F299292

General Info

Members Datasets Scaffolds Average Seq Length
194 142 388 139

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0102155|Ga0501035_0102155_1014_1475
Length 153
Sequence MTRERPDGAPGTPDAGTSYPVVPVGRVESPLRDRDAAPRQGDEDAPDAWLAFGAEYRPALRDLHPGDDVLLLTWLDRADRARLTVHPRGDASRPEQGVFSTRSPDRPNPIGLHRVRILAVGPDGTRLRVSGLEALDGTPVLDVKPVLGGIADR

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
51 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
52 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
129 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
130 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 6.7
Rhizosphere 88.14
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0102155 3300049822 Bacteria 2515
2 rootL2_10198846 3300003322 Unclassified 2429
3 JGI25405J52794_10010168 3300003911 Bacteria 1786
4 Ga0065707_10516937 3300005295 Bacteria 745
5 Ga0070658_10183828 3300005327 Bacteria 1760
6 Ga0070690_100276620 3300005330 Unclassified 1196
7 Ga0070660_100362509 3300005339 Bacteria 1195
8 Ga0070689_101422512 3300005340 Bacteria 627
9 Ga0070668_100012736 3300005347 Bacteria 6259
10 Ga0070668_100312496 3300005347 Bacteria 1321
11 Ga0070669_100019267 3300005353 Bacteria 4873
12 Ga0070669_100086447 3300005353 Bacteria 2343
13 Ga0070669_100219534 3300005353 Bacteria 1503
14 Ga0070659_100719740 3300005366 Bacteria 864
15 Ga0070713_101279378 3300005436 Bacteria 710
16 Ga0070700_100049935 3300005441 Bacteria 2599
17 Ga0070694_100895411 3300005444 Bacteria 732
18 Ga0070662_100031814 3300005457 Bacteria 3705
19 Ga0068867_101494496 3300005459 Bacteria 629
20 Ga0070684_100340795 3300005535 Bacteria 1378
21 Ga0070672_100180200 3300005543 Bacteria 1760
22 Ga0070686_100059038 3300005544 Bacteria 2470
23 Ga0070695_100405933 3300005545 Bacteria 1034
24 Ga0070665_100824862 3300005548 Bacteria 940
25 Ga0068855_100789913 3300005563 Bacteria 1010
26 Ga0068857_100002320 3300005577 Bacteria 15466
27 Ga0068857_100665296 3300005577 Bacteria 988
28 Ga0070702_101187688 3300005615 Bacteria 614
29 Ga0068859_100532781 3300005617 Bacteria 1269
30 Ga0068861_100139950 3300005719 Bacteria 1974
31 Ga0068861_100443953 3300005719 Unclassified 1161
32 Ga0068870_10004389 3300005840 Bacteria 6079
33 Ga0068862_100022307 3300005844 Bacteria 5295
34 Ga0068862_101537680 3300005844 Unclassified 671
35 Ga0068862_102145457 3300005844 Bacteria 570
36 Ga0068862_102618711 3300005844 Bacteria 516
37 Ga0081455_10000409 3300005937 Bacteria 56312
38 Ga0081455_10007520 3300005937 Bacteria 11459
39 Ga0081455_10013225 3300005937 Bacteria 8174
40 Ga0081455_10278868 3300005937 Bacteria 1208
41 Ga0075365_10059100 3300006038 Bacteria 2554
42 Ga0075365_10771424 3300006038 Bacteria 679
43 Ga0075363_100404893 3300006048 Bacteria 802
44 Ga0075428_100004982 3300006844 Bacteria 14745
45 Ga0075428_100166483 3300006844 Bacteria 2391
46 Ga0075428_100202452 3300006844 Bacteria 2146
47 Ga0075428_100544624 3300006844 Bacteria 1241
48 Ga0075430_100001581 3300006846 Bacteria 18597
49 Ga0075430_100191951 3300006846 Bacteria 1697
50 Ga0075430_100525746 3300006846 Bacteria 976
51 Ga0075431_100007360 3300006847 Bacteria 10963
52 Ga0075431_100016531 3300006847 Bacteria 7489
