F300081

General Info

Members Datasets Scaffolds Average Seq Length
195 127 186 198

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10147457|Ga0157371_101474572
Length 218
Sequence MNNLWIKDRKKPVRLSFMTSAKHRYFIINKPPNMVSQFISPDAVGLLGDLNYDFPEGIHAIGRLDSHSEGLLILTTNKKVTRLLFQGEVPHKRTYVVHVKHVITQEKLDLLRTGIPILVKGNTEYITTPCEVDIVEKPKGWLKLSKEPEDVPHTWLKITLTEGKYHQIRKMVLAAGHKCKRLIRMSIEDLEIGDLPPGGVLELEEEDFFRKLKIKNWR

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
122 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
126 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
127 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 0
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.74
Nodule 0
Rhizoplane 1.54
Rhizosphere 79.49
Stem 0
Stem Tuber 0
Unclassified 9.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10055237 3300003316 Bacteria 1072
2 rootH2_10057638 3300003320 Bacteria 2156
3 rootL2_10306156 3300003322 Bacteria 3154
4 rootH1_10112441 3300003323 Bacteria 9263
5 rootH1_10377488 3300003323 Bacteria 1519
6 Ga0055536_1010481 3300003781 Bacteria 3668
7 Ga0065165_1000185 3300005262 Bacteria 108984
8 Ga0065714_10086960 3300005288 Bacteria 2080
9 Ga0070680_100036633 3300005336 Bacteria 3963
10 Ga0070680_100286315 3300005336 Bacteria 1396
11 Ga0070680_100298732 3300005336 Bacteria 1365
12 Ga0070660_100006923 3300005339 Bacteria 7863
13 Ga0070660_100013445 3300005339 Bacteria 5872
14 Ga0070660_100028631 3300005339 Bacteria 4170
15 Ga0070660_100211552 3300005339 Bacteria 1574
16 Ga0070668_100681300 3300005347 Bacteria 905
17 Ga0070675_100016703 3300005354 Bacteria 5826
18 Ga0070673_100071804 3300005364 Unclassified 2782
19 Ga0070659_100017829 3300005366 Bacteria 5348
20 Ga0070678_100200449 3300005456 Bacteria 1647
21 Ga0070678_100513124 3300005456 Bacteria 1059
22 Ga0070681_10082279 3300005458 Bacteria 3174
23 Ga0070681_10818282 3300005458 Bacteria 849
24 Ga0068867_100170935 3300005459 Bacteria 1721
25 Ga0068867_100354541 3300005459 Bacteria 1225
26 Ga0070679_100079487 3300005530 Bacteria 3269
27 Ga0070679_100375526 3300005530 Bacteria 1368
28 Ga0070679_100397381 3300005530 Bacteria 1324
29 Ga0070679_100626711 3300005530 Bacteria 1018
30 Ga0068853_100016341 3300005539 Bacteria 6106
31 Ga0068853_100538668 3300005539 Bacteria 1105
32 Ga0070672_100288996 3300005543 Bacteria 1388
33 Ga0070665_100000002 3300005548 Bacteria 849037
34 Ga0070665_101146873 3300005548 Unclassified 788
35 Ga0068855_100027625 3300005563 Bacteria 6787
36 Ga0068855_100040646 3300005563 Bacteria 5519
37 Ga0068855_100043938 3300005563 Bacteria 5290
38 Ga0068857_100042604 3300005577 Bacteria 4028
39 Ga0068857_100145188 3300005577 Bacteria 2147
40 Ga0068856_100110065 3300005614 Bacteria 2751
41 Ga0068856_100218727 3300005614 Bacteria 1920
42 Ga0068852_100002354 3300005616 Bacteria 13017
43 Ga0068852_100812090 3300005616 Bacteria 950
