F300034

General Info

Members Datasets Scaffolds Average Seq Length
195 157 195 73

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10606019|Ga0105243_106060191
Length 85
Sequence MWFRFPGKQGETMAPVRIVGIVLIVAGVLALAYGGFSFTKETHKAEIGPLKLSVAEKENVNVPQWAGIAALVAGVVMVVVGGKKG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
98 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
99 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 0.51
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100929979 3300005330 Bacteria 681
2 Ga0070670_100489572 3300005331 Bacteria 1093
3 Ga0070670_100709304 3300005331 Bacteria 905
4 Ga0070677_10089682 3300005333 Bacteria 1334
5 Ga0070677_10266247 3300005333 Bacteria 857
6 Ga0070666_10575937 3300005335 Bacteria 820
7 Ga0070680_101754534 3300005336 Unclassified 538
8 Ga0070687_100218943 3300005343 Bacteria 1165
9 Ga0070687_100223085 3300005343 Bacteria 1156
10 Ga0070692_10256755 3300005345 Bacteria 1049
11 Ga0070675_100486950 3300005354 Bacteria 1110
12 Ga0070674_100212054 3300005356 Bacteria 1502
13 Ga0070674_100286392 3300005356 Unclassified 1308
14 Ga0070688_100145267 3300005365 Bacteria 1615
15 Ga0070659_101145367 3300005366 Unclassified 687
16 Ga0070667_101375253 3300005367 Bacteria 662
17 Ga0070713_100166843 3300005436 Bacteria 1969
18 Ga0070701_10914079 3300005438 Bacteria 607
19 Ga0070705_100073675 3300005440 Bacteria 2073
20 Ga0070705_100669883 3300005440 Unclassified 811
21 Ga0070700_101234391 3300005441 Bacteria 625
22 Ga0070694_101304174 3300005444 Bacteria 611
23 Ga0070694_101532130 3300005444 Bacteria 565
24 Ga0070708_101839692 3300005445 Bacteria 562
25 Ga0070678_100267413 3300005456 Bacteria 1441
26 Ga0070678_100534834 3300005456 Bacteria 1038
27 Ga0068867_100450509 3300005459 Bacteria 1096
28 Ga0070685_10269035 3300005466 Bacteria 1136
29 Ga0070707_100345778 3300005468 Bacteria 1445
30 Ga0070698_100334901 3300005471 Bacteria 1445
31 Ga0070698_100368437 3300005471 Bacteria 1368
32 Ga0070698_101338332 3300005471 Bacteria 666
33 Ga0070698_102215068 3300005471 Bacteria 503
34 Ga0070699_100032102 3300005518 Bacteria 4535
35 Ga0070697_100439338 3300005536 Bacteria 1135
36 Ga0070672_100437887 3300005543 Bacteria 1125
37 Ga0070672_100837887 3300005543 Unclassified 810
38 Ga0070686_100183023 3300005544 Bacteria 1490
39 Ga0070686_101166504 3300005544 Bacteria 639
40 Ga0070695_100458929 3300005545 Unclassified 978
41 Ga0070695_101067196 3300005545 Bacteria 660
42 Ga0070696_100294083 3300005546 Bacteria 1242
43 Ga0070696_100309828 3300005546 Bacteria 1212
44 Ga0070693_100151645 3300005547 Bacteria 1469
45 Ga0070665_100867660 3300005548 Bacteria 915
46 Ga0068855_100070036 3300005563 Bacteria 4081
47 Ga0068855_102102409 3300005563 Unclassified 569
48 Ga0068852_102672535 3300005616 Unclassified 518
49 Ga0068859_101562092 3300005617 Unclassified 729
50 Ga0068866_10576800 3300005718 Bacteria 756
51 Ga0068863_101017252 3300005841 Bacteria 832
52 Ga0068858_100889751 3300005842 Bacteria 870
53 Ga0068860_100100946 3300005843 Bacteria 2753
54 Ga0068862_101671733 3300005844 Unclassified 645