53 Ga0075431_100414592 3300006847 Bacteria 1347
54 Ga0075431_100487337 3300006847 Bacteria 1225
55 Ga0075433_10130888 3300006852 Bacteria 2229
56 Ga0075429_100006112 3300006880 Bacteria 10409
57 Ga0075429_100491196 3300006880 Bacteria 1076
58 Ga0068865_100215418 3300006881 Bacteria 1499
59 Ga0097620_100532762 3300006931 Bacteria 1269
60 Ga0097620_101967444 3300006931 Unclassified 645
61 Ga0105240_10030161 3300009093 Bacteria 7054
62 Ga0111539_10003999 3300009094 Bacteria 19355
63 Ga0111539_10467968 3300009094 Bacteria 1468
64 Ga0111539_10584356 3300009094 Bacteria 1301
65 Ga0111539_11221706 3300009094 Bacteria 873
66 Ga0111539_11423184 3300009094 Bacteria 804
67 Ga0105245_10201968 3300009098 Unclassified 1909
68 Ga0114129_10023783 3300009147 Bacteria 8685
69 Ga0114129_10026613 3300009147 Bacteria 8192
70 Ga0114129_10284438 3300009147 Bacteria 2209
71 Ga0114129_10765477 3300009147 Bacteria 1235
72 Ga0114129_13090212 3300009147 Unclassified 544
73 Ga0105243_10165433 3300009148 Bacteria 1911
74 Ga0105242_10000034 3300009176 Bacteria 95536
75 Ga0105237_10125979 3300009545 Bacteria 2556
76 Ga0105237_10139429 3300009545 Bacteria 2419
77 Ga0105237_10161253 3300009545 Bacteria 2241
78 Ga0105238_10000003 3300009551 Bacteria 422077
79 Ga0105249_10008744 3300009553 Bacteria 8835
80 Ga0105239_10004461 3300010375 Bacteria 16729
81 Ga0105246_10356381 3300011119 Bacteria 1201
82 Ga0105246_10503960 3300011119 Bacteria 1029
83 Ga0157336_1005681 3300012477 Bacteria 831
84 Ga0157339_1005010 3300012505 Bacteria 1028
85 Ga0157342_1003968 3300012507 Unclassified 1294
86 Ga0157371_10695130 3300013102 Unclassified 761
87 Ga0163162_10334017 3300013306 Bacteria 1648
88 Ga0157372_10582651 3300013307 Bacteria 1304
89 Ga0157375_10030627 3300013308 Bacteria 5076
90 Ga0157380_10080815 3300014326 Bacteria 2657
91 Ga0157379_10571247 3300014968 Bacteria 1053
92 Ga0163161_10668938 3300017792 Bacteria 862
93 Ga0163161_10872855 3300017792 Bacteria 760
94 Ga0206354_10719694 3300020081 Bacteria 740
95 Ga0207642_10302751 3300025899 Bacteria 927
96 Ga0207688_10350506 3300025901 Bacteria 910
97 Ga0207699_10050819 3300025906 Bacteria 2447
98 Ga0207643_10004080 3300025908 Bacteria 7853
99 Ga0207695_10594845 3300025913 Unclassified 987
100 Ga0207671_10157027 3300025914 Bacteria 1760
101 Ga0207671_10181847 3300025914 Bacteria 1636
102 Ga0207671_11430946 3300025914 Unclassified 535
103 Ga0207649_10127171 3300025920 Bacteria 1726
104 Ga0207681_10047824 3300025923 Bacteria 2884
105 Ga0207681_10188932 3300025923 Bacteria 1574
106 Ga0207681_10208761 3300025923 Bacteria 1504
107 Ga0207694_10000077 3300025924 Bacteria 112188
108 Ga0207687_10139023 3300025927 Bacteria 1840
109 Ga0207664_10900565 3300025929 Bacteria 794
110 Ga0207706_10042947 3300025933 Bacteria 4007
111 Ga0207686_10000223 3300025934 Bacteria 43288
112 Ga0207709_10148403 3300025935 Unclassified 1621
113 Ga0207704_10101038 3300025938 Bacteria 1923
114 Ga0207691_10065816 3300025940 Bacteria 3279
115 Ga0207679_12027773 3300025945 Bacteria 523
116 Ga0207712_10003469 3300025961 Bacteria 9955
117 Ga0207668_10071628 3300025972 Bacteria 2477
118 Ga0207668_10074621 3300025972 Bacteria 2435
