F299450

General Info

Members Datasets Scaffolds Average Seq Length
195 166 390 331

Family's Representative Sequence

Representative Sequence 3300001978|JGI24747J21853_1001026|JGI24747J21853_10010261
Length 377
Sequence MPLIRGICKEFQHATRWPCHPHYRWVGRHRPRLRARGRIVKAYIVDRYEKKGSLRLGELPEPKLGSDDVLVRIHAAGVNPLDAKIRDGEFKAILPYRLPLVLGNDMAGVVVGTGANVRRFKPGDHVYARPDERRIGTFAEFIAVSETDLAMKPGNLTMEEAAAIPLVALTAWQALVEKAQLKQGQKVLIHAGSGGLGTVAIQLAKHLGATVATTTSTANVDLVXXXXADIVIDYKSDDFETLLNGYDVVLNSLGKDTLEKSLSVLNHGGKLISVSGPPDAAFARANGLGWLLRQVMRLLSFSIRRKARSRGVAYSFLFMRADGEQLSKITALIEAGIIRPVIDRVFPFEATNDALAYVETGRSKGKVVIRIAQEPRP

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
90 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
91 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
92 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
133 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
134 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
135 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
136 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
137 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
138 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
139 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
140 2643221583 Caulobacter sp. Root655 Isolate Unclassified
141 2643221612 Lysobacter sp. Root76 Isolate Unclassified
142 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
143 2643221727 Lysobacter sp. Root96 Isolate Unclassified
144 2791355266 Rhizobium sp. L43 Isolate Nodule
145 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
146 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
147 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
148 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
149 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
150 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
151 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
152 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
153 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
154 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
155 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
156 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
157 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
158 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
159 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
160 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
161 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
162 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
163 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
164 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
165 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
166 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.1
Metatranscriptomes 0
Isolates 15.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 8.21
Rhizoplane 9.23
Rhizosphere 66.15
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1001026 3300001978 Bacteria 1982
2 JGI24746J21847_1002054 3300001977 Bacteria 3214
3 JGI24739J22299_10007988 3300001989 Bacteria 3959
4 JGI24737J22298_10008364 3300001990 Bacteria 3468
5 JGI24735J21928_10048959 3300002067 Bacteria 1222
6 JGI25153J46596_10008521 3300003215 Bacteria 4888
7 Ga0070683_100000135 3300005329 Bacteria 47783
8 Ga0070670_100051613 3300005331 Bacteria 3531
9 Ga0070677_10006257 3300005333 Bacteria 3950
10 Ga0068869_100037462 3300005334 Bacteria 3448
11 Ga0070666_10070890 3300005335 Bacteria 2371
12 Ga0070660_100029872 3300005339 Bacteria 4086
