F299663

General Info

Members Datasets Scaffolds Average Seq Length
195 127 390 284

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100137781|Ga0070689_1001377812
Length 327
Sequence MIRGRDGWHRARVVKVTLDGSRRSVHNSRSSCPDEVSTVSHSAGAIRHVSDTARWVALYRAMESERPDALFHDPYARTLAGERAEQIVASLPKGASMSWPMVVRTVVLDELITKSVARDGVDTVLNLAAGLDTRPYRLPLPLQLRWIEVDFPDMIAYKQDHLANAKPVCALEQVGLDLTEISRRRELFAKIGSTSKQVLVVSEGLLIYLSREQVGALADDLTAPPTFRWWLIDIAGPRILKRMEKTWGRAVAAGNAPFKFAPAEGTQFFEGHGWVEAEFRSMWVEANRLKRAEIPFAWLWQLLGRLSPKRRQEEFRRMAGMVLLRRR

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 5.13
Rhizosphere 92.82
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100137781 3300005340 Bacteria 1961
2 Ga0065712_10160194 3300005290 Bacteria 1308
3 Ga0070683_100094738 3300005329 Bacteria 2806
4 Ga0070680_100026665 3300005336 Bacteria 4621
5 Ga0070680_100161653 3300005336 Bacteria 1882
6 Ga0070691_10056238 3300005341 Bacteria 1885
7 Ga0070669_100159118 3300005353 Bacteria 1754
8 Ga0070675_100023396 3300005354 Bacteria 4940
9 Ga0070673_100002989 3300005364 Bacteria 10433
10 Ga0070688_100192770 3300005365 Bacteria 1421
11 Ga0070705_100003556 3300005440 Bacteria 7630
12 Ga0070705_100006348 3300005440 Bacteria 5793
13 Ga0070694_100002724 3300005444 Bacteria 10487
14 Ga0070694_100033434 3300005444 Bacteria 3384
15 Ga0070694_100182257 3300005444 Bacteria 1554
16 Ga0070708_100055654 3300005445 Bacteria 3518
17 Ga0070681_10481131 3300005458 Bacteria 1154
18 Ga0070706_100026358 3300005467 Bacteria 5348
19 Ga0070706_100057079 3300005467 Bacteria 3602
20 Ga0070707_100051252 3300005468 Bacteria 3957
21 Ga0070698_100000042 3300005471 Bacteria 89194
22 Ga0070698_100185566 3300005471 Bacteria 2018
23 Ga0070698_100562276 3300005471 Bacteria 1080
24 Ga0070699_100169870 3300005518 Bacteria 1932
25 Ga0070699_100246247 3300005518 Unclassified 1597
26 Ga0070697_100038767 3300005536 Bacteria 3851
27 Ga0070697_100049003 3300005536 Unclassified 3427
28 Ga0070672_100017531 3300005543 Bacteria 5158
29 Ga0070695_100036764 3300005545 Bacteria 3083
30 Ga0070695_100038939 3300005545 Bacteria 3003
31 Ga0070696_100006656 3300005546 Bacteria 7719
32 Ga0070696_100299559 3300005546 Bacteria 1231
33 Ga0070704_100001118 3300005549 Bacteria 13957
34 Ga0070704_100004284 3300005549 Bacteria 8247
35 Ga0070704_100004798 3300005549 Bacteria 7831
36 Ga0068856_100324600 3300005614 Bacteria 1557
37 Ga0068856_100637813 3300005614 Bacteria 1086
38 Ga0068859_100089480 3300005617 Bacteria 3129
39 Ga0068862_100000321 3300005844 Bacteria 52128
40 Ga0075428_100294175 3300006844 Bacteria 1746
41 Ga0075428_100417345 3300006844 Bacteria 1438
42 Ga0075430_100049210 3300006846 Unclassified 3558
43 Ga0075431_100067631 3300006847 Bacteria 3688
44 Ga0075433_10102592 3300006852 Bacteria 2534
45 Ga0075433_10136155 3300006852 Bacteria 2183
46 Ga0075433_10147337 3300006852 Bacteria 2093
47 Ga0075433_10161952 3300006852 Bacteria 1991
48 Ga0075434_100000315 3300006871 Bacteria 34579
49 Ga0075434_100007366 3300006871 Bacteria 10184
50 Ga0075434_100024305 3300006871 Bacteria 5923
51 Ga0075434_100035913 3300006871 Bacteria 4900
52 Ga0075434_100280744 3300006871 Unclassified 1685
53 Ga0075436_100092653 3300006914 Bacteria 2101
54 Ga0075436_100231107 3300006914 Bacteria 1314
