817675 | 3300041491 | Bacteria | 1022 |
| 149 | Ga0439431_0016117 | 3300041997 | Bacteria | 1746 |
| 150 | Ga0439449_0002074 | 3300042007 | Bacteria | 7879 |
| 151 | Ga0466965_0394361 | 3300044683 | Bacteria | 764 |
| 152 | Ga0495606_0003840 | 3300046507 | Bacteria | 15525 |
| 153 | Ga0495648_0007262 | 3300046524 | Bacteria | 8894 |
| 154 | Ga0495598_0049627 | 3300046537 | Bacteria | 1259 |
| 155 | Ga0495633_0000019 | 3300046558 | Bacteria | 233769 |
| 156 | Ga0495668_0000624 | 3300046616 | Bacteria | 42812 |
| 157 | Ga0495668_0001215 | 3300046616 | Bacteria | 26081 |
| 158 | Ga0495611_0000042 | 3300046648 | Bacteria | 94996 |
| 159 | Ga0495625_0145378 | 3300046660 | Bacteria | 1597 |
| 160 | Ga0495636_0000333 | 3300047318 | Bacteria | 18073 |
| 161 | Ga0495687_000119 | 3300047443 | Bacteria | 121587 |
| 162 | Ga0495686_0000046 | 3300047472 | Bacteria | 281963 |
| 163 | Ga0496115_0557106 | 3300048918 | Unclassified | 915 |
| 164 | Ga0496124_0081195 | 3300048927 | Bacteria | 2666 |
| 165 | Ga0496125_0367873 | 3300048928 | Bacteria | 852 |
| 166 | Ga0501032_0145577 | 3300049569 | Bacteria | 1560 |
| 167 | Ga0501033_0138660 | 3300049570 | Unclassified | 1759 |
| 168 | Ga0501033_0434558 | 3300049570 | Unclassified | 913 |
| 169 | Ga0501034_0123026 | 3300049571 | Bacteria | 2580 |
| 170 | Ga0501034_0186371 | 3300049571 | Unclassified | 2038 |
| 171 | Ga0501034_0360459 | 3300049571 | Bacteria | 1381 |
| 172 | Ga0501225_0073607 | 3300049705 | Bacteria | 973 |
| 173 | Ga0501035_0115794 | 3300049822 | Bacteria | 2346 |
| 174 | Ga0501044_0856719 | 3300049823 | Bacteria | 785 |
| 175 | Ga0501044_1054576 | 3300049823 | Bacteria | 683 |
| 176 | Ga0500644_0083070 | 3300053088 | Unclassified | 1182 |
| 177 | Ga0500644_0120236 | 3300053088 | Bacteria | 1023 |
| 178 | Ga0500651_0016284 | 3300053093 | Bacteria | 4572 |
| 179 | Ga0500556_0021452 | 3300053104 | Unclassified | 2083 |
| 180 | Ga0500562_027725 | 3300053108 | Bacteria | 1487 |
| 181 | Ga0500588_0061019 | 3300053146 | Bacteria | 1208 |
| 182 | Ga0500616_0001380 | 3300053153 | Bacteria | 23509 |
| 183 | Ga0500622_0000372 | 3300053156 | Bacteria | 43235 |
| 184 | Ga0500622_0003667 | 3300053156 | Bacteria | 10089 |
| 185 | Ga0500627_0010024 | 3300053158 | Bacteria | 3440 |
| 186 | Ga0500645_021482 | 3300053730 | Bacteria | 1992 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041456 | Ga0451795_1526924 | Ga0451795_1526924_23_511 | 159 |
| 2 | 3300025208 | Ga0209436_104165 | Ga0209436_1041652 | 172 |
| 3 | 3300025302 | Ga0207426_1018392 | Ga0207426_10183921 | 172 |
| 4 | 3300046660 | Ga0495625_0145378 | Ga0495625_0145378_501_1025 | 174 |
| 5 | 3300049705 | Ga0501225_0073607 | Ga0501225_0073607_370_954 | 174 |
| 6 | 3300049570 | Ga0501033_0138660 | Ga0501033_0138660_349_1044 | 175 |
| 7 | iso_pu_bacteria | 2818991460 | 2819679732 | 179 |
| 8 | iso_pu_bacteria | 2945977869 | 2945982917 | 180 |
| 9 | 3300005347 | Ga0070668_100681300 | Ga0070668_1006813002 | 182 |
| 10 | 3300005354 | Ga0070675_100016703 | Ga0070675_1000167034 | 182 |