44 Ga0068870_10223218 3300005840 Bacteria 1154
45 Ga0068860_100000019 3300005843 Bacteria 299860
46 Ga0068860_101049951 3300005843 Bacteria 833
47 Ga0068865_100698239 3300006881 Bacteria 867
48 Ga0105240_10047577 3300009093 Bacteria 5427
49 Ga0105240_10379000 3300009093 Bacteria 1598
50 Ga0105241_10010223 3300009174 Bacteria 6893
51 Ga0105241_10186649 3300009174 Bacteria 1724
52 Ga0105242_10937173 3300009176 Bacteria 869
53 Ga0105237_10000238 3300009545 Bacteria 78411
54 Ga0105237_10003156 3300009545 Bacteria 19825
55 Ga0105239_10002336 3300010375 Bacteria 24195
56 Ga0105239_10003044 3300010375 Bacteria 20839
57 Ga0105239_10267372 3300010375 Bacteria 1923
58 Ga0105239_10428471 3300010375 Bacteria 1499
59 Ga0157373_10007859 3300013100 Bacteria 7934
60 Ga0157371_10012508 3300013102 Bacteria 6486
61 Ga0157371_10024873 3300013102 Bacteria 4369
62 Ga0157371_10102764 3300013102 Bacteria 2028
63 Ga0157371_10112871 3300013102 Bacteria 1929
64 Ga0157371_10147457 3300013102 Bacteria 1677
65 Ga0157370_10008635 3300013104 Bacteria 10965
66 Ga0157370_10169327 3300013104 Unclassified 2031
67 Ga0157370_10231515 3300013104 Bacteria 1710
68 Ga0157370_10234953 3300013104 Bacteria 1696
69 Ga0157370_10254608 3300013104 Bacteria 1623
70 Ga0157370_10345075 3300013104 Bacteria 1372
71 Ga0157370_10777914 3300013104 Unclassified 871
72 Ga0157369_10030664 3300013105 Bacteria 5929
73 Ga0157369_10054754 3300013105 Bacteria 4307
74 Ga0157374_10449992 3300013296 Unclassified 1289
75 Ga0157378_10021958 3300013297 Bacteria 5613
76 Ga0157378_10665796 3300013297 Unclassified 1058
77 Ga0163162_10003984 3300013306 Bacteria 14163
78 Ga0163162_10010101 3300013306 Bacteria 9177
79 Ga0163162_10059409 3300013306 Bacteria 3855
80 Ga0163162_10283030 3300013306 Bacteria 1790
81 Ga0157372_10043009 3300013307 Bacteria 5000
82 Ga0157372_10149022 3300013307 Bacteria 2699
83 Ga0157372_10526908 3300013307 Bacteria 1377
84 Ga0157375_10161263 3300013308 Bacteria 2384
85 Ga0157375_11664484 3300013308 Bacteria 755
86 Ga0163163_10470741 3300014325 Bacteria 1317
87 Ga0163163_10779431 3300014325 Unclassified 1019
88 Ga0157380_10306818 3300014326 Bacteria 1465
89 Ga0182005_1000732 3300015265 Bacteria 15016
90 Ga0209436_104165 3300025208 Bacteria 3633
91 Ga0209130_1002546 3300025284 Bacteria 8920
92 Ga0209676_1000810 3300025292 Bacteria 40868
93 Ga0209758_1055992 3300025297 Bacteria 1335
94 Ga0207426_1000729 3300025302 Bacteria 37672
95 Ga0207426_1018392 3300025302 Bacteria 2462
96 Ga0207707_10056369 3300025912 Bacteria 3419
97 Ga0207695_10007644 3300025913 Bacteria 13696
98 Ga0207671_10000325 3300025914 Bacteria 70129
99 Ga0207671_10022150 3300025914 Bacteria 4808
100 Ga0207660_10036723 3300025917 Bacteria 3408
101 Ga0207660_10056087 3300025917 Unclassified 2818
102 Ga0207660_10349708 3300025917 Bacteria 1184
103 Ga0207660_10465377 3300025917 Bacteria 1023
104 Ga0207657_10005438 3300025919 Bacteria 13306