55 Ga0097620_100089480 3300006931 Bacteria 3129
56 Ga0075435_100019723 3300007076 Bacteria 5155
57 Ga0075435_100384693 3300007076 Bacteria 1205
58 Ga0099794_10001664 3300007265 Bacteria 7861
59 Ga0111539_10001715 3300009094 Bacteria 29165
60 Ga0111539_10003896 3300009094 Bacteria 19623
61 Ga0111539_10025800 3300009094 Bacteria 7198
62 Ga0111539_10335863 3300009094 Bacteria 1759
63 Ga0114129_10087016 3300009147 Bacteria 4333
64 Ga0114129_10329193 3300009147 Bacteria 2029
65 Ga0114129_10372556 3300009147 Bacteria 1887
66 Ga0114129_10934995 3300009147 Bacteria 1096
67 Ga0105242_10002109 3300009176 Bacteria 15679
68 Ga0157375_10068305 3300013308 Bacteria 3556
69 Ga0157380_10277901 3300014326 Bacteria 1530
70 Ga0157377_10154528 3300014745 Bacteria 1421
71 Ga0213871_10018629 3300021441 Unclassified 1700
72 Ga0207653_10000126 3300025885 Bacteria 54271
73 Ga0207653_10061894 3300025885 Bacteria 1264
74 Ga0207684_10063426 3300025910 Bacteria 3137
75 Ga0207663_10000516 3300025916 Bacteria 16934
76 Ga0207663_10114774 3300025916 Unclassified 1834
77 Ga0207660_10131968 3300025917 Bacteria 1902
78 Ga0207662_10327242 3300025918 Bacteria 1024
79 Ga0207681_10167783 3300025923 Bacteria 1661
80 Ga0207706_10187622 3300025933 Bacteria 1815
81 Ga0207670_10343498 3300025936 Bacteria 1180
82 Ga0207669_10164201 3300025937 Bacteria 1573
83 Ga0207691_10028054 3300025940 Bacteria 5274
84 Ga0207691_10345434 3300025940 Unclassified 1273
85 Ga0207702_10120468 3300026078 Bacteria 2348
86 Ga0207674_10407233 3300026116 Bacteria 1314
87 Ga0207675_100436844 3300026118 Bacteria 1295
88 Ga0207683_10424910 3300026121 Bacteria 1224
89 Ga0209588_1002683 3300027671 Bacteria 4854
90 Ga0207428_10005789 3300027907 Bacteria 11470
91 Ga0207428_10049838 3300027907 Bacteria 3353
92 Ga0207428_10188036 3300027907 Bacteria 1557
93 Ga0207428_10209942 3300027907 Bacteria 1463
94 Ga0268265_10000378 3300028380 Bacteria 48047
95 Ga0268265_10311837 3300028380 Unclassified 1421
96 Ga0373945_0007796 3300035116 Bacteria 3474
97 Ga0373957_0027456 3300035120 Bacteria 2068
98 Ga0373943_0100095 3300035170 Unclassified 1515
99 Ga0373946_0020209 3300035171 Bacteria 2572
100 Ga0373924_0007122 3300035410 Bacteria 4031
101 Ga0373935_0169167 3300035692 Bacteria 1494
102 Ga0373937_0047303 3300036401 Bacteria 3936
103 Ga0373925_0010981 3300037068 Bacteria 6575
104 Ga0436360_0718501 3300039438 Bacteria 2311
105 Ga0436363_0931065 3300039450 Bacteria 1396
106 Ga0436362_0224201 3300039453 Bacteria 4741
107 Ga0451849_1238758 3300041505 Bacteria 2984
108 Ga0451853_3628044 3300041512 Bacteria 6987
109 Ga0451577_0003443 3300042876 Bacteria 17622
110 Ga0451577_0028104 3300042876 Bacteria 5089
111 Ga0466969_0007826 3300044656 Bacteria 5679
112 Ga0453683_0186909 3300044673 Bacteria 1314
113 Ga0466965_0170204 3300044683 Unclassified 1146
114 Ga0466966_0007305 3300044684 Bacteria 7322
115 Ga0453684_0508015 3300044712 Bacteria 1333
116 Ga0466968_0000840 3300044735 Bacteria 10734
117 Ga0466970_0000612 3300044765 Bacteria 17517
118 Ga0451576_0027183 3300045051 Bacteria 6146
119 Ga0451576_0075659 3300045051 Bacteria 3503
120 Ga0466958_0071669 3300045836 Bacteria 2122
121 Ga0495592_0111924 3300046454 Bacteria 1931
122 Ga0495590_0142373 3300046457 Unclassified 866
123 Ga0495629_0105319 3300046459 Unclassified 1967