| 11 | 3300005364 | Ga0070673_100071804 | Ga0070673_1000718042 | 182 |
| 12 | 3300005456 | Ga0070678_100513124 | Ga0070678_1005131242 | 182 |
| 13 | 3300005459 | Ga0068867_100354541 | Ga0068867_1003545412 | 182 |
| 14 | 3300005843 | Ga0068860_101049951 | Ga0068860_1010499512 | 182 |
| 15 | 3300013297 | Ga0157378_10021958 | Ga0157378_100219583 | 182 |
| 16 | 3300013308 | Ga0157375_10161263 | Ga0157375_101612633 | 182 |
| 17 | 3300014325 | Ga0163163_10470741 | Ga0163163_104707411 | 182 |
| 18 | 3300014326 | Ga0157380_10306818 | Ga0157380_103068181 | 182 |
| 19 | 3300025923 | Ga0207681_10604023 | Ga0207681_106040232 | 182 |
| 20 | 3300025940 | Ga0207691_10011017 | Ga0207691_1001101710 | 182 |
| 21 | 3300025972 | Ga0207668_10447264 | Ga0207668_104472642 | 182 |
| 22 | 3300026088 | Ga0207641_10232497 | Ga0207641_102324973 | 182 |
| 23 | 3300026089 | Ga0207648_10078744 | Ga0207648_100787443 | 182 |
| 24 | 3300026121 | Ga0207683_10250263 | Ga0207683_102502633 | 182 |
| 25 | 3300031911 | Ga0307412_10533736 | Ga0307412_105337361 | 182 |
| 26 | 3300053108 | Ga0500562_027725 | Ga0500562_027725_88_684 | 182 |
| 27 | 3300003322 | rootL2_10306156 | rootL2_103061562 | 183 |
| 28 | 3300003323 | rootH1_10112441 | rootH1_101124414 | 183 |
| 29 | 3300005288 | Ga0065714_10086960 | Ga0065714_100869602 | 183 |
| 30 | 3300005336 | Ga0070680_100036633 | Ga0070680_1000366334 | 183 |
| 31 | 3300005336 | Ga0070680_100298732 | Ga0070680_1002987322 | 183 |
| 32 | 3300005339 | Ga0070660_100006923 | Ga0070660_1000069235 | 183 |
| 33 | 3300005339 | Ga0070660_100013445 | Ga0070660_1000134455 | 183 |
| 34 | 3300005339 | Ga0070660_100211552 | Ga0070660_1002115522 | 183 |
| 35 | 3300005366 | Ga0070659_100017829 | Ga0070659_1000178292 | 183 |
| 36 | 3300005458 | Ga0070681_10082279 | Ga0070681_100822794 | 183 |
| 37 | 3300005459 | Ga0068867_100170935 | Ga0068867_1001709353 | 183 |
| 38 | 3300005530 | Ga0070679_100079487 | Ga0070679_1000794871 | 183 |
| 39 | 3300005530 | Ga0070679_100375526 | Ga0070679_1003755262 | 183 |
| 40 | 3300005530 | Ga0070679_100397381 | Ga0070679_1003973812 | 183 |
| 41 | 3300005563 | Ga0068855_100027625 | Ga0068855_1000276257 | 183 |
| 42 | 3300005563 | Ga0068855_100043938 | Ga0068855_1000439385 | 183 |
| 43 | 3300005577 | Ga0068857_100042604 | Ga0068857_1000426042 | 183 |
| 44 | 3300009545 | Ga0105237_10000238 | Ga0105237_1000023861 | 183 |
| 45 | 3300013100 | Ga0157373_10007859 | Ga0157373_100078595 | 183 |
| 46 | 3300013102 | Ga0157371_10102764 | Ga0157371_101027642 | 183 |
| 47 | 3300013102 | Ga0157371_10147457 | Ga0157371_101474572 | 183 |
| 48 | 3300013104 | Ga0157370_10008635 | Ga0157370_100086358 | 183 |
| 49 | 3300013104 | Ga0157370_10169327 | Ga0157370_101693272 | 183 |
| 50 | 3300013104 | Ga0157370_10234953 | Ga0157370_102349532 | 183 |
| 51 | 3300013104 | Ga0157370_10777914 | Ga0157370_107779141 | 183 |
| 52 | 3300013105 | Ga0157369_10054754 | Ga0157369_100547544 | 183 |
| 53 | 3300013307 | Ga0157372_10043009 | Ga0157372_100430092 | 183 |