55 Ga0081539_10237960 3300005985 Bacteria 817
56 Ga0075364_10070937 3300006051 Bacteria 2294
57 Ga0075432_10101889 3300006058 Bacteria 1061
58 Ga0075432_10585186 3300006058 Bacteria 508
59 Ga0075362_10763960 3300006177 Bacteria 507
60 Ga0075367_10319334 3300006178 Bacteria 978
61 Ga0075366_10014277 3300006195 Bacteria 4535
62 Ga0075366_11057164 3300006195 Unclassified 507
63 Ga0075370_10357262 3300006353 Bacteria 873
64 Ga0068871_100125356 3300006358 Bacteria 2173
65 Ga0075434_100100010 3300006871 Bacteria 2905
66 Ga0075434_100327044 3300006871 Bacteria 1553
67 Ga0075429_101971016 3300006880 Bacteria 506
68 Ga0068865_101246173 3300006881 Unclassified 660
69 Ga0075436_100044808 3300006914 Bacteria 3051
70 Ga0097620_101562241 3300006931 Unclassified 729
71 Ga0075435_100241129 3300007076 Bacteria 1538
72 Ga0111539_12897482 3300009094 Bacteria 555
73 Ga0105245_10456646 3300009098 Bacteria 1287
74 Ga0105245_10675552 3300009098 Unclassified 1064
75 Ga0105245_10947748 3300009098 Bacteria 904
76 Ga0105245_12193499 3300009098 Bacteria 606
77 Ga0105243_10053545 3300009148 Bacteria 3201
78 Ga0105243_10606019 3300009148 Bacteria 1055
79 Ga0105242_10030444 3300009176 Bacteria 4308
80 Ga0105242_10379366 3300009176 Bacteria 1314
81 Ga0105249_10564103 3300009553 Unclassified 1190
82 Ga0105249_12848615 3300009553 Bacteria 555
83 Ga0157339_1049529 3300012505 Unclassified 552
84 Ga0157371_11588095 3300013102 Bacteria 512
85 Ga0157370_10017241 3300013104 Bacteria 7289
86 Ga0157378_10223931 3300013297 Bacteria 1789
87 Ga0157378_10704936 3300013297 Unclassified 1029
88 Ga0157378_11775092 3300013297 Unclassified 665
89 Ga0163162_10062993 3300013306 Bacteria 3750
90 Ga0163162_10201728 3300013306 Bacteria 2118
91 Ga0157375_13495231 3300013308 Unclassified 523
92 Ga0157380_11439562 3300014326 Bacteria 741
93 Ga0157379_10041412 3300014968 Bacteria 4112
94 Ga0157379_10807145 3300014968 Bacteria 886
95 Ga0157379_11204365 3300014968 Bacteria 728
96 Ga0157376_10332240 3300014969 Bacteria 1449
97 Ga0163161_10627688 3300017792 Bacteria 888
98 Ga0207682_10052591 3300025893 Bacteria 1688
99 Ga0207682_10293351 3300025893 Unclassified 762
100 Ga0207642_10491887 3300025899 Bacteria 750
101 Ga0207645_10516126 3300025907 Bacteria 809
102 Ga0207695_11626132 3300025913 Bacteria 527
103 Ga0207663_11519523 3300025916 Bacteria 539
104 Ga0207662_10102478 3300025918 Bacteria 1775
105 Ga0207646_10294962 3300025922 Bacteria 1465
106 Ga0207694_11125695 3300025924 Bacteria 664
107 Ga0207650_10627954 3300025925 Bacteria 905
108 Ga0207659_10457807 3300025926 Bacteria 1075
109 Ga0207687_10836256 3300025927 Bacteria 786
110 Ga0207700_10124005 3300025928 Bacteria 2098
111 Ga0207644_10636995 3300025931 Bacteria 887
112 Ga0207686_10012827 3300025934 Bacteria 4617
113 Ga0207669_10758950 3300025937 Unclassified 802
114 Ga0207669_10984282 3300025937 Bacteria 708
115 Ga0207691_11504594 3300025940 Unclassified 550
116 Ga0207667_10022600 3300025949 Bacteria 6941
117 Ga0207651_10648624 3300025960 Bacteria 927
118 Ga0207668_12089176 3300025972 Unclassified 510