105 Ga0207657_10009552 3300025919 Bacteria 9737
106 Ga0207657_10196091 3300025919 Bacteria 1627
107 Ga0207649_10186781 3300025920 Bacteria 1455
108 Ga0207652_10044903 3300025921 Bacteria 3766
109 Ga0207652_10078623 3300025921 Bacteria 2880
110 Ga0207681_10604023 3300025923 Unclassified 907
111 Ga0207690_10079249 3300025932 Bacteria 2288
112 Ga0207690_10096328 3300025932 Bacteria 2104
113 Ga0207691_10011017 3300025940 Bacteria 8674
114 Ga0207691_10192200 3300025940 Bacteria 1780
115 Ga0207661_10308149 3300025944 Bacteria 1421
116 Ga0207667_10038141 3300025949 Bacteria 5133
117 Ga0207668_10447264 3300025972 Bacteria 1102
118 Ga0207640_10256501 3300025981 Bacteria 1360
119 Ga0207703_10795077 3300026035 Bacteria 903
120 Ga0207639_10101165 3300026041 Bacteria 2330
121 Ga0207641_10232497 3300026088 Unclassified 1714
122 Ga0207648_10051150 3300026089 Bacteria 3611
123 Ga0207648_10078744 3300026089 Unclassified 2875
124 Ga0207674_10103728 3300026116 Bacteria 2822
125 Ga0207674_10355916 3300026116 Bacteria 1415
126 Ga0207683_10202269 3300026121 Bacteria 1806
127 Ga0207683_10250263 3300026121 Bacteria 1617
128 Ga0207698_10004845 3300026142 Bacteria 8243
129 Ga0207698_10806490 3300026142 Bacteria 941
130 Ga0268266_10000022 3300028379 Bacteria 508060
131 Ga0268266_10777977 3300028379 Unclassified 924
132 Ga0268264_10000254 3300028381 Bacteria 98371
133 Ga0307517_10097202 3300028786 Unclassified 2353
134 Ga0307408_100449585 3300031548 Bacteria 1117
135 Ga0307516_10001745 3300031730 Bacteria 29897
136 Ga0307405_10006861 3300031731 Bacteria 5645
137 Ga0307412_10533736 3300031911 Unclassified 982
138 Ga0307507_10168978 3300033179 Unclassified 1594
139 Ga0307510_10008151 3300033180 Bacteria 12477
140 Ga0395899_0052377 3300037312 Bacteria 3025
141 Ga0395899_0375581 3300037312 Bacteria 946
142 Ga0395900_0424693 3300037418 Bacteria 1289
143 Ga0395898_0029824 3300037466 Bacteria 5460
144 Ga0395905_0196430 3300037471 Bacteria 1892
145 Ga0395901_0038964 3300038443 Bacteria 4916
146 Ga0451789_1082362 3300041443 Bacteria 1068
147 Ga0451795_1526924 3300041456 Bacteria 839
148 Ga0451833_0817675 3300041491 Bacteria 1022
149 Ga0439431_0016117 3300041997 Bacteria 1746
150 Ga0439449_0002074 3300042007 Bacteria 7879
151 Ga0466965_0394361 3300044683 Bacteria 764
152 Ga0495606_0003840 3300046507 Bacteria 15525
153 Ga0495648_0007262 3300046524 Bacteria 8894
154 Ga0495598_0049627 3300046537 Bacteria 1259
155 Ga0495633_0000019 3300046558 Bacteria 233769
156 Ga0495668_0000624 3300046616 Bacteria 42812
157 Ga0495668_0001215 3300046616 Bacteria 26081
158 Ga0495611_0000042 3300046648 Bacteria 94996
159 Ga0495625_0145378 3300046660 Bacteria 1597
160 Ga0495636_0000333 3300047318 Bacteria 18073
161 Ga0495687_000119 3300047443 Bacteria 121587
162 Ga0495686_0000046 3300047472 Bacteria 281963
163 Ga0496115_0557106 3300048918 Unclassified 915