| 54 | 3300013307 | Ga0157372_10149022 | Ga0157372_101490223 | 183 |
| 55 | 3300025912 | Ga0207707_10056369 | Ga0207707_100563692 | 183 |
| 56 | 3300025914 | Ga0207671_10000325 | Ga0207671_1000032522 | 183 |
| 57 | 3300025917 | Ga0207660_10036723 | Ga0207660_100367233 | 183 |
| 58 | 3300025917 | Ga0207660_10465377 | Ga0207660_104653772 | 183 |
| 59 | 3300025919 | Ga0207657_10005438 | Ga0207657_1000543811 | 183 |
| 60 | 3300025919 | Ga0207657_10009552 | Ga0207657_100095529 | 183 |
| 61 | 3300025919 | Ga0207657_10196091 | Ga0207657_101960912 | 183 |
| 62 | 3300025921 | Ga0207652_10044903 | Ga0207652_100449035 | 183 |
| 63 | 3300025932 | Ga0207690_10079249 | Ga0207690_100792492 | 183 |
| 64 | 3300025932 | Ga0207690_10096328 | Ga0207690_100963282 | 183 |
| 65 | 3300025944 | Ga0207661_10308149 | Ga0207661_103081492 | 183 |
| 66 | 3300025949 | Ga0207667_10038141 | Ga0207667_100381413 | 183 |
| 67 | 3300026089 | Ga0207648_10051150 | Ga0207648_100511504 | 183 |
| 68 | 3300026116 | Ga0207674_10355916 | Ga0207674_103559162 | 183 |
| 69 | 3300026121 | Ga0207683_10202269 | Ga0207683_102022692 | 183 |
| 70 | 3300037312 | Ga0395899_0052377 | Ga0395899_0052377_1772_2362 | 183 |
| 71 | 3300037312 | Ga0395899_0375581 | Ga0395899_0375581_70_660 | 183 |
| 72 | 3300037418 | Ga0395900_0424693 | Ga0395900_0424693_194_784 | 183 |
| 73 | 3300037466 | Ga0395898_0029824 | Ga0395898_0029824_3826_4416 | 183 |
| 74 | 3300038443 | Ga0395901_0038964 | Ga0395901_0038964_1541_2131 | 183 |
| 75 | 3300046616 | Ga0495668_0000624 | Ga0495668_0000624_35151_35879 | 183 |
| 76 | 3300048928 | Ga0496125_0367873 | Ga0496125_0367873_16_621 | 183 |
| 77 | 3300049569 | Ga0501032_0145577 | Ga0501032_0145577_597_1211 | 183 |
| 78 | 3300049570 | Ga0501033_0434558 | Ga0501033_0434558_66_656 | 183 |
| 79 | 3300049571 | Ga0501034_0123026 | Ga0501034_0123026_38_589 | 183 |
| 80 | 3300049571 | Ga0501034_0360459 | Ga0501034_0360459_455_1045 | 183 |
| 81 | 3300049822 | Ga0501035_0115794 | Ga0501035_0115794_870_1484 | 183 |
| 82 | 3300049823 | Ga0501044_1054576 | Ga0501044_1054576_43_633 | 183 |
| 83 | 3300053104 | Ga0500556_0021452 | Ga0500556_0021452_1280_2008 | 183 |
| 84 | 3300053153 | Ga0500616_0001380 | Ga0500616_0001380_22888_23463 | 183 |
| 85 | 3300053158 | Ga0500627_0010024 | Ga0500627_0010024_2808_3422 | 183 |
| 86 | 3300003316 | rootH1_10055237 | rootH1_100552371 | 184 |
| 87 | 3300003320 | rootH2_10057638 | rootH2_100576382 | 184 |
| 88 | 3300003323 | rootH1_10377488 | rootH1_103774882 | 184 |
| 89 | 3300003781 | Ga0055536_1010481 | Ga0055536_10104815 | 184 |
| 90 | 3300005262 | Ga0065165_1000185 | Ga0065165_100018557 | 184 |
| 91 | 3300005336 | Ga0070680_100286315 | Ga0070680_1002863153 | 184 |
| 92 | 3300005339 | Ga0070660_100028631 | Ga0070660_1000286314 | 184 |
| 93 | 3300005456 | Ga0070678_100200449 | Ga0070678_1002004491 | 184 |
| 94 | 3300005458 | Ga0070681_10818282 | Ga0070681_108182821 | 184 |
| 95 | 3300005530 | Ga0070679_100626711 | Ga0070679_1006267112 | 184 |