119 Ga0207703_10010737 3300026035 Bacteria 7148
120 Ga0207708_10933405 3300026075 Bacteria 752
121 Ga0207708_11827563 3300026075 Bacteria 533
122 Ga0207648_11284061 3300026089 Unclassified 688
123 Ga0207648_11757930 3300026089 Bacteria 582
124 Ga0207674_11751639 3300026116 Bacteria 589
125 Ga0207683_10287973 3300026121 Bacteria 1502
126 Ga0207683_10484115 3300026121 Bacteria 1142
127 Ga0210002_1064835 3300027617 Unclassified 640
128 Ga0209813_10173214 3300027866 Bacteria 785
129 Ga0207428_10002938 3300027907 Bacteria 16889
130 Ga0268264_10037236 3300028381 Bacteria 4011
131 Ga0316177_1143800 3300030731 Bacteria 4118
132 Ga0316180_1042597 3300030736 Bacteria 1871
133 Ga0316182_1069225 3300030745 Bacteria 1480
134 Ga0307516_10210518 3300031730 Bacteria 1659
135 Ga0307405_10896044 3300031731 Bacteria 750
136 Ga0307413_10508207 3300031824 Bacteria 969
137 Ga0307410_10512524 3300031852 Bacteria 989
138 Ga0307412_10812019 3300031911 Bacteria 813
139 Ga0307409_101566955 3300031995 Unclassified 687
140 Ga0307416_101243983 3300032002 Bacteria 850
141 Ga0307416_101873565 3300032002 Bacteria 703
142 Ga0307411_10396241 3300032005 Bacteria 1140
143 Ga0307411_11063850 3300032005 Bacteria 727
144 Ga0373923_0259058 3300035111 Unclassified 816
145 Ga0373957_0144336 3300035120 Bacteria 975
146 Ga0373931_0434491 3300035691 Bacteria 837
147 Ga0373933_0086240 3300035724 Unclassified 1932
148 Ga0373937_1010489 3300036401 Bacteria 780
149 Ga0436365_1228133 3300039437 Bacteria 3371
150 Ga0451802_1882080 3300041460 Bacteria 598
151 Ga0439443_004442 3300042003 Bacteria 1825
152 Ga0439460_0177874 3300042461 Bacteria 718
153 Ga0451577_0460085 3300042876 Bacteria 1155
154 Ga0453683_0978130 3300044673 Bacteria 561
155 Ga0451576_0524863 3300045051 Bacteria 1244
156 Ga0451576_1227575 3300045051 Bacteria 782
157 Ga0495627_000552 3300046453 Bacteria 30847
158 Ga0495605_0000046 3300046474 Bacteria 175985
159 Ga0495596_0017041 3300046500 Bacteria 3013
160 Ga0495607_0002744 3300046501 Bacteria 14043
161 Ga0495616_0007334 3300046513 Bacteria 6600
162 Ga0495631_0020609 3300046518 Bacteria 3078
163 Ga0495644_0020735 3300046523 Bacteria 2507
164 Ga0495648_0000754 3300046524 Bacteria 34587
165 Ga0495642_0000050 3300046528 Bacteria 71246
166 Ga0495654_0116224 3300046530 Bacteria 1215
167 Ga0495587_0763833 3300046536 Unclassified 529
168 Ga0495609_0051891 3300046538 Bacteria 1825
169 Ga0495621_0037380 3300046539 Bacteria 1688
170 Ga0495633_0117899 3300046558 Bacteria 1230
171 Ga0495656_0014157 3300046615 Bacteria 2985
172 Ga0495668_0001454 3300046616 Bacteria 22820
173 Ga0495611_0015079 3300046648 Bacteria 3303
174 Ga0495659_0486624 3300046664 Bacteria 540
175 Ga0495661_0008930 3300046665 Bacteria 6901
176 Ga0495669_0029071 3300046684 Bacteria 2422
177 Ga0495670_0228972 3300046691 Bacteria 988
178 Ga0495671_0000565 3300046692 Bacteria 27666
179 Ga0495589_0037095 3300046794 Bacteria 2442
180 Ga0495677_0003942 3300047445 Bacteria 5732
181 Ga0495681_0046964 3300047470 Bacteria 2056
182 Ga0495686_0023016 3300047472 Bacteria 4116
183 Ga0495602_0528349 3300048088 Unclassified 821