164 Ga0496124_0081195 3300048927 Bacteria 2666
165 Ga0496125_0367873 3300048928 Bacteria 852
166 Ga0501032_0145577 3300049569 Bacteria 1560
167 Ga0501033_0138660 3300049570 Unclassified 1759
168 Ga0501033_0434558 3300049570 Unclassified 913
169 Ga0501034_0123026 3300049571 Bacteria 2580
170 Ga0501034_0186371 3300049571 Unclassified 2038
171 Ga0501034_0360459 3300049571 Bacteria 1381
172 Ga0501225_0073607 3300049705 Bacteria 973
173 Ga0501035_0115794 3300049822 Bacteria 2346
174 Ga0501044_0856719 3300049823 Bacteria 785
175 Ga0501044_1054576 3300049823 Bacteria 683
176 Ga0500644_0083070 3300053088 Unclassified 1182
177 Ga0500644_0120236 3300053088 Bacteria 1023
178 Ga0500651_0016284 3300053093 Bacteria 4572
179 Ga0500556_0021452 3300053104 Unclassified 2083
180 Ga0500562_027725 3300053108 Bacteria 1487
181 Ga0500588_0061019 3300053146 Bacteria 1208
182 Ga0500616_0001380 3300053153 Bacteria 23509
183 Ga0500622_0000372 3300053156 Bacteria 43235
184 Ga0500622_0003667 3300053156 Bacteria 10089
185 Ga0500627_0010024 3300053158 Bacteria 3440
186 Ga0500645_021482 3300053730 Bacteria 1992

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041456 Ga0451795_1526924 Ga0451795_1526924_23_511 159
2 3300025208 Ga0209436_104165 Ga0209436_1041652 172
3 3300025302 Ga0207426_1018392 Ga0207426_10183921 172
4 3300046660 Ga0495625_0145378 Ga0495625_0145378_501_1025 174
5 3300049705 Ga0501225_0073607 Ga0501225_0073607_370_954 174
6 3300049570 Ga0501033_0138660 Ga0501033_0138660_349_1044 175
7 iso_pu_bacteria 2818991460 2819679732 179
8 iso_pu_bacteria 2945977869 2945982917 180
9 3300005347 Ga0070668_100681300 Ga0070668_1006813002 182
10 3300005354 Ga0070675_100016703 Ga0070675_1000167034 182
11 3300005364 Ga0070673_100071804 Ga0070673_1000718042 182
12 3300005456 Ga0070678_100513124 Ga0070678_1005131242 182
13 3300005459 Ga0068867_100354541 Ga0068867_1003545412 182
14 3300005843 Ga0068860_101049951 Ga0068860_1010499512 182
15 3300013297 Ga0157378_10021958 Ga0157378_100219583 182
16 3300013308 Ga0157375_10161263 Ga0157375_101612633 182
17 3300014325 Ga0163163_10470741 Ga0163163_104707411 182
18 3300014326 Ga0157380_10306818 Ga0157380_103068181 182
19 3300025923 Ga0207681_10604023 Ga0207681_106040232 182
20 3300025940 Ga0207691_10011017 Ga0207691_1001101710 182
21 3300025972 Ga0207668_10447264 Ga0207668_104472642 182
22 3300026088 Ga0207641_10232497 Ga0207641_102324973 182
23 3300026089 Ga0207648_10078744 Ga0207648_100787443 182
24 3300026121 Ga0207683_10250263 Ga0207683_102502633 182
25 3300031911 Ga0307412_10533736 Ga0307412_105337361 182
26 3300053108 Ga0500562_027725 Ga0500562_027725_88_684 182
27 3300003322 rootL2_10306156 rootL2_103061562 183
28 3300003323 rootH1_10112441 rootH1_101124414 183
29 3300005288 Ga0065714_10086960 Ga0065714_100869602 183
30 3300005336 Ga0070680_100036633 Ga0070680_1000366334 183
31 3300005336 Ga0070680_100298732 Ga0070680_1002987322 183