13 Ga0070687_100028584 3300005343 Bacteria 2706
14 Ga0070661_100023310 3300005344 Bacteria 4435
15 Ga0070668_100102811 3300005347 Bacteria 2266
16 Ga0070669_100055351 3300005353 Bacteria 2907
17 Ga0070671_100022190 3300005355 Bacteria 5186
18 Ga0070671_100027705 3300005355 Bacteria 4665
19 Ga0070671_100039461 3300005355 Bacteria 3919
20 Ga0070663_100025705 3300005455 Bacteria 3978
21 Ga0070678_100022454 3300005456 Bacteria 4182
22 Ga0068867_100024275 3300005459 Bacteria 4344
23 Ga0070684_100002657 3300005535 Bacteria 13198
24 Ga0068853_100041499 3300005539 Bacteria 3930
25 Ga0070672_100027023 3300005543 Bacteria 4277
26 Ga0070672_100145594 3300005543 Bacteria 1957
27 Ga0070665_100481540 3300005548 Bacteria 1252
28 Ga0070664_100034105 3300005564 Bacteria 4268
29 Ga0068854_100035938 3300005578 Bacteria 3471
30 Ga0068864_100066210 3300005618 Bacteria 3135
31 Ga0068870_10034324 3300005840 Bacteria 2595
32 Ga0068858_100188589 3300005842 Bacteria 1948
33 Ga0075364_10031383 3300006051 Bacteria 3413
34 Ga0075367_10001523 3300006178 Bacteria 10022
35 Ga0075369_10023462 3300006186 Bacteria 2551
36 Ga0075366_10005948 3300006195 Bacteria 6638
37 Ga0075370_10016923 3300006353 Bacteria 3931
38 Ga0075430_100061464 3300006846 Bacteria 3156
39 Ga0075431_100025650 3300006847 Bacteria 6042
40 Ga0075429_100182435 3300006880 Bacteria 1839
41 Ga0105240_10402057 3300009093 Bacteria 1542
42 Ga0105245_10044626 3300009098 Bacteria 3957
43 Ga0105245_10413316 3300009098 Unclassified 1351
44 Ga0105237_10411605 3300009545 Bacteria 1357
45 Ga0105239_10072885 3300010375 Bacteria 3776
46 Ga0105239_10083948 3300010375 Bacteria 3508
47 Ga0105239_10128471 3300010375 Bacteria 2818
48 Ga0105239_10412944 3300010375 Bacteria 1528
49 Ga0157373_10042059 3300013100 Bacteria 3267
50 Ga0157371_10034212 3300013102 Bacteria 3645
51 Ga0157371_10175991 3300013102 Bacteria 1530
52 Ga0157374_10134649 3300013296 Bacteria 2394
53 Ga0157378_10101483 3300013297 Bacteria 2628
54 Ga0157378_10593285 3300013297 Bacteria 1118
55 Ga0163162_10218679 3300013306 Bacteria 2035
56 Ga0157375_10101404 3300013308 Bacteria 2961
57 Ga0163163_10071247 3300014325 Bacteria 3463
58 Ga0157380_10024335 3300014326 Bacteria 4581
59 Ga0157380_10306881 3300014326 Bacteria 1465
60 Ga0157376_10132947 3300014969 Bacteria 2223
61 Ga0209758_1012193 3300025297 Bacteria 4844
62 Ga0207697_10013388 3300025315 Bacteria 3423
63 Ga0207688_10001978 3300025901 Bacteria 10989
64 Ga0207647_10027484 3300025904 Bacteria 3708
65 Ga0207647_10028994 3300025904 Bacteria 3587
66 Ga0207645_10016546 3300025907 Bacteria 4879
67 Ga0207643_10039479 3300025908 Bacteria 2655
68 Ga0207662_10028391 3300025918 Bacteria 3233
69 Ga0207657_10033694 3300025919 Bacteria 4614
70 Ga0207687_10127697 3300025927 Bacteria 1912
71 Ga0207644_10071103 3300025931 Bacteria 2545
72 Ga0207690_10092631 3300025932 Bacteria 2139
73 Ga0207706_10044060 3300025933 Bacteria 3954
74 Ga0207706_10111141 3300025933 Bacteria 2411
75 Ga0207669_10011551 3300025937 Bacteria 4302
76 Ga0207691_10034566 3300025940 Bacteria 4699
77 Ga0207691_10292074 3300025940 Bacteria 1402
78 Ga0207689_10063106 3300025942 Bacteria 3048
79 Ga0207689_10107545 3300025942 Bacteria 2292
80 Ga0207661_10000041 3300025944 Bacteria 122817
81 Ga0207679_10023930 3300025945 Bacteria 4183
82 Ga0207667_10159095 3300025949 Bacteria 2324
83 Ga0207651_10048660 3300025960 Bacteria 2867
84 Ga0207668_10076139 3300025972 Bacteria 2415
85 Ga0207640_10115145 3300025981 Bacteria 1914
86 Ga0207658_10103024 3300025986 Bacteria 2240
87 Ga0207677_10047325 3300026023 Bacteria 2887