184 Ga0501076_0466387 3300049592 Bacteria 1040
185 Ga0501249_098591 3300049679 Bacteria 698
186 nmdc:mga03n38_282498_c1 3300050490 Bacteria 886
187 nmdc:mga0yw44_60865_c1 3300050492 Bacteria 2314
188 nmdc:mga0k408_15070_c1 3300050493 Bacteria 4273
189 nmdc:mga06z11_75996_c1 3300050494 Bacteria 1790
190 nmdc:mga04h51_200426_c1 3300050495 Bacteria 784
191 nmdc:mga0n895_309245_c1 3300050512 Bacteria 1602
192 nmdc:mga0n895_375915_c1 3300050512 Bacteria 1438
193 nmdc:mga0rr50_456159_c1 3300050513 Bacteria 1084
194 nmdc:mga08x19_51430_c1 3300050514 Bacteria 2647
195 Ga0590075_208990 3300059424 Bacteria 517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100489572 Ga0070670_1004895721 68
2 3300035111 Ga0373923_0259058 Ga0373923_0259058_160_366 68
3 3300035724 Ga0373933_0086240 Ga0373933_0086240_776_982 68
4 3300026075 Ga0207708_11827563 Ga0207708_118275631 69
5 3300013306 Ga0163162_10201728 Ga0163162_102017281 70
6 3300014968 Ga0157379_10807145 Ga0157379_108071451 70
7 3300005436 Ga0070713_100166843 Ga0070713_1001668433 71
8 3300005440 Ga0070705_100073675 Ga0070705_1000736752 71
9 3300005445 Ga0070708_101839692 Ga0070708_1018396921 71
10 3300005456 Ga0070678_100267413 Ga0070678_1002674132 71
11 3300005468 Ga0070707_100345778 Ga0070707_1003457781 71
12 3300005471 Ga0070698_101338332 Ga0070698_1013383322 71
13 3300005518 Ga0070699_100032102 Ga0070699_1000321024 71
14 3300025916 Ga0207663_11519523 Ga0207663_115195232 71
15 3300025922 Ga0207646_10294962 Ga0207646_102949622 71
16 3300025928 Ga0207700_10124005 Ga0207700_101240051 71
17 3300026121 Ga0207683_10484115 Ga0207683_104841152 71
18 3300041460 Ga0451802_1882080 Ga0451802_1882080_10_225 71
19 3300005331 Ga0070670_100709304 Ga0070670_1007093043 72
20 3300005333 Ga0070677_10089682 Ga0070677_100896821 72
21 3300005343 Ga0070687_100223085 Ga0070687_1002230851 72
22 3300005354 Ga0070675_100486950 Ga0070675_1004869501 72
23 3300005366 Ga0070659_101145367 Ga0070659_1011453671 72
24 3300005367 Ga0070667_101375253 Ga0070667_1013752532 72
25 3300005438 Ga0070701_10914079 Ga0070701_109140791 72
26 3300005441 Ga0070700_101234391 Ga0070700_1012343911 72
27 3300005444 Ga0070694_101304174 Ga0070694_1013041741 72
28 3300005456 Ga0070678_100534834 Ga0070678_1005348342 72
29 3300005471 Ga0070698_100334901 Ga0070698_1003349012 72
30 3300005471 Ga0070698_100368437 Ga0070698_1003684372 72
31 3300005471 Ga0070698_102215068 Ga0070698_1022150681 72
32 3300005536 Ga0070697_100439338 Ga0070697_1004393381 72
33 3300005544 Ga0070686_100183023 Ga0070686_1001830231 72
34 3300005544 Ga0070686_101166504 Ga0070686_1011665041 72
35 3300005546 Ga0070696_100294083 Ga0070696_1002940832 72
36 3300005548 Ga0070665_100867660 Ga0070665_1008676602 72
37 3300005718 Ga0068866_10576800 Ga0068866_105768001 72
38 3300005841 Ga0068863_101017252 Ga0068863_1010172523 72
39 3300005842 Ga0068858_100889751 Ga0068858_1008897511 72
40 3300005843 Ga0068860_100100946 Ga0068860_1001009465 72
41 3300006051 Ga0075364_10070937 Ga0075364_100709373 72
42 3300006058 Ga0075432_10101889 Ga0075432_101018892 72