119 Ga0207640_10155944 3300025981 Bacteria 1683
120 Ga0207678_10992937 3300026067 Unclassified 743
121 Ga0207675_100334409 3300026118 Bacteria 1481
122 Ga0207698_11295316 3300026142 Bacteria 743
123 Ga0207428_10250002 3300027907 Bacteria 1322
124 Ga0207428_10593433 3300027907 Bacteria 799
125 Ga0268266_10052599 3300028379 Bacteria 3497
126 Ga0268265_10017973 3300028380 Bacteria 4892
127 Ga0268265_11283404 3300028380 Unclassified 732
128 Ga0307408_100925940 3300031548 Bacteria 799
129 Ga0307405_10745830 3300031731 Bacteria 815
130 Ga0307413_10662050 3300031824 Unclassified 863
131 Ga0307410_10133906 3300031852 Bacteria 1824
132 Ga0307406_10396526 3300031901 Unclassified 1093
133 Ga0307406_11444723 3300031901 Bacteria 604
134 Ga0307416_100213831 3300032002 Bacteria 1842
135 Ga0307416_101131612 3300032002 Unclassified 888
136 Ga0307415_100094547 3300032126 Bacteria 2173
137 Ga0395898_0650803 3300037466 Bacteria 996
138 Ga0395905_0074921 3300037471 Bacteria 3172
139 Ga0436365_1519036 3300039437 Bacteria 631
140 Ga0436360_1017624 3300039438 Bacteria 770
141 Ga0451793_1588614 3300041452 Bacteria 500
142 Ga0451797_1528338 3300041453 Bacteria 509
143 Ga0451807_0127434 3300041486 Bacteria 1470
144 Ga0451849_0530817 3300041505 Bacteria 1224
145 Ga0466969_0036709 3300044656 Unclassified 2474
146 Ga0466972_0006113 3300044658 Bacteria 6049
147 Ga0466965_0743915 3300044683 Bacteria 565
148 Ga0466961_0352183 3300044693 Bacteria 896
149 Ga0466963_0033691 3300044694 Bacteria 3328
150 Ga0466970_0215117 3300044765 Bacteria 1071
151 Ga0466959_0140061 3300045049 Bacteria 1710
152 Ga0466959_1100597 3300045049 Unclassified 528
153 Ga0466967_0008286 3300045976 Bacteria 7597
154 Ga0466967_0289234 3300045976 Bacteria 1574
155 Ga0495651_0153831 3300046462 Bacteria 1655
156 Ga0495652_0042310 3300046529 Bacteria 3929
157 Ga0495581_0520764 3300047315 Bacteria 691
158 Ga0496100_0845755 3300048903 Bacteria 718
159 Ga0496101_0561285 3300048904 Bacteria 903
160 Ga0496102_0017347 3300048905 Bacteria 6306
161 Ga0496104_1158503 3300048907 Bacteria 676
162 Ga0496106_0080112 3300048909 Bacteria 2508
163 Ga0496108_0405762 3300048911 Bacteria 1190
164 Ga0496110_0103007 3300048913 Bacteria 2560
165 Ga0496111_0131727 3300048914 Bacteria 1850
166 Ga0496112_0024044 3300048915 Bacteria 5831
167 Ga0496112_1292849 3300048915 Bacteria 645
168 Ga0501034_0136816 3300049571 Bacteria 2431
169 Ga0501036_0876677 3300049572 Bacteria 737
170 Ga0501038_0015613 3300049574 Bacteria 6903
171 Ga0501039_0096239 3300049575 Bacteria 2308
172 Ga0501047_0421180 3300049581 Bacteria 1167
173 Ga0501074_0443197 3300049590 Bacteria 921
174 Ga0501235_056405 3300049669 Unclassified 916
175 Ga0501268_034124 3300049765 Unclassified 933
176 Ga0501273_082482 3300049770 Unclassified 536
177 Ga0501044_0054732 3300049823 Bacteria 4100
178 Ga0501044_0287426 3300049823 Bacteria 1576
179 nmdc:mga00v17_477786_c1 3300050491 Bacteria 808
180 nmdc:mga00v17_58339_c1 3300050491 Bacteria 2364
181 nmdc:mga0yw44_151735_c1 3300050492 Bacteria 1512
182 nmdc:mga05p37_1545953_c1 3300050507 Unclassified 657
183 nmdc:mga0qj67_111668_c1 3300050509 Bacteria 2207