| 96 | 3300005539 | Ga0068853_100016341 | Ga0068853_1000163418 | 184 |
| 97 | 3300005539 | Ga0068853_100538668 | Ga0068853_1005386681 | 184 |
| 98 | 3300005543 | Ga0070672_100288996 | Ga0070672_1002889962 | 184 |
| 99 | 3300005548 | Ga0070665_100000002 | Ga0070665_100000002203 | 184 |
| 100 | 3300005548 | Ga0070665_101146873 | Ga0070665_1011468731 | 184 |
| 101 | 3300005563 | Ga0068855_100040646 | Ga0068855_1000406463 | 184 |
| 102 | 3300005577 | Ga0068857_100145188 | Ga0068857_1001451882 | 184 |
| 103 | 3300005614 | Ga0068856_100110065 | Ga0068856_1001100652 | 184 |
| 104 | 3300005614 | Ga0068856_100218727 | Ga0068856_1002187271 | 184 |
| 105 | 3300005616 | Ga0068852_100002354 | Ga0068852_10000235413 | 184 |
| 106 | 3300005616 | Ga0068852_100812090 | Ga0068852_1008120901 | 184 |
| 107 | 3300005840 | Ga0068870_10223218 | Ga0068870_102232181 | 184 |
| 108 | 3300005843 | Ga0068860_100000019 | Ga0068860_100000019185 | 184 |
| 109 | 3300006881 | Ga0068865_100698239 | Ga0068865_1006982392 | 184 |
| 110 | 3300009093 | Ga0105240_10047577 | Ga0105240_100475772 | 184 |
| 111 | 3300009093 | Ga0105240_10379000 | Ga0105240_103790002 | 184 |
| 112 | 3300009174 | Ga0105241_10010223 | Ga0105241_100102234 | 184 |
| 113 | 3300009174 | Ga0105241_10186649 | Ga0105241_101866492 | 184 |
| 114 | 3300009176 | Ga0105242_10937173 | Ga0105242_109371731 | 184 |
| 115 | 3300009545 | Ga0105237_10003156 | Ga0105237_1000315620 | 184 |
| 116 | 3300010375 | Ga0105239_10002336 | Ga0105239_1000233621 | 184 |
| 117 | 3300010375 | Ga0105239_10003044 | Ga0105239_100030446 | 184 |
| 118 | 3300010375 | Ga0105239_10267372 | Ga0105239_102673722 | 184 |
| 119 | 3300010375 | Ga0105239_10428471 | Ga0105239_104284712 | 184 |
| 120 | 3300013102 | Ga0157371_10012508 | Ga0157371_100125083 | 184 |
| 121 | 3300013102 | Ga0157371_10024873 | Ga0157371_100248732 | 184 |
| 122 | 3300013102 | Ga0157371_10112871 | Ga0157371_101128711 | 184 |
| 123 | 3300013104 | Ga0157370_10231515 | Ga0157370_102315152 | 184 |
| 124 | 3300013104 | Ga0157370_10254608 | Ga0157370_102546083 | 184 |
| 125 | 3300013104 | Ga0157370_10345075 | Ga0157370_103450753 | 184 |
| 126 | 3300013105 | Ga0157369_10030664 | Ga0157369_100306644 | 184 |
| 127 | 3300013296 | Ga0157374_10449992 | Ga0157374_104499922 | 184 |
| 128 | 3300013297 | Ga0157378_10665796 | Ga0157378_106657961 | 184 |
| 129 | 3300013306 | Ga0163162_10003984 | Ga0163162_100039844 | 184 |
| 130 | 3300013306 | Ga0163162_10010101 | Ga0163162_100101019 | 184 |
| 131 | 3300013306 | Ga0163162_10059409 | Ga0163162_100594092 | 184 |
| 132 | 3300013306 | Ga0163162_10283030 | Ga0163162_102830301 | 184 |
| 133 | 3300013307 | Ga0157372_10526908 | Ga0157372_105269082 | 184 |
| 134 | 3300013308 | Ga0157375_11664484 | Ga0157375_116644841 | 184 |
| 135 | 3300014325 | Ga0163163_10779431 | Ga0163163_107794312 | 184 |
| 136 | 3300015265 | Ga0182005_1000732 | Ga0182005_100073211 | 184 |
| 137 | 3300025284 | Ga0209130_1002546 | Ga0209130_10025462 | 184 |