43 3300006058 Ga0075432_10585186 Ga0075432_105851861 72
44 3300006195 Ga0075366_10014277 Ga0075366_100142774 72
45 3300006881 Ga0068865_101246173 Ga0068865_1012461731 72
46 3300009098 Ga0105245_10947748 Ga0105245_109477482 72
47 3300009098 Ga0105245_12193499 Ga0105245_121934991 72
48 3300009148 Ga0105243_10053545 Ga0105243_100535455 72
49 3300009176 Ga0105242_10030444 Ga0105242_100304445 72
50 3300013297 Ga0157378_10223931 Ga0157378_102239312 72
51 3300013306 Ga0163162_10062993 Ga0163162_100629932 72
52 3300014326 Ga0157380_11439562 Ga0157380_114395621 72
53 3300014968 Ga0157379_10041412 Ga0157379_100414126 72
54 3300014968 Ga0157379_11204365 Ga0157379_112043651 72
55 3300017792 Ga0163161_10627688 Ga0163161_106276881 72
56 3300025893 Ga0207682_10052591 Ga0207682_100525912 72
57 3300025899 Ga0207642_10491887 Ga0207642_104918872 72
58 3300025907 Ga0207645_10516126 Ga0207645_105161261 72
59 3300025924 Ga0207694_11125695 Ga0207694_111256952 72
60 3300025925 Ga0207650_10627954 Ga0207650_106279543 72
61 3300025934 Ga0207686_10012827 Ga0207686_100128273 72
62 3300025960 Ga0207651_10648624 Ga0207651_106486242 72
63 3300026035 Ga0207703_10010737 Ga0207703_100107373 72
64 3300026075 Ga0207708_10933405 Ga0207708_109334051 72
65 3300026116 Ga0207674_11751639 Ga0207674_117516391 72
66 3300026121 Ga0207683_10287973 Ga0207683_102879732 72
67 3300027907 Ga0207428_10002938 Ga0207428_100029389 72
68 3300028381 Ga0268264_10037236 Ga0268264_100372366 72
69 3300031730 Ga0307516_10210518 Ga0307516_102105183 72
70 3300031731 Ga0307405_10896044 Ga0307405_108960442 72
71 3300031824 Ga0307413_10508207 Ga0307413_105082071 72
72 3300031852 Ga0307410_10512524 Ga0307410_105125241 72
73 3300031911 Ga0307412_10812019 Ga0307412_108120192 72
74 3300031995 Ga0307409_101566955 Ga0307409_1015669551 72
75 3300032002 Ga0307416_101243983 Ga0307416_1012439831 72
76 3300032005 Ga0307411_10396241 Ga0307411_103962412 72
77 3300032005 Ga0307411_11063850 Ga0307411_110638502 72
78 3300035691 Ga0373931_0434491 Ga0373931_0434491_389_607 72
79 3300044673 Ga0453683_0978130 Ga0453683_0978130_169_387 72
80 3300046453 Ga0495627_000552 Ga0495627_000552_17636_17854 72
81 3300046474 Ga0495605_0000046 Ga0495605_0000046_12565_12783 72
82 3300046500 Ga0495596_0017041 Ga0495596_0017041_2273_2491 72
83 3300046501 Ga0495607_0002744 Ga0495607_0002744_9361_9579 72
84 3300046513 Ga0495616_0007334 Ga0495616_0007334_2251_2469 72
85 3300046518 Ga0495631_0020609 Ga0495631_0020609_1992_2210 72
86 3300046523 Ga0495644_0020735 Ga0495644_0020735_1767_1985 72
87 3300046524 Ga0495648_0000754 Ga0495648_0000754_10938_11156 72
88 3300046528 Ga0495642_0000050 Ga0495642_0000050_9972_10190 72
89 3300046530 Ga0495654_0116224 Ga0495654_0116224_413_631 72
90 3300046536 Ga0495587_0763833 Ga0495587_0763833_106_324 72
91 3300046538 Ga0495609_0051891 Ga0495609_0051891_325_543 72
92 3300046539 Ga0495621_0037380 Ga0495621_0037380_617_835 72
93 3300046558 Ga0495633_0117899 Ga0495633_0117899_708_926 72
94 3300046615 Ga0495656_0014157 Ga0495656_0014157_925_1143 72
95 3300046616 Ga0495668_0001454 Ga0495668_0001454_10515_10733 72