88 Ga0207639_10087580 3300026041 Bacteria 2483
89 Ga0207678_10035635 3300026067 Bacteria 4332
90 Ga0207702_10317020 3300026078 Bacteria 1484
91 Ga0207648_10004406 3300026089 Bacteria 14463
92 Ga0207676_10064261 3300026095 Bacteria 2918
93 Ga0207674_10550060 3300026116 Bacteria 1115
94 Ga0207683_10008618 3300026121 Bacteria 8722
95 Ga0207683_10112136 3300026121 Bacteria 2442
96 Ga0268266_10108104 3300028379 Bacteria 2461
97 Ga0268266_10197916 3300028379 Bacteria 1838
98 Ga0307517_10025527 3300028786 Bacteria 7220
99 Ga0307405_10136391 3300031731 Bacteria 1704
100 Ga0373935_0083047 3300035692 Bacteria 2085
101 Ga0439436_0000363 3300041404 Bacteria 11249
102 Ga0439436_0021750 3300041404 Bacteria 1903
103 Ga0439461_0000396 3300041410 Bacteria 6242
104 Ga0439465_0000162 3300041413 Bacteria 16888
105 Ga0439465_0050670 3300041413 Bacteria 1359
106 Ga0439431_0000781 3300041997 Bacteria 6864
107 Ga0439442_000705 3300042002 Bacteria 7030
108 Ga0439445_0004791 3300042004 Bacteria 3069
109 Ga0439445_0025149 3300042004 Bacteria 1517
110 Ga0439432_000280 3300042006 Bacteria 18433
111 Ga0439462_0000118 3300042015 Bacteria 12485
112 Ga0439462_0008967 3300042015 Bacteria 2530
113 Ga0439446_0010840 3300042156 Bacteria 2462
114 Ga0439446_0023964 3300042156 Bacteria 1739
115 Ga0439434_0002418 3300042435 Bacteria 5430
116 Ga0453684_0111738 3300044712 Bacteria 3318
117 Ga0495651_0061570 3300046462 Bacteria 2872
118 Ga0495632_0000703 3300046519 Bacteria 30486
119 Ga0495643_0002339 3300046522 Bacteria 15224
120 Ga0495640_0219123 3300046533 Bacteria 1201
121 Ga0495635_0079264 3300046663 Bacteria 2248
122 Ga0495588_0011446 3300046674 Bacteria 4165
123 Ga0495604_0035652 3300047317 Bacteria 3927
124 Ga0495636_0000059 3300047318 Bacteria 47988
125 Ga0495687_047949 3300047443 Bacteria 1836
126 Ga0495687_053467 3300047443 Bacteria 1700
127 Ga0495673_0001263 3300047469 Bacteria 20823
128 Ga0496100_0106505 3300048903 Bacteria 1941
129 Ga0496101_0048034 3300048904 Bacteria 3066
130 Ga0496102_0085399 3300048905 Bacteria 2914
131 Ga0496104_0010628 3300048907 Bacteria 8224
132 Ga0496104_0045243 3300048907 Bacteria 4139
133 Ga0496104_0228962 3300048907 Bacteria 1771
134 Ga0496105_0050950 3300048908 Bacteria 3420
135 Ga0496106_0113439 3300048909 Bacteria 2112
136 Ga0496108_0097150 3300048911 Bacteria 2510
137 Ga0496110_0385908 3300048913 Bacteria 1276
138 Ga0496111_0140476 3300048914 Bacteria 1790
139 Ga0496112_0018080 3300048915 Bacteria 6633
140 Ga0496112_0138553 3300048915 Bacteria 2403
141 Ga0496112_0241137 3300048915 Bacteria 1760
142 Ga0496113_0170481 3300048916 Bacteria 1723
143 Ga0496113_0241042 3300048916 Bacteria 1443
144 Ga0496115_0006305 3300048918 Bacteria 8680
145 Ga0496121_0000191 3300048924 Bacteria 136529
146 Ga0496124_0002311 3300048927 Bacteria 25168
147 Ga0496124_0194483 3300048927 Bacteria 1549
148 Ga0496125_0018525 3300048928 Bacteria 6612
149 Ga0496126_0003158 3300048929 Bacteria 21223
150 Ga0501264_000702 3300049761 Bacteria 4582
151 nmdc:mga00v17_20316_c1 3300050491 Bacteria 3803
152 nmdc:mga0k408_992_c1 3300050493 Bacteria 15617
153 nmdc:mga06z11_9474_c1 3300050494 Bacteria 4105
154 nmdc:mga07m45_12732_c1 3300050496 Bacteria 3743
155 nmdc:mga05p37_121666_c1 3300050507 Bacteria 3206
156 nmdc:mga05p37_407850_c1 3300050507 Bacteria 1585
157 nmdc:mga0qj67_1754_c1 3300050509 Bacteria 15340
158 nmdc:mga06r32_18913_c1 3300050510 Bacteria 6316
159 Ga0495601_0102529 3300053077 Bacteria 1849
160 Ga0495619_0031662 3300053085 Bacteria 3428
161 Ga0500566_0000453 3300053094 Bacteria 22761
162 Ga0500590_090941 3300053148 Bacteria 1482