32 3300005339 Ga0070660_100006923 Ga0070660_1000069235 183
33 3300005339 Ga0070660_100013445 Ga0070660_1000134455 183
34 3300005339 Ga0070660_100211552 Ga0070660_1002115522 183
35 3300005366 Ga0070659_100017829 Ga0070659_1000178292 183
36 3300005458 Ga0070681_10082279 Ga0070681_100822794 183
37 3300005459 Ga0068867_100170935 Ga0068867_1001709353 183
38 3300005530 Ga0070679_100079487 Ga0070679_1000794871 183
39 3300005530 Ga0070679_100375526 Ga0070679_1003755262 183
40 3300005530 Ga0070679_100397381 Ga0070679_1003973812 183
41 3300005563 Ga0068855_100027625 Ga0068855_1000276257 183
42 3300005563 Ga0068855_100043938 Ga0068855_1000439385 183
43 3300005577 Ga0068857_100042604 Ga0068857_1000426042 183
44 3300009545 Ga0105237_10000238 Ga0105237_1000023861 183
45 3300013100 Ga0157373_10007859 Ga0157373_100078595 183
46 3300013102 Ga0157371_10102764 Ga0157371_101027642 183
47 3300013102 Ga0157371_10147457 Ga0157371_101474572 183
48 3300013104 Ga0157370_10008635 Ga0157370_100086358 183
49 3300013104 Ga0157370_10169327 Ga0157370_101693272 183
50 3300013104 Ga0157370_10234953 Ga0157370_102349532 183
51 3300013104 Ga0157370_10777914 Ga0157370_107779141 183
52 3300013105 Ga0157369_10054754 Ga0157369_100547544 183
53 3300013307 Ga0157372_10043009 Ga0157372_100430092 183
54 3300013307 Ga0157372_10149022 Ga0157372_101490223 183
55 3300025912 Ga0207707_10056369 Ga0207707_100563692 183
56 3300025914 Ga0207671_10000325 Ga0207671_1000032522 183
57 3300025917 Ga0207660_10036723 Ga0207660_100367233 183
58 3300025917 Ga0207660_10465377 Ga0207660_104653772 183
59 3300025919 Ga0207657_10005438 Ga0207657_1000543811 183
60 3300025919 Ga0207657_10009552 Ga0207657_100095529 183
61 3300025919 Ga0207657_10196091 Ga0207657_101960912 183
62 3300025921 Ga0207652_10044903 Ga0207652_100449035 183
63 3300025932 Ga0207690_10079249 Ga0207690_100792492 183
64 3300025932 Ga0207690_10096328 Ga0207690_100963282 183
65 3300025944 Ga0207661_10308149 Ga0207661_103081492 183
66 3300025949 Ga0207667_10038141 Ga0207667_100381413 183
67 3300026089 Ga0207648_10051150 Ga0207648_100511504 183
68 3300026116 Ga0207674_10355916 Ga0207674_103559162 183
69 3300026121 Ga0207683_10202269 Ga0207683_102022692 183
70 3300037312 Ga0395899_0052377 Ga0395899_0052377_1772_2362 183
71 3300037312 Ga0395899_0375581 Ga0395899_0375581_70_660 183
72 3300037418 Ga0395900_0424693 Ga0395900_0424693_194_784 183
73 3300037466 Ga0395898_0029824 Ga0395898_0029824_3826_4416 183
74 3300038443 Ga0395901_0038964 Ga0395901_0038964_1541_2131 183
75 3300046616 Ga0495668_0000624 Ga0495668_0000624_35151_35879 183
76 3300048928 Ga0496125_0367873 Ga0496125_0367873_16_621 183
77 3300049569 Ga0501032_0145577 Ga0501032_0145577_597_1211 183
78 3300049570 Ga0501033_0434558 Ga0501033_0434558_66_656 183
79 3300049571 Ga0501034_0123026 Ga0501034_0123026_38_589 183
80 3300049571 Ga0501034_0360459 Ga0501034_0360459_455_1045 183