124 Ga0495651_0204765 3300046462 Bacteria 1378
125 Ga0495653_0160689 3300046463 Bacteria 1560
126 Ga0495662_0006630 3300046476 Bacteria 5777
127 Ga0495662_0159771 3300046476 Bacteria 1110
128 Ga0495608_0012821 3300046511 Bacteria 5818
129 Ga0495608_0038119 3300046511 Unclassified 3230
130 Ga0495608_0086165 3300046511 Unclassified 2036
131 Ga0495608_0247219 3300046511 Bacteria 1113
132 Ga0495628_0044499 3300046516 Bacteria 3531
133 Ga0495630_0012898 3300046517 Bacteria 6071
134 Ga0495630_0022793 3300046517 Bacteria 4625
135 Ga0495640_0052244 3300046533 Unclassified 2807
136 Ga0495587_0204278 3300046536 Unclassified 1117
137 Ga0495645_0043424 3300046543 Bacteria 3279
138 Ga0495667_0017807 3300046559 Bacteria 4799
139 Ga0495667_0150495 3300046559 Unclassified 1498
140 Ga0495635_0038782 3300046663 Bacteria 3297
141 Ga0495659_0030705 3300046664 Bacteria 1872
142 Ga0495599_0292414 3300046678 Bacteria 985
143 Ga0495646_0055717 3300046680 Unclassified 2373
144 Ga0495613_0000620 3300046689 Bacteria 28244
145 Ga0495613_0096777 3300046689 Bacteria 2134
146 Ga0495624_0013996 3300046690 Bacteria 5459
147 Ga0495624_0211594 3300046690 Unclassified 1176
148 Ga0495600_0124406 3300046809 Unclassified 1677
149 Ga0495604_0052253 3300047317 Bacteria 3166
150 Ga0495604_0122575 3300047317 Bacteria 1880
151 Ga0495674_0061841 3300047319 Bacteria 3262
152 Ga0495674_0172951 3300047319 Bacteria 1801
153 Ga0495672_0025429 3300047320 Bacteria 3790
154 Ga0495676_0225361 3300047321 Bacteria 1290
155 Ga0495684_0001428 3300047471 Bacteria 19144
156 Ga0495684_0004275 3300047471 Bacteria 11144
157 Ga0495602_0141102 3300048088 Unclassified 1907
158 Ga0495602_0242931 3300048088 Bacteria 1346
159 Ga0496100_0123336 3300048903 Bacteria 1816
160 Ga0496102_0001460 3300048905 Bacteria 20897
161 Ga0496102_0213117 3300048905 Bacteria 1821
162 Ga0496103_0004295 3300048906 Bacteria 8662
163 Ga0496104_0232251 3300048907 Bacteria 1756
164 Ga0496107_0261394 3300048910 Bacteria 1288
165 Ga0496109_0021722 3300048912 Bacteria 5679
166 Ga0496110_0040772 3300048913 Unclassified 4047
167 Ga0496111_0003032 3300048914 Bacteria 10299
168 Ga0496114_0063182 3300048917 Bacteria 3100
169 Ga0501034_0077556 3300049571 Bacteria 3328
170 Ga0501044_0122823 3300049823 Unclassified 2596
171 nmdc:mga05p37_12305_c1 3300050507 Bacteria 10218
172 nmdc:mga05p37_334712_c1 3300050507 Bacteria 1787
173 nmdc:mga08y16_126357_c1 3300050511 Bacteria 2660
174 nmdc:mga08y16_23957_c1 3300050511 Bacteria 6446
175 nmdc:mga08y16_24248_c1 3300050511 Bacteria 6404
176 nmdc:mga0n895_13686_c1 3300050512 Bacteria 7334
177 nmdc:mga0n895_278582_c1 3300050512 Unclassified 1696
178 nmdc:mga0n895_32117_c1 3300050512 Bacteria 5036
179 nmdc:mga0n895_7208_c1 3300050512 Bacteria 9521
180 nmdc:mga0n895_88835_c1 3300050512 Bacteria 3091
181 nmdc:mga0rr50_2131_c1 3300050513 Bacteria 11065
182 nmdc:mga0rr50_49251_c1 3300050513 Bacteria 3118
183 nmdc:mga0rr50_6739_c1 3300050513 Bacteria 7033
184 nmdc:mga08x19_42617_c2 3300050514 Bacteria 2251
185 nmdc:mga08x19_4615_c1 3300050514 Bacteria 8177
186 nmdc:mga08x19_52851_c1 3300050514 Bacteria 2613
187 nmdc:mga0a205_122948_c1 3300050515 Bacteria 2495
188 nmdc:mga0a205_12551_c1 3300050515 Bacteria 7842
189 nmdc:mga0a205_167040_c1 3300050515 Bacteria 2096