163 Ga0500604_0000035 3300053151 Bacteria 52540
164 Ga0500636_0001432 3300053177 Bacteria 12994
165 2514011623 2513237161 Bacteria 8871253
166 2517411275 2517287029 Bacteria 6905599
167 2597871078 2597489889 Bacteria 6297495
168 2599335946 2599185156 Bacteria 5403036
169 2643924423 2643221583 Bacteria 5218014
170 2644080352 2643221612 Bacteria 4361984
171 2644190965 2643221634 Bacteria 6705461
172 2644696965 2643221727 Bacteria 4415595
173 2793363493 2791355266 Bacteria 7116587
174 2808943600 2808606379 Bacteria 5022697
175 2842926900 2842922631 Bacteria 5824079
176 2857511295 2857509624 Bacteria 7472071
177 2893068132 2893066018 Bacteria 6158120
178 2902837931 2902837492 Bacteria 6697721
179 2906645443 2906643746 Bacteria 8722424
180 2935770073 2935769743 Bacteria 7878163
181 2935785686 2935785616 Bacteria 7962367
182 2935794386 2935793552 Bacteria 8012592
183 8003153487 8003151029 Bacteria 8187759
184 8003574878 8003570095 Bacteria 5747666
185 8016528273 8016522445 Bacteria 8156687
186 8016533418 8016530956 Bacteria 8155261
187 8016546653 8016539877 Bacteria 8155419
188 8016555474 8016548790 Bacteria 8155074
189 8016563832 8016557553 Bacteria 8154380
190 8016571750 8016566248 Bacteria 8158151
191 8016575970 8016575299 Bacteria 8154085
192 8016601552 8016595262 Bacteria 8149947
193 8019533211 8019530166 Bacteria 8155624
194 8019556372 8019555841 Bacteria 9642137
195 8056150311 8056148874 Bacteria 6479865
196 JGI24747J21853_1001026
197 JGI24746J21847_1002054
198 JGI24739J22299_10007988
199 JGI24737J22298_10008364
200 JGI24735J21928_10048959
201 JGI25153J46596_10008521
202 Ga0070683_100000135
203 Ga0070670_100051613
204 Ga0070677_10006257
205 Ga0068869_100037462
206 Ga0070666_10070890
207 Ga0070660_100029872
208 Ga0070687_100028584
209 Ga0070661_100023310
210 Ga0070668_100102811
211 Ga0070669_100055351
212 Ga0070671_100022190
213 Ga0070671_100027705
214 Ga0070671_100039461
215 Ga0070663_100025705
216 Ga0070678_100022454
217 Ga0068867_100024275
218 Ga0070684_100002657
219 Ga0068853_100041499
220 Ga0070672_100027023
221 Ga0070672_100145594
222 Ga0070665_100481540
223 Ga0070664_100034105
224 Ga0068854_100035938
225 Ga0068864_100066210
226 Ga0068870_10034324
227 Ga0068858_100188589
228 Ga0075364_10031383
229 Ga0075367_10001523
230 Ga0075369_10023462
231 Ga0075366_10005948
232 Ga0075370_10016923
233 Ga0075430_100061464
234 Ga0075431_100025650
235 Ga0075429_100182435
236 Ga0105240_10402057
237 Ga0105245_10044626
238 Ga0105245_10413316
239 Ga0105237_10411605
240 Ga0105239_10072885
241 Ga0105239_10083948
242 Ga0105239_10128471
243 Ga0105239_10412944
244 Ga0157373_10042059
245 Ga0157371_10034212
246 Ga0157371_10175991
247 Ga0157374_10134649
248 Ga0157378_10101483
249 Ga0157378_10593285
250 Ga0163162_10218679
251 Ga0157375_10101404
252 Ga0163163_10071247
253 Ga0157380_10024335
254 Ga0157380_10306881
255 Ga0157376_10132947
256 Ga0209758_1012193
257 Ga0207697_10013388
258 Ga0207688_10001978
259 Ga0207647_10027484
260 Ga0207647_10028994
261 Ga0207645_10016546
262 Ga0207643_10039479
263 Ga0207662_10028391
264 Ga0207657_10033694
265 Ga0207687_10127697
266 Ga0207644_10071103
267 Ga0207690_10092631
268 Ga0207706_10044060
269 Ga0207706_10111141
270 Ga0207669_10011551
271 Ga0207691_10034566
272 Ga0207691_10292074
273 Ga0207689_10063106
274 Ga0207689_10107545
275 Ga0207661_10000041
276 Ga0207679_10023930
277 Ga0207667_10159095
278 Ga0207651_10048660
279 Ga0207668_10076139
280 Ga0207640_10115145
281 Ga0207658_10103024
282 Ga0207677_10047325
283 Ga0207639_10087580
284 Ga0207678_10035635