| 138 | 3300025292 | Ga0209676_1000810 | Ga0209676_100081025 | 184 |
| 139 | 3300025297 | Ga0209758_1055992 | Ga0209758_10559922 | 184 |
| 140 | 3300025302 | Ga0207426_1000729 | Ga0207426_100072930 | 184 |
| 141 | 3300025913 | Ga0207695_10007644 | Ga0207695_100076441 | 184 |
| 142 | 3300025914 | Ga0207671_10022150 | Ga0207671_100221502 | 184 |
| 143 | 3300025917 | Ga0207660_10056087 | Ga0207660_100560872 | 184 |
| 144 | 3300025917 | Ga0207660_10349708 | Ga0207660_103497082 | 184 |
| 145 | 3300025920 | Ga0207649_10186781 | Ga0207649_101867811 | 184 |
| 146 | 3300025921 | Ga0207652_10078623 | Ga0207652_100786233 | 184 |
| 147 | 3300025940 | Ga0207691_10192200 | Ga0207691_101922002 | 184 |
| 148 | 3300025981 | Ga0207640_10256501 | Ga0207640_102565013 | 184 |
| 149 | 3300026035 | Ga0207703_10795077 | Ga0207703_107950772 | 184 |
| 150 | 3300026041 | Ga0207639_10101165 | Ga0207639_101011653 | 184 |
| 151 | 3300026116 | Ga0207674_10103728 | Ga0207674_101037282 | 184 |
| 152 | 3300026142 | Ga0207698_10004845 | Ga0207698_100048456 | 184 |
| 153 | 3300026142 | Ga0207698_10806490 | Ga0207698_108064902 | 184 |
| 154 | 3300028379 | Ga0268266_10000022 | Ga0268266_10000022234 | 184 |
| 155 | 3300028379 | Ga0268266_10777977 | Ga0268266_107779771 | 184 |
| 156 | 3300028381 | Ga0268264_10000254 | Ga0268264_1000025425 | 184 |
| 157 | 3300028786 | Ga0307517_10097202 | Ga0307517_100972023 | 184 |
| 158 | 3300031548 | Ga0307408_100449585 | Ga0307408_1004495852 | 184 |
| 159 | 3300031730 | Ga0307516_10001745 | Ga0307516_1000174524 | 184 |
| 160 | 3300031731 | Ga0307405_10006861 | Ga0307405_100068615 | 184 |
| 161 | 3300033179 | Ga0307507_10168978 | Ga0307507_101689781 | 184 |
| 162 | 3300033180 | Ga0307510_10008151 | Ga0307510_100081516 | 184 |
| 163 | 3300037471 | Ga0395905_0196430 | Ga0395905_0196430_257_820 | 184 |
| 164 | 3300041443 | Ga0451789_1082362 | Ga0451789_1082362_429_1001 | 184 |
| 165 | 3300041491 | Ga0451833_0817675 | Ga0451833_0817675_231_803 | 184 |
| 166 | 3300041997 | Ga0439431_0016117 | Ga0439431_0016117_324_944 | 184 |
| 167 | 3300042007 | Ga0439449_0002074 | Ga0439449_0002074_2342_2977 | 184 |
| 168 | 3300044683 | Ga0466965_0394361 | Ga0466965_0394361_58_702 | 184 |
| 169 | 3300046507 | Ga0495606_0003840 | Ga0495606_0003840_12607_13206 | 184 |
| 170 | 3300046524 | Ga0495648_0007262 | Ga0495648_0007262_3197_3799 | 184 |
| 171 | 3300046537 | Ga0495598_0049627 | Ga0495598_0049627_250_861 | 184 |
| 172 | 3300046558 | Ga0495633_0000019 | Ga0495633_0000019_91647_92282 | 184 |
| 173 | 3300046616 | Ga0495668_0001215 | Ga0495668_0001215_10250_10840 | 184 |
| 174 | 3300046648 | Ga0495611_0000042 | Ga0495611_0000042_52462_53079 | 184 |
| 175 | 3300047318 | Ga0495636_0000333 | Ga0495636_0000333_7562_8173 | 184 |
| 176 | 3300047443 | Ga0495687_000119 | Ga0495687_000119_62425_63030 | 184 |
| 177 | 3300047472 | Ga0495686_0000046 | Ga0495686_0000046_236878_237483 | 184 |
| 178 | 3300048918 | Ga0496115_0557106 | Ga0496115_0557106_98_730 | 184 |