81 3300049822 Ga0501035_0115794 Ga0501035_0115794_870_1484 183
82 3300049823 Ga0501044_1054576 Ga0501044_1054576_43_633 183
83 3300053104 Ga0500556_0021452 Ga0500556_0021452_1280_2008 183
84 3300053153 Ga0500616_0001380 Ga0500616_0001380_22888_23463 183
85 3300053158 Ga0500627_0010024 Ga0500627_0010024_2808_3422 183
86 3300003316 rootH1_10055237 rootH1_100552371 184
87 3300003320 rootH2_10057638 rootH2_100576382 184
88 3300003323 rootH1_10377488 rootH1_103774882 184
89 3300003781 Ga0055536_1010481 Ga0055536_10104815 184
90 3300005262 Ga0065165_1000185 Ga0065165_100018557 184
91 3300005336 Ga0070680_100286315 Ga0070680_1002863153 184
92 3300005339 Ga0070660_100028631 Ga0070660_1000286314 184
93 3300005456 Ga0070678_100200449 Ga0070678_1002004491 184
94 3300005458 Ga0070681_10818282 Ga0070681_108182821 184
95 3300005530 Ga0070679_100626711 Ga0070679_1006267112 184
96 3300005539 Ga0068853_100016341 Ga0068853_1000163418 184
97 3300005539 Ga0068853_100538668 Ga0068853_1005386681 184
98 3300005543 Ga0070672_100288996 Ga0070672_1002889962 184
99 3300005548 Ga0070665_100000002 Ga0070665_100000002203 184
100 3300005548 Ga0070665_101146873 Ga0070665_1011468731 184
101 3300005563 Ga0068855_100040646 Ga0068855_1000406463 184
102 3300005577 Ga0068857_100145188 Ga0068857_1001451882 184
103 3300005614 Ga0068856_100110065 Ga0068856_1001100652 184
104 3300005614 Ga0068856_100218727 Ga0068856_1002187271 184
105 3300005616 Ga0068852_100002354 Ga0068852_10000235413 184
106 3300005616 Ga0068852_100812090 Ga0068852_1008120901 184
107 3300005840 Ga0068870_10223218 Ga0068870_102232181 184
108 3300005843 Ga0068860_100000019 Ga0068860_100000019185 184
109 3300006881 Ga0068865_100698239 Ga0068865_1006982392 184
110 3300009093 Ga0105240_10047577 Ga0105240_100475772 184
111 3300009093 Ga0105240_10379000 Ga0105240_103790002 184
112 3300009174 Ga0105241_10010223 Ga0105241_100102234 184
113 3300009174 Ga0105241_10186649 Ga0105241_101866492 184
114 3300009176 Ga0105242_10937173 Ga0105242_109371731 184
115 3300009545 Ga0105237_10003156 Ga0105237_1000315620 184
116 3300010375 Ga0105239_10002336 Ga0105239_1000233621 184
117 3300010375 Ga0105239_10003044 Ga0105239_100030446 184
118 3300010375 Ga0105239_10267372 Ga0105239_102673722 184
119 3300010375 Ga0105239_10428471 Ga0105239_104284712 184
120 3300013102 Ga0157371_10012508 Ga0157371_100125083 184
121 3300013102 Ga0157371_10024873 Ga0157371_100248732 184
122 3300013102 Ga0157371_10112871 Ga0157371_101128711 184
123 3300013104 Ga0157370_10231515 Ga0157370_102315152 184
124 3300013104 Ga0157370_10254608 Ga0157370_102546083 184
125 3300013104 Ga0157370_10345075 Ga0157370_103450753 184
126 3300013105 Ga0157369_10030664 Ga0157369_100306644 184
127 3300013296 Ga0157374_10449992 Ga0157374_104499922 184
128 3300013297 Ga0157378_10665796 Ga0157378_106657961 184
129 3300013306 Ga0163162_10003984 Ga0163162_100039844 184