285 Ga0207702_10317020
286 Ga0207648_10004406
287 Ga0207676_10064261
288 Ga0207674_10550060
289 Ga0207683_10008618
290 Ga0207683_10112136
291 Ga0268266_10108104
292 Ga0268266_10197916
293 Ga0307517_10025527
294 Ga0307405_10136391
295 Ga0373935_0083047
296 Ga0439436_0000363
297 Ga0439436_0021750
298 Ga0439461_0000396
299 Ga0439465_0000162
300 Ga0439465_0050670
301 Ga0439431_0000781
302 Ga0439442_000705
303 Ga0439445_0004791
304 Ga0439445_0025149
305 Ga0439432_000280
306 Ga0439462_0000118
307 Ga0439462_0008967
308 Ga0439446_0010840
309 Ga0439446_0023964
310 Ga0439434_0002418
311 Ga0453684_0111738
312 Ga0495651_0061570
313 Ga0495632_0000703
314 Ga0495643_0002339
315 Ga0495640_0219123
316 Ga0495635_0079264
317 Ga0495588_0011446
318 Ga0495604_0035652
319 Ga0495636_0000059
320 Ga0495687_047949
321 Ga0495687_053467
322 Ga0495673_0001263
323 Ga0496100_0106505
324 Ga0496101_0048034
325 Ga0496102_0085399
326 Ga0496104_0010628
327 Ga0496104_0045243
328 Ga0496104_0228962
329 Ga0496105_0050950
330 Ga0496106_0113439
331 Ga0496108_0097150
332 Ga0496110_0385908
333 Ga0496111_0140476
334 Ga0496112_0018080
335 Ga0496112_0138553
336 Ga0496112_0241137
337 Ga0496113_0170481
338 Ga0496113_0241042
339 Ga0496115_0006305
340 Ga0496121_0000191
341 Ga0496124_0002311
342 Ga0496124_0194483
343 Ga0496125_0018525
344 Ga0496126_0003158
345 Ga0501264_000702
346 nmdc:mga00v17_20316_c1
347 nmdc:mga0k408_992_c1
348 nmdc:mga06z11_9474_c1
349 nmdc:mga07m45_12732_c1
350 nmdc:mga05p37_121666_c1
351 nmdc:mga05p37_407850_c1
352 nmdc:mga0qj67_1754_c1
353 nmdc:mga06r32_18913_c1
354 Ga0495601_0102529
355 Ga0495619_0031662
356 Ga0500566_0000453
357 Ga0500590_090941
358 Ga0500604_0000035
359 Ga0500636_0001432
360 2514011623
361 2517411275
362 2597871078
363 2599335946
364 2643924423
365 2644080352
366 2644190965
367 2644696965
368 2793363493
369 2808943600
370 2842926900
371 2857511295
372 2893068132
373 2902837931
374 2906645443
375 2935770073
376 2935785686
377 2935794386
378 8003153487
379 8003574878
380 8016528273
381 8016533418
382 8016546653
383 8016555474
384 8016563832
385 8016571750
386 8016575970
387 8016601552
388 8019533211
389 8019556372
390 8056150311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

226

369

0.95

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

195

308

0.89

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

65

154

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.8869 40 363
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8765 38 363
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.8764 39 361
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8739 38 363
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8648 37 362
ID Description Score Start End Superfamily
af_A0A1D6J5A6_4_169_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9527 39 162 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.95 40 165 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9469 41 158 3.90.180.10
af_P28304_1_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9447 40 162 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9446 40 162 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3CSH0-F1-model_v4 NADP-dependent oxidoreductase 0.9929 41 150
AF-A0A536VTB4-F1-model_v4 NADP-dependent oxidoreductase 0.9853 94 363 GO:0008270
GO:0016491
AF-A0A5B8TNI8-F1-model_v4 NADP-dependent oxidoreductase 0.9795 37 365 GO:0008270
GO:0016491
AF-A0A7W4CN73-F1-model_v4 NADP-dependent oxidoreductase 0.9791 59 346 GO:0016491
AF-A0A0W0HQ86-F1-model_v4 NADPH:quinone oxidoreductase 0.9788 41 363 GO:0016491

Map