| 179 | 3300048927 | Ga0496124_0081195 | Ga0496124_0081195_651_1259 | 184 |
| 180 | 3300049571 | Ga0501034_0186371 | Ga0501034_0186371_1378_1989 | 184 |
| 181 | 3300049823 | Ga0501044_0856719 | Ga0501044_0856719_203_763 | 184 |
| 182 | 3300053088 | Ga0500644_0083070 | Ga0500644_0083070_523_1125 | 184 |
| 183 | 3300053088 | Ga0500644_0120236 | Ga0500644_0120236_187_756 | 184 |
| 184 | 3300053093 | Ga0500651_0016284 | Ga0500651_0016284_863_1498 | 184 |
| 185 | 3300053146 | Ga0500588_0061019 | Ga0500588_0061019_428_1033 | 184 |
| 186 | 3300053156 | Ga0500622_0000372 | Ga0500622_0000372_25718_26332 | 184 |
| 187 | 3300053156 | Ga0500622_0003667 | Ga0500622_0003667_8790_9392 | 184 |
| 188 | 3300053730 | Ga0500645_021482 | Ga0500645_021482_417_1031 | 184 |
| 189 | iso_pu_bacteria | 2522125168 | 2522552738 | 184 |
| 190 | iso_pu_bacteria | 2818991444 | 2819585505 | 184 |
| 191 | iso_pu_bacteria | 2821136567 | 2821139210 | 184 |
| 192 | iso_pu_bacteria | 2904467357 | 2904473228 | 184 |
| 193 | iso_pu_bacteria | 2929154850 | 2929156151 | 184 |
| 194 | iso_pu_bacteria | 2929177148 | 2929180532 | 184 |
| 195 | iso_pu_bacteria | 2946013367 | 2946017690 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lgt-assembly2.cif.gz_D | crystal structure of the catalytic domain of rlub in complex with a 21-nucleotide rna substrate | 0.7787 | 25 | 184 |
| 4lgt-assembly1.cif.gz_A | crystal structure of the catalytic domain of rlub in complex with a 21-nucleotide rna substrate | 0.7709 | 25 | 184 |
| 2gml-assembly2.cif.gz_B | crystal structure of catalytic domain of e.coli rluf | 0.7701 | 20 | 184 |
| 4lab-assembly1.cif.gz_A | crystal structure of the catalytic domain of rlub | 0.7662 | 16 | 184 |
| 1ksv-assembly1.cif.gz_A | structure of rsua | 0.7615 | 19 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gmlB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif | 0.8522 | 60 | 154 | 3.30.70.1560 |
| 2gmlB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif | 0.8311 | 60 | 154 | 3.30.70.1560 |
| 1ksvA02 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.7918 | 29 | 175 | 3.30.2350.10 |
| af_P75966_105_205_3.30.70.1560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif | 0.7773 | 59 | 161 | 3.30.70.1560 |
| af_Q2FY78_132_218_3.30.70.1560 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif | 0.7718 | 59 | 159 | 3.30.70.1560 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5WPS5-F1-model_v4 | 23S rRNA pseudouridine | 0.9158 | 31 | 183 |
GO:0001522
GO:0003723 GO:0006396 GO:0009982 GO:0140098 |
| AF-A0A7J5WPS5-F1-model_v4 | 23S rRNA pseudouridine | 0.8822 | 31 | 183 |
GO:0001522
GO:0003723 GO:0006396 GO:0009982 GO:0140098 |
| AF-A0A7C3U6G5-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.8738 | 29 | 179 |
GO:0000455
GO:0003723 GO:0120159 |
| AF-A0A2E3B5M3-F1-model_v4 | deleted | 0.8727 | 29 | 183 |
|
| AF-A0A535RYP0-F1-model_v4 | Pseudouridine synthase (EC 5.4.99.-) | 0.8694 | 29 | 180 |
GO:0000455
GO:0003723 GO:0120159 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar