F298826

General Info

Members Datasets Scaffolds Average Seq Length
194 114 388 225

Family's Representative Sequence

Representative Sequence 3300030760|Ga0265762_1019369|Ga0265762_10193691
Length 261
Sequence MQVGNLLALRARTRPLFPLPYPESERALRSLATLMNSKVEVIFFDVGNTLLFPNRQRIHAPLAERGMAVDNEHLRDLECRTKNHFDGILANNGSTDHSFWWMFYSQLLSELGLPDEAVRDRLVAGIRNSGNWDTIRPGTSEQLCQIGERYRIAVISNADGKIEDVLRRCGIADCFHSITDSGLVGYEKPHPEIFLRALESMKAAPEHSLYVGDVYSVDYLGATRAGMQAVLMDVAGAYRERGVPRIESLAELQTLLQNREG

Samples

Sample ID Description Type Environment
1 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 1.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.09
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 23.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265762_1019369 3300030760 Bacteria 1246
2 Ga0070670_100087008 3300005331 Bacteria 2685
3 Ga0068869_100075448 3300005334 Bacteria 2505
4 Ga0068868_100070110 3300005338 Bacteria 2794
5 Ga0070660_100046872 3300005339 Bacteria 3314
6 Ga0070659_100124678 3300005366 Unclassified 2089
7 Ga0070709_10064160 3300005434 Bacteria 2348
8 Ga0070714_100000567 3300005435 Bacteria 26632
9 Ga0070714_100101920 3300005435 Unclassified 2530
10 Ga0070714_100346606 3300005435 Unclassified 1394
11 Ga0070714_100413760 3300005435 Bacteria 1276
12 Ga0070713_100043477 3300005436 Bacteria 3673
13 Ga0070713_100055133 3300005436 Bacteria 3302
14 Ga0070713_100069817 3300005436 Bacteria 2964
15 Ga0070711_100003411 3300005439 Bacteria 9259
16 Ga0070708_100000206 3300005445 Bacteria 43568
17 Ga0070708_100025741 3300005445 Bacteria 5032
18 Ga0070708_100041598 3300005445 Bacteria 4029
19 Ga0070708_100055824 3300005445 Unclassified 3512
20 Ga0070708_100101118 3300005445 Bacteria 2640
21 Ga0070708_100318354 3300005445 Bacteria 1465
22 Ga0070708_100821175 3300005445 Unclassified 874
23 Ga0070681_10232860 3300005458 Bacteria 1756
24 Ga0070706_100059592 3300005467 Bacteria 3524
25 Ga0070706_100827597 3300005467 Bacteria 856
26 Ga0070707_100000305 3300005468 Bacteria 48093
27 Ga0070707_100016147 3300005468 Bacteria 7006
28 Ga0070707_100033254 3300005468 Unclassified 4917
29 Ga0070707_100431426 3300005468 Bacteria 1278
30 Ga0070698_100000324 3300005471 Bacteria 48802
31 Ga0070699_100000336 3300005518 Bacteria 45557
32 Ga0070699_100024989 3300005518 Bacteria 5150
33 Ga0070699_100038490 3300005518 Bacteria 4141
34 Ga0070699_100243520 3300005518 Bacteria 1606
35 Ga0070699_100390579 3300005518 Bacteria 1257
36 Ga0070699_100598007 3300005518 Bacteria 1006
37 Ga0070697_100000232 3300005536 Bacteria 45220
38 Ga0070697_100000509 3300005536 Bacteria 29380
39 Ga0070697_100026708 3300005536 Unclassified 4616
40 Ga0070665_100297883 3300005548 Unclassified 1615
41 Ga0068854_100021078 3300005578 Bacteria 4418
42 Ga0068861_100310229 3300005719 Bacteria 1370
43 Ga0068862_100034846 3300005844 Bacteria 4261
44 Ga0081540_1071551 3300005983 Bacteria 1602
45 Ga0081540_1083586 3300005983 Unclassified 1428