96 3300046648 Ga0495611_0015079 Ga0495611_0015079_348_566 72
97 3300046664 Ga0495659_0486624 Ga0495659_0486624_33_251 72
98 3300046665 Ga0495661_0008930 Ga0495661_0008930_4926_5144 72
99 3300046684 Ga0495669_0029071 Ga0495669_0029071_1086_1304 72
100 3300046691 Ga0495670_0228972 Ga0495670_0228972_660_878 72
101 3300046692 Ga0495671_0000565 Ga0495671_0000565_9320_9538 72
102 3300046794 Ga0495589_0037095 Ga0495589_0037095_2074_2292 72
103 3300047445 Ga0495677_0003942 Ga0495677_0003942_716_934 72
104 3300047470 Ga0495681_0046964 Ga0495681_0046964_336_554 72
105 3300047472 Ga0495686_0023016 Ga0495686_0023016_976_1194 72
106 3300048088 Ga0495602_0528349 Ga0495602_0528349_294_512 72
107 3300050493 nmdc:mga0k408_15070_c1 nmdc:mga0k408_15070_c1_3161_3379 72
108 3300005330 Ga0070690_100929979 Ga0070690_1009299791 73
109 3300005333 Ga0070677_10266247 Ga0070677_102662471 73
110 3300005335 Ga0070666_10575937 Ga0070666_105759372 73
111 3300005336 Ga0070680_101754534 Ga0070680_1017545341 73
112 3300005343 Ga0070687_100218943 Ga0070687_1002189432 73
113 3300005345 Ga0070692_10256755 Ga0070692_102567552 73
114 3300005356 Ga0070674_100212054 Ga0070674_1002120542 73
115 3300005356 Ga0070674_100286392 Ga0070674_1002863922 73
116 3300005365 Ga0070688_100145267 Ga0070688_1001452672 73
117 3300005440 Ga0070705_100669883 Ga0070705_1006698831 73
118 3300005444 Ga0070694_101532130 Ga0070694_1015321301 73
119 3300005459 Ga0068867_100450509 Ga0068867_1004505091 73
120 3300005466 Ga0070685_10269035 Ga0070685_102690352 73
121 3300005543 Ga0070672_100437887 Ga0070672_1004378872 73
122 3300005543 Ga0070672_100837887 Ga0070672_1008378872 73
123 3300005545 Ga0070695_100458929 Ga0070695_1004589292 73
124 3300005545 Ga0070695_101067196 Ga0070695_1010671961 73
125 3300005546 Ga0070696_100309828 Ga0070696_1003098281 73
126 3300005547 Ga0070693_100151645 Ga0070693_1001516452 73
127 3300005563 Ga0068855_100070036 Ga0068855_1000700362 73
128 3300005563 Ga0068855_102102409 Ga0068855_1021024092 73
129 3300005616 Ga0068852_102672535 Ga0068852_1026725352 73
130 3300005617 Ga0068859_101562092 Ga0068859_1015620922 73
131 3300005844 Ga0068862_101671733 Ga0068862_1016717331 73
132 3300005985 Ga0081539_10237960 Ga0081539_102379602 73
133 3300006177 Ga0075362_10763960 Ga0075362_107639601 73
134 3300006178 Ga0075367_10319334 Ga0075367_103193341 73
135 3300006195 Ga0075366_11057164 Ga0075366_110571641 73
136 3300006353 Ga0075370_10357262 Ga0075370_103572621 73
137 3300006358 Ga0068871_100125356 Ga0068871_1001253561 73
138 3300006871 Ga0075434_100100010 Ga0075434_1001000101 73
139 3300006871 Ga0075434_100327044 Ga0075434_1003270442 73
140 3300006880 Ga0075429_101971016 Ga0075429_1019710162 73
141 3300006914 Ga0075436_100044808 Ga0075436_1000448083 73
142 3300006931 Ga0097620_101562241 Ga0097620_1015622412 73
143 3300007076 Ga0075435_100241129 Ga0075435_1002411292 73
144 3300009094 Ga0111539_12897482 Ga0111539_128974821 73
145 3300009098 Ga0105245_10456646 Ga0105245_104566461 73
146 3300009098 Ga0105245_10675552 Ga0105245_106755522 73