190 nmdc:mga0a205_334760_c1 3300050515 Bacteria 1383
191 nmdc:mga0a205_61975_c1 3300050515 Bacteria 3614
192 nmdc:mga0a205_88993_c1 3300050515 Bacteria 2984
193 Ga0495601_0000732 3300053077 Bacteria 17669
194 Ga0495619_0001375 3300053085 Bacteria 16006
195 Ga0500637_0213100 3300053178 Bacteria 1095
196 Ga0070689_100137781
197 Ga0065712_10160194
198 Ga0070683_100094738
199 Ga0070680_100026665
200 Ga0070680_100161653
201 Ga0070691_10056238
202 Ga0070669_100159118
203 Ga0070675_100023396
204 Ga0070673_100002989
205 Ga0070688_100192770
206 Ga0070705_100003556
207 Ga0070705_100006348
208 Ga0070694_100002724
209 Ga0070694_100033434
210 Ga0070694_100182257
211 Ga0070708_100055654
212 Ga0070681_10481131
213 Ga0070706_100026358
214 Ga0070706_100057079
215 Ga0070707_100051252
216 Ga0070698_100000042
217 Ga0070698_100185566
218 Ga0070698_100562276
219 Ga0070699_100169870
220 Ga0070699_100246247
221 Ga0070697_100038767
222 Ga0070697_100049003
223 Ga0070672_100017531
224 Ga0070695_100036764
225 Ga0070695_100038939
226 Ga0070696_100006656
227 Ga0070696_100299559
228 Ga0070704_100001118
229 Ga0070704_100004284
230 Ga0070704_100004798
231 Ga0068856_100324600
232 Ga0068856_100637813
233 Ga0068859_100089480
234 Ga0068862_100000321
235 Ga0075428_100294175
236 Ga0075428_100417345
237 Ga0075430_100049210
238 Ga0075431_100067631
239 Ga0075433_10102592
240 Ga0075433_10136155
241 Ga0075433_10147337
242 Ga0075433_10161952
243 Ga0075434_100000315
244 Ga0075434_100007366
245 Ga0075434_100024305
246 Ga0075434_100035913
247 Ga0075434_100280744
248 Ga0075436_100092653
249 Ga0075436_100231107
250 Ga0097620_100089480
251 Ga0075435_100019723
252 Ga0075435_100384693
253 Ga0099794_10001664
254 Ga0111539_10001715
255 Ga0111539_10003896
256 Ga0111539_10025800
257 Ga0111539_10335863
258 Ga0114129_10087016
259 Ga0114129_10329193
260 Ga0114129_10372556
261 Ga0114129_10934995
262 Ga0105242_10002109
263 Ga0157375_10068305
264 Ga0157380_10277901
265 Ga0157377_10154528
266 Ga0213871_10018629
267 Ga0207653_10000126
268 Ga0207653_10061894
269 Ga0207684_10063426
270 Ga0207663_10000516
271 Ga0207663_10114774
272 Ga0207660_10131968
273 Ga0207662_10327242
274 Ga0207681_10167783
275 Ga0207706_10187622
276 Ga0207670_10343498
277 Ga0207669_10164201
278 Ga0207691_10028054
279 Ga0207691_10345434
280 Ga0207702_10120468
281 Ga0207674_10407233
282 Ga0207675_100436844
283 Ga0207683_10424910
284 Ga0209588_1002683
285 Ga0207428_10005789
286 Ga0207428_10049838
287 Ga0207428_10188036
288 Ga0207428_10209942
289 Ga0268265_10000378
290 Ga0268265_10311837
291 Ga0373945_0007796
292 Ga0373957_0027456
293 Ga0373943_0100095
294 Ga0373946_0020209
295 Ga0373924_0007122
296 Ga0373935_0169167
297 Ga0373937_0047303
298 Ga0373925_0010981
299 Ga0436360_0718501
300 Ga0436363_0931065
301 Ga0436362_0224201
302 Ga0451849_1238758
303 Ga0451853_3628044
304 Ga0451577_0003443
305 Ga0451577_0028104
306 Ga0466969_0007826
307 Ga0453683_0186909
308 Ga0466965_0170204
309 Ga0466966_0007305
310 Ga0453684_0508015
311 Ga0466968_0000840
312 Ga0466970_0000612
313 Ga0451576_0027183
314 Ga0451576_0075659
315 Ga0466958_0071669
316 Ga0495592_0111924
317 Ga0495590_0142373
318 Ga0495629_0105319
319 Ga0495651_0204765
320 Ga0495653_0160689
321 Ga0495662_0006630
322 Ga0495662_0159771
323 Ga0495608_0012821