130 3300013306 Ga0163162_10010101 Ga0163162_100101019 184
131 3300013306 Ga0163162_10059409 Ga0163162_100594092 184
132 3300013306 Ga0163162_10283030 Ga0163162_102830301 184
133 3300013307 Ga0157372_10526908 Ga0157372_105269082 184
134 3300013308 Ga0157375_11664484 Ga0157375_116644841 184
135 3300014325 Ga0163163_10779431 Ga0163163_107794312 184
136 3300015265 Ga0182005_1000732 Ga0182005_100073211 184
137 3300025284 Ga0209130_1002546 Ga0209130_10025462 184
138 3300025292 Ga0209676_1000810 Ga0209676_100081025 184
139 3300025297 Ga0209758_1055992 Ga0209758_10559922 184
140 3300025302 Ga0207426_1000729 Ga0207426_100072930 184
141 3300025913 Ga0207695_10007644 Ga0207695_100076441 184
142 3300025914 Ga0207671_10022150 Ga0207671_100221502 184
143 3300025917 Ga0207660_10056087 Ga0207660_100560872 184
144 3300025917 Ga0207660_10349708 Ga0207660_103497082 184
145 3300025920 Ga0207649_10186781 Ga0207649_101867811 184
146 3300025921 Ga0207652_10078623 Ga0207652_100786233 184
147 3300025940 Ga0207691_10192200 Ga0207691_101922002 184
148 3300025981 Ga0207640_10256501 Ga0207640_102565013 184
149 3300026035 Ga0207703_10795077 Ga0207703_107950772 184
150 3300026041 Ga0207639_10101165 Ga0207639_101011653 184
151 3300026116 Ga0207674_10103728 Ga0207674_101037282 184
152 3300026142 Ga0207698_10004845 Ga0207698_100048456 184
153 3300026142 Ga0207698_10806490 Ga0207698_108064902 184
154 3300028379 Ga0268266_10000022 Ga0268266_10000022234 184
155 3300028379 Ga0268266_10777977 Ga0268266_107779771 184
156 3300028381 Ga0268264_10000254 Ga0268264_1000025425 184
157 3300028786 Ga0307517_10097202 Ga0307517_100972023 184
158 3300031548 Ga0307408_100449585 Ga0307408_1004495852 184
159 3300031730 Ga0307516_10001745 Ga0307516_1000174524 184
160 3300031731 Ga0307405_10006861 Ga0307405_100068615 184
161 3300033179 Ga0307507_10168978 Ga0307507_101689781 184
162 3300033180 Ga0307510_10008151 Ga0307510_100081516 184
163 3300037471 Ga0395905_0196430 Ga0395905_0196430_257_820 184
164 3300041443 Ga0451789_1082362 Ga0451789_1082362_429_1001 184
165 3300041491 Ga0451833_0817675 Ga0451833_0817675_231_803 184
166 3300041997 Ga0439431_0016117 Ga0439431_0016117_324_944 184
167 3300042007 Ga0439449_0002074 Ga0439449_0002074_2342_2977 184
168 3300044683 Ga0466965_0394361 Ga0466965_0394361_58_702 184
169 3300046507 Ga0495606_0003840 Ga0495606_0003840_12607_13206 184
170 3300046524 Ga0495648_0007262 Ga0495648_0007262_3197_3799 184
171 3300046537 Ga0495598_0049627 Ga0495598_0049627_250_861 184
172 3300046558 Ga0495633_0000019 Ga0495633_0000019_91647_92282 184
173 3300046616 Ga0495668_0001215 Ga0495668_0001215_10250_10840 184
174 3300046648 Ga0495611_0000042 Ga0495611_0000042_52462_53079 184
175 3300047318 Ga0495636_0000333 Ga0495636_0000333_7562_8173 184
176 3300047443 Ga0495687_000119 Ga0495687_000119_62425_63030 184