46 Ga0070717_10017268 3300006028 Bacteria 5612
47 Ga0070717_10051831 3300006028 Bacteria 3379
48 Ga0070717_10098179 3300006028 Bacteria 2482
49 Ga0070717_10110522 3300006028 Bacteria 2344
50 Ga0070717_10145372 3300006028 Bacteria 2048
51 Ga0070717_10236419 3300006028 Bacteria 1610
52 Ga0070717_10680966 3300006028 Bacteria 934
53 Ga0070717_10696329 3300006028 Unclassified 923
54 Ga0070716_100191675 3300006173 Unclassified 1351
55 Ga0070712_100003389 3300006175 Bacteria 9803
56 Ga0075431_100201128 3300006847 Bacteria 2038
57 Ga0075433_10000697 3300006852 Bacteria 22941
58 Ga0075433_10062624 3300006852 Bacteria 3258
59 Ga0075433_10093507 3300006852 Bacteria 2660
60 Ga0075434_100000303 3300006871 Bacteria 34918
61 Ga0075434_100000455 3300006871 Bacteria 30483
62 Ga0075429_100063714 3300006880 Bacteria 3211
63 Ga0075436_100020101 3300006914 Bacteria 4583
64 Ga0075436_100022740 3300006914 Unclassified 4307
65 Ga0075435_100001940 3300007076 Bacteria 13479
66 Ga0099794_10209945 3300007265 Unclassified 998
67 Ga0099795_10064268 3300007788 Unclassified 1370
68 Ga0105240_10063656 3300009093 Unclassified 4586
69 Ga0114129_10598342 3300009147 Unclassified 1429
70 Ga0105241_10031513 3300009174 Bacteria 3971
71 Ga0105239_10084959 3300010375 Bacteria 3487
72 Ga0157370_10308156 3300013104 Unclassified 1461
73 Ga0157370_10489405 3300013104 Bacteria 1130
74 Ga0157369_10000176 3300013105 Bacteria 89387
75 Ga0157369_10096006 3300013105 Bacteria 3163
76 Ga0157374_10002408 3300013296 Bacteria 15776
77 Ga0157372_10013216 3300013307 Bacteria 8810
78 Ga0157372_10025846 3300013307 Bacteria 6385
79 Ga0163163_10040916 3300014325 Bacteria 4529
80 Ga0163163_10157984 3300014325 Unclassified 2312
81 Ga0157376_10140189 3300014969 Bacteria 2168
82 Ga0182007_10007551 3300015262 Bacteria 4543
83 Ga0182007_10009199 3300015262 Bacteria 4006
84 Ga0207699_10026588 3300025906 Bacteria 3193
85 Ga0207684_10000384 3300025910 Bacteria 59609
86 Ga0207684_10126134 3300025910 Bacteria 2197
87 Ga0207695_10798576 3300025913 Bacteria 824
88 Ga0207671_10048367 3300025914 Bacteria 3148
89 Ga0207693_10008012 3300025915 Bacteria 8676
90 Ga0207663_10003876 3300025916 Bacteria 7386
91 Ga0207663_10043161 3300025916 Bacteria 2759
92 Ga0207652_10152198 3300025921 Unclassified 2072
93 Ga0207646_10000620 3300025922 Bacteria 46137
94 Ga0207646_10051758 3300025922 Unclassified 3674
95 Ga0207646_10141224 3300025922 Unclassified 2169
96 Ga0207646_10283521 3300025922 Bacteria 1497
97 Ga0207646_10358498 3300025922 Bacteria 1317
98 Ga0207646_10365837 3300025922 Bacteria 1303
99 Ga0207694_10094360 3300025924 Bacteria 2364
100 Ga0207650_10101444 3300025925 Bacteria 2216
101 Ga0207700_10068792 3300025928 Bacteria 2715
102 Ga0207700_10222496 3300025928 Bacteria 1601
103 Ga0207664_10000052 3300025929 Bacteria 131431
104 Ga0207664_10046498 3300025929 Bacteria 3406
105 Ga0207664_10074634 3300025929 Bacteria 2741
106 Ga0207706_10466373 3300025933 Unclassified 1092