184 nmdc:mga06r32_102638_c1 3300050510 Bacteria 2808
185 nmdc:mga06r32_361703_c1 3300050510 Bacteria 1435
186 nmdc:mga08y16_182803_c1 3300050511 Bacteria 2176
187 nmdc:mga08y16_1892932_c1 3300050511 Bacteria 548
188 nmdc:mga08y16_508042_c1 3300050511 Bacteria 1224
189 nmdc:mga0n895_393253_c1 3300050512 Bacteria 1402
190 nmdc:mga0n895_476779_c1 3300050512 Bacteria 1258
191 Ga0495601_0004079 3300053077 Bacteria 8426
192 Ga0495612_0019046 3300053078 Bacteria 2748
193 Ga0495619_0104816 3300053085 Bacteria 1928
194 Ga0500611_051365 3300053727 Unclassified 945
195 Ga0501035_0102155
196 rootL2_10198846
197 JGI25405J52794_10010168
198 Ga0065707_10516937
199 Ga0070658_10183828
200 Ga0070690_100276620
201 Ga0070660_100362509
202 Ga0070689_101422512
203 Ga0070668_100012736
204 Ga0070668_100312496
205 Ga0070669_100019267
206 Ga0070669_100086447
207 Ga0070669_100219534
208 Ga0070659_100719740
209 Ga0070713_101279378
210 Ga0070700_100049935
211 Ga0070694_100895411
212 Ga0070662_100031814
213 Ga0068867_101494496
214 Ga0070684_100340795
215 Ga0070672_100180200
216 Ga0070686_100059038
217 Ga0070695_100405933
218 Ga0070665_100824862
219 Ga0068855_100789913
220 Ga0068857_100002320
221 Ga0068857_100665296
222 Ga0070702_101187688
223 Ga0068859_100532781
224 Ga0068861_100139950
225 Ga0068861_100443953
226 Ga0068870_10004389
227 Ga0068862_100022307
228 Ga0068862_101537680
229 Ga0068862_102145457
230 Ga0068862_102618711
231 Ga0081455_10000409
232 Ga0081455_10007520
233 Ga0081455_10013225
234 Ga0081455_10278868
235 Ga0075365_10059100
236 Ga0075365_10771424
237 Ga0075363_100404893
238 Ga0075428_100004982
239 Ga0075428_100166483
240 Ga0075428_100202452
241 Ga0075428_100544624
242 Ga0075430_100001581
243 Ga0075430_100191951
244 Ga0075430_100525746
245 Ga0075431_100007360
246 Ga0075431_100016531
247 Ga0075431_100414592
248 Ga0075431_100487337
249 Ga0075433_10130888
250 Ga0075429_100006112
251 Ga0075429_100491196
252 Ga0068865_100215418
253 Ga0097620_100532762
254 Ga0097620_101967444
255 Ga0105240_10030161
256 Ga0111539_10003999
257 Ga0111539_10467968
258 Ga0111539_10584356
259 Ga0111539_11221706
260 Ga0111539_11423184
261 Ga0105245_10201968
262 Ga0114129_10023783
263 Ga0114129_10026613
264 Ga0114129_10284438
265 Ga0114129_10765477
266 Ga0114129_13090212
267 Ga0105243_10165433
268 Ga0105242_10000034
269 Ga0105237_10125979
270 Ga0105237_10139429
271 Ga0105237_10161253
272 Ga0105238_10000003
273 Ga0105249_10008744
274 Ga0105239_10004461
275 Ga0105246_10356381
276 Ga0105246_10503960
277 Ga0157336_1005681
278 Ga0157339_1005010
279 Ga0157342_1003968
280 Ga0157371_10695130
281 Ga0163162_10334017
282 Ga0157372_10582651
283 Ga0157375_10030627
284 Ga0157380_10080815
285 Ga0157379_10571247
286 Ga0163161_10668938
287 Ga0163161_10872855
288 Ga0206354_10719694
289 Ga0207642_10302751
290 Ga0207688_10350506
291 Ga0207699_10050819
292 Ga0207643_10004080
293 Ga0207695_10594845
294 Ga0207671_10157027
295 Ga0207671_10181847
296 Ga0207671_11430946
297 Ga0207649_10127171
298 Ga0207681_10047824
299 Ga0207681_10188932
300 Ga0207681_10208761
301 Ga0207694_10000077
302 Ga0207687_10139023
303 Ga0207664_10900565
304 Ga0207706_10042947
305 Ga0207686_10000223
306 Ga0207709_10148403