177 3300047472 Ga0495686_0000046 Ga0495686_0000046_236878_237483 184
178 3300048918 Ga0496115_0557106 Ga0496115_0557106_98_730 184
179 3300048927 Ga0496124_0081195 Ga0496124_0081195_651_1259 184
180 3300049571 Ga0501034_0186371 Ga0501034_0186371_1378_1989 184
181 3300049823 Ga0501044_0856719 Ga0501044_0856719_203_763 184
182 3300053088 Ga0500644_0083070 Ga0500644_0083070_523_1125 184
183 3300053088 Ga0500644_0120236 Ga0500644_0120236_187_756 184
184 3300053093 Ga0500651_0016284 Ga0500651_0016284_863_1498 184
185 3300053146 Ga0500588_0061019 Ga0500588_0061019_428_1033 184
186 3300053156 Ga0500622_0000372 Ga0500622_0000372_25718_26332 184
187 3300053156 Ga0500622_0003667 Ga0500622_0003667_8790_9392 184
188 3300053730 Ga0500645_021482 Ga0500645_021482_417_1031 184
189 iso_pu_bacteria 2522125168 2522552738 184
190 iso_pu_bacteria 2818991444 2819585505 184
191 iso_pu_bacteria 2821136567 2821139210 184
192 iso_pu_bacteria 2904467357 2904473228 184
193 iso_pu_bacteria 2929154850 2929156151 184
194 iso_pu_bacteria 2929177148 2929180532 184
195 iso_pu_bacteria 2946013367 2946017690 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

24

174

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgt-assembly2.cif.gz_D crystal structure of the catalytic domain of rlub in complex with a 21-nucleotide rna substrate 0.7787 25 184
4lgt-assembly1.cif.gz_A crystal structure of the catalytic domain of rlub in complex with a 21-nucleotide rna substrate 0.7709 25 184
2gml-assembly2.cif.gz_B crystal structure of catalytic domain of e.coli rluf 0.7701 20 184
4lab-assembly1.cif.gz_A crystal structure of the catalytic domain of rlub 0.7662 16 184
1ksv-assembly1.cif.gz_A structure of rsua 0.7615 19 175
ID Description Score Start End Superfamily
2gmlB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif 0.8522 60 154 3.30.70.1560
2gmlB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif 0.8311 60 154 3.30.70.1560
1ksvA02 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.7918 29 175 3.30.2350.10
af_P75966_105_205_3.30.70.1560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif 0.7773 59 161 3.30.70.1560
af_Q2FY78_132_218_3.30.70.1560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Alpha-L RNA-binding motif 0.7718 59 159 3.30.70.1560
ID Description Score Start End GO Terms
AF-A0A7J5WPS5-F1-model_v4 23S rRNA pseudouridine 0.9158 31 183 GO:0001522
GO:0003723
GO:0006396
GO:0009982
GO:0140098
AF-A0A7J5WPS5-F1-model_v4 23S rRNA pseudouridine 0.8822 31 183 GO:0001522
GO:0003723
GO:0006396
GO:0009982
GO:0140098
AF-A0A7C3U6G5-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.8738 29 179 GO:0000455
GO:0003723
GO:0120159
AF-A0A2E3B5M3-F1-model_v4 deleted 0.8727 29 183
AF-A0A535RYP0-F1-model_v4 Pseudouridine synthase (EC 5.4.99.-) 0.8694 29 180 GO:0000455
GO:0003723
GO:0120159

Feature Viewer

pLDDT pTM Quality
83.23 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map