147 3300009148 Ga0105243_10606019 Ga0105243_106060191 73
148 3300009176 Ga0105242_10379366 Ga0105242_103793661 73
149 3300009553 Ga0105249_10564103 Ga0105249_105641032 73
150 3300009553 Ga0105249_12848615 Ga0105249_128486152 73
151 3300012505 Ga0157339_1049529 Ga0157339_10495291 73
152 3300013102 Ga0157371_11588095 Ga0157371_115880951 73
153 3300013104 Ga0157370_10017241 Ga0157370_100172411 73
154 3300013297 Ga0157378_10704936 Ga0157378_107049362 73
155 3300013297 Ga0157378_11775092 Ga0157378_117750922 73
156 3300013308 Ga0157375_13495231 Ga0157375_134952311 73
157 3300014969 Ga0157376_10332240 Ga0157376_103322401 73
158 3300025893 Ga0207682_10293351 Ga0207682_102933512 73
159 3300025913 Ga0207695_11626132 Ga0207695_116261321 73
160 3300025918 Ga0207662_10102478 Ga0207662_101024782 73
161 3300025926 Ga0207659_10457807 Ga0207659_104578071 73
162 3300025927 Ga0207687_10836256 Ga0207687_108362562 73
163 3300025931 Ga0207644_10636995 Ga0207644_106369953 73
164 3300025937 Ga0207669_10758950 Ga0207669_107589502 73
165 3300025937 Ga0207669_10984282 Ga0207669_109842821 73
166 3300025940 Ga0207691_11504594 Ga0207691_115045942 73
167 3300025949 Ga0207667_10022600 Ga0207667_100226003 73
168 3300025972 Ga0207668_12089176 Ga0207668_120891762 73
169 3300026089 Ga0207648_11284061 Ga0207648_112840612 73
170 3300026089 Ga0207648_11757930 Ga0207648_117579302 73
171 3300027617 Ga0210002_1064835 Ga0210002_10648351 73
172 3300027866 Ga0209813_10173214 Ga0209813_101732142 73
173 3300030731 Ga0316177_1143800 Ga0316177_11438002 73
174 3300030736 Ga0316180_1042597 Ga0316180_10425973 73
175 3300030745 Ga0316182_1069225 Ga0316182_10692252 73
176 3300032002 Ga0307416_101873565 Ga0307416_1018735651 73
177 3300035120 Ga0373957_0144336 Ga0373957_0144336_604_825 73
178 3300036401 Ga0373937_1010489 Ga0373937_1010489_224_445 73
179 3300039437 Ga0436365_1228133 Ga0436365_1228133_2494_2715 73
180 3300042003 Ga0439443_004442 Ga0439443_004442_1439_1660 73
181 3300042461 Ga0439460_0177874 Ga0439460_0177874_278_499 73
182 3300042876 Ga0451577_0460085 Ga0451577_0460085_417_638 73
183 3300045051 Ga0451576_0524863 Ga0451576_0524863_603_824 73
184 3300045051 Ga0451576_1227575 Ga0451576_1227575_418_639 73
185 3300049592 Ga0501076_0466387 Ga0501076_0466387_529_816 73
186 3300049679 Ga0501249_098591 Ga0501249_098591_394_615 73
187 3300050490 nmdc:mga03n38_282498_c1 nmdc:mga03n38_282498_c1_151_372 73
188 3300050492 nmdc:mga0yw44_60865_c1 nmdc:mga0yw44_60865_c1_283_504 73
189 3300050494 nmdc:mga06z11_75996_c1 nmdc:mga06z11_75996_c1_844_1065 73
190 3300050495 nmdc:mga04h51_200426_c1 nmdc:mga04h51_200426_c1_253_474 73
191 3300050512 nmdc:mga0n895_309245_c1 nmdc:mga0n895_309245_c1_408_629 73
192 3300050512 nmdc:mga0n895_375915_c1 nmdc:mga0n895_375915_c1_1074_1295 73
193 3300050513 nmdc:mga0rr50_456159_c1 nmdc:mga0rr50_456159_c1_242_463 73
194 3300050514 nmdc:mga08x19_51430_c1 nmdc:mga08x19_51430_c1_1247_1468 73
195 3300059424 Ga0590075_208990 Ga0590075_208990_127_348 73

Feature Viewer

pLDDT pTM Quality
65.69 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map