324 Ga0495608_0038119
325 Ga0495608_0086165
326 Ga0495608_0247219
327 Ga0495628_0044499
328 Ga0495630_0012898
329 Ga0495630_0022793
330 Ga0495640_0052244
331 Ga0495587_0204278
332 Ga0495645_0043424
333 Ga0495667_0017807
334 Ga0495667_0150495
335 Ga0495635_0038782
336 Ga0495659_0030705
337 Ga0495599_0292414
338 Ga0495646_0055717
339 Ga0495613_0000620
340 Ga0495613_0096777
341 Ga0495624_0013996
342 Ga0495624_0211594
343 Ga0495600_0124406
344 Ga0495604_0052253
345 Ga0495604_0122575
346 Ga0495674_0061841
347 Ga0495674_0172951
348 Ga0495672_0025429
349 Ga0495676_0225361
350 Ga0495684_0001428
351 Ga0495684_0004275
352 Ga0495602_0141102
353 Ga0495602_0242931
354 Ga0496100_0123336
355 Ga0496102_0001460
356 Ga0496102_0213117
357 Ga0496103_0004295
358 Ga0496104_0232251
359 Ga0496107_0261394
360 Ga0496109_0021722
361 Ga0496110_0040772
362 Ga0496111_0003032
363 Ga0496114_0063182
364 Ga0501034_0077556
365 Ga0501044_0122823
366 nmdc:mga05p37_12305_c1
367 nmdc:mga05p37_334712_c1
368 nmdc:mga08y16_126357_c1
369 nmdc:mga08y16_23957_c1
370 nmdc:mga08y16_24248_c1
371 nmdc:mga0n895_13686_c1
372 nmdc:mga0n895_278582_c1
373 nmdc:mga0n895_32117_c1
374 nmdc:mga0n895_7208_c1
375 nmdc:mga0n895_88835_c1
376 nmdc:mga0rr50_2131_c1
377 nmdc:mga0rr50_49251_c1
378 nmdc:mga0rr50_6739_c1
379 nmdc:mga08x19_42617_c2
380 nmdc:mga08x19_4615_c1
381 nmdc:mga08x19_52851_c1
382 nmdc:mga0a205_122948_c1
383 nmdc:mga0a205_12551_c1
384 nmdc:mga0a205_167040_c1
385 nmdc:mga0a205_334760_c1
386 nmdc:mga0a205_61975_c1
387 nmdc:mga0a205_88993_c1
388 Ga0495601_0000732
389 Ga0495619_0001375
390 Ga0500637_0213100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04072

LCM

Leucine carboxyl methyltransferase

53

222

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyo-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form 0.7751 13 282
6id6-assembly1.cif.gz_A crystal structure of rv0731c from mycobacterium tuberculosis at 1.63 angstroms. 0.7597 13 284
2uyo-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form 0.7595 13 282
2uyq-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in complex with s-adenosylmethionine 0.756 12 282
2uyq-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in complex with s-adenosylmethionine 0.7459 12 282
ID Description Score Start End Superfamily
af_P95073_3_260_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8874 9 171 3.40.50.150
af_O06551_7_232_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8141 9 184 3.40.50.150
2ckdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.772 13 282 3.40.50.150
af_Q2FWN7_4_222_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7714 7 223 3.40.50.150
af_P9WFH7_9_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7692 9 283 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V9H7X3-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9948 8 201 GO:0008168
GO:0032259
AF-A0A2V8AT88-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.992 7 283 GO:0008168
GO:0032259
AF-A0A257S3J9-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9917 9 197 GO:0008168
GO:0032259
AF-A0A2V8ZRC0-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9914 1 226 GO:0008168
GO:0032259
AF-A0A538NUL5-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9888 7 284 GO:0008168
GO:0032259

Map