307 Ga0207704_10101038
308 Ga0207691_10065816
309 Ga0207679_12027773
310 Ga0207712_10003469
311 Ga0207668_10071628
312 Ga0207668_10074621
313 Ga0207640_10155944
314 Ga0207678_10992937
315 Ga0207675_100334409
316 Ga0207698_11295316
317 Ga0207428_10250002
318 Ga0207428_10593433
319 Ga0268266_10052599
320 Ga0268265_10017973
321 Ga0268265_11283404
322 Ga0307408_100925940
323 Ga0307405_10745830
324 Ga0307413_10662050
325 Ga0307410_10133906
326 Ga0307406_10396526
327 Ga0307406_11444723
328 Ga0307416_100213831
329 Ga0307416_101131612
330 Ga0307415_100094547
331 Ga0395898_0650803
332 Ga0395905_0074921
333 Ga0436365_1519036
334 Ga0436360_1017624
335 Ga0451793_1588614
336 Ga0451797_1528338
337 Ga0451807_0127434
338 Ga0451849_0530817
339 Ga0466969_0036709
340 Ga0466972_0006113
341 Ga0466965_0743915
342 Ga0466961_0352183
343 Ga0466963_0033691
344 Ga0466970_0215117
345 Ga0466959_0140061
346 Ga0466959_1100597
347 Ga0466967_0008286
348 Ga0466967_0289234
349 Ga0495651_0153831
350 Ga0495652_0042310
351 Ga0495581_0520764
352 Ga0496100_0845755
353 Ga0496101_0561285
354 Ga0496102_0017347
355 Ga0496104_1158503
356 Ga0496106_0080112
357 Ga0496108_0405762
358 Ga0496110_0103007
359 Ga0496111_0131727
360 Ga0496112_0024044
361 Ga0496112_1292849
362 Ga0501034_0136816
363 Ga0501036_0876677
364 Ga0501038_0015613
365 Ga0501039_0096239
366 Ga0501047_0421180
367 Ga0501074_0443197
368 Ga0501235_056405
369 Ga0501268_034124
370 Ga0501273_082482
371 Ga0501044_0054732
372 Ga0501044_0287426
373 nmdc:mga00v17_477786_c1
374 nmdc:mga00v17_58339_c1
375 nmdc:mga0yw44_151735_c1
376 nmdc:mga05p37_1545953_c1
377 nmdc:mga0qj67_111668_c1
378 nmdc:mga06r32_102638_c1
379 nmdc:mga06r32_361703_c1
380 nmdc:mga08y16_182803_c1
381 nmdc:mga08y16_1892932_c1
382 nmdc:mga08y16_508042_c1
383 nmdc:mga0n895_393253_c1
384 nmdc:mga0n895_476779_c1
385 Ga0495601_0004079
386 Ga0495612_0019046
387 Ga0495619_0104816
388 Ga0500611_051365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

36

150

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.934 4 133
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9315 1 129
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9266 1 129
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8939 4 133
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8742 1 129
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9326 5 133 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9266 1 129 2.40.30.70
af_Q9BU70_29_181_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8948 5 130 2.40.30.70
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8925 7 133 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.892 5 133 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A4T2AM35-F1-model_v4 deleted 0.9774 3 131
AF-A0A1T4WTP3-F1-model_v4 tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA 0.9761 3 130 GO:0008168
GO:0032259
AF-A0A127JRV9-F1-model_v4 Methyltransferase 0.9756 4 130 GO:0008168
GO:0032259
AF-A0A4R8MAU5-F1-model_v4 tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA 0.9754 4 131 GO:0008168
GO:0032259
AF-A0A4P6HJC3-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9747 3 133 GO:0008168
GO:0032259

Map