107 Ga0207665_10001737 3300025939 Bacteria 14655
108 Ga0207665_10105646 3300025939 Bacteria 1972
109 Ga0207667_10562524 3300025949 Unclassified 1152
110 Ga0207640_10572145 3300025981 Unclassified 952
111 Ga0207677_10012432 3300026023 Unclassified 4893
112 Ga0207702_10428514 3300026078 Unclassified 1280
113 Ga0207641_10052703 3300026088 Bacteria 3447
114 Ga0207674_10044106 3300026116 Bacteria 4595
115 Ga0268264_10135375 3300028381 Bacteria 2190
116 Ga0265338_10000352 3300028800 Bacteria 83563
117 Ga0265338_10198731 3300028800 Bacteria 1513
118 Ga0265762_1001711 3300030760 Unclassified 3989
119 Ga0265330_10069852 3300031235 Unclassified 1520
120 Ga0265328_10120335 3300031239 Unclassified 979
121 Ga0265340_10081488 3300031247 Bacteria 1523
122 Ga0265340_10131806 3300031247 Bacteria 1146
123 Ga0265339_10010588 3300031249 Bacteria 5722
124 Ga0265339_10011633 3300031249 Bacteria 5408
125 Ga0265339_10014495 3300031249 Bacteria 4749
126 Ga0265316_10017731 3300031344 Bacteria 6142
127 Ga0265316_10091499 3300031344 Bacteria 2320
128 Ga0265316_10108043 3300031344 Bacteria 2109
129 Ga0265316_10142601 3300031344 Unclassified 1799
130 Ga0265314_10013725 3300031711 Bacteria 6532
131 Ga0265314_10018574 3300031711 Bacteria 5418
132 Ga0373926_0008734 3300035083 Bacteria 3373
133 Ga0373944_0021044 3300035089 Bacteria 1885
134 Ga0373923_0047943 3300035111 Bacteria 1782
135 Ga0373936_0022046 3300035113 Bacteria 2480
136 Ga0373945_0024618 3300035116 Bacteria 2087
137 Ga0373945_0031383 3300035116 Bacteria 1877
138 Ga0373953_0074968 3300035117 Bacteria 1400
139 Ga0373943_0027282 3300035170 Unclassified 2682
140 Ga0373955_0052012 3300035172 Unclassified 2233
141 Ga0373924_0025565 3300035410 Bacteria 2335
142 Ga0373924_0034138 3300035410 Bacteria 2058
143 Ga0373931_0048546 3300035691 Bacteria 2251
144 Ga0373935_0010413 3300035692 Bacteria 5575
145 Ga0373933_0192012 3300035724 Unclassified 1305
146 Ga0373933_0201541 3300035724 Bacteria 1273
147 Ga0373933_0405892 3300035724 Bacteria 889
148 Ga0373947_0126399 3300035725 Bacteria 1628
149 Ga0373937_0354532 3300036401 Unclassified 1390
150 Ga0373925_0028679 3300037068 Bacteria 4079
151 Ga0373925_0040707 3300037068 Bacteria 3441
152 Ga0436363_0876930 3300039450 Bacteria 1015
153 Ga0436363_1266164 3300039450 Unclassified 957
154 Ga0453683_0003114 3300044673 Bacteria 12397
155 Ga0466964_0043867 3300044706 Bacteria 1815
156 Ga0451576_0757842 3300045051 Bacteria 1020
157 Ga0466967_0114457 3300045976 Bacteria 2483
158 Ga0466967_0137533 3300045976 Bacteria 2273
159 Ga0495603_0230536 3300046455 Bacteria 1068
160 Ga0495629_0186675 3300046459 Unclassified 1436
161 Ga0495580_0001154 3300046472 Bacteria 23234
162 Ga0495580_0006882 3300046472 Bacteria 9185
163 Ga0495580_0007681 3300046472 Bacteria 8647
164 Ga0495580_0095390 3300046472 Unclassified 2069
165 Ga0495580_0208438 3300046472 Bacteria 1345
166 Ga0495580_0367317 3300046472 Bacteria 973
167 Ga0495580_0478055 3300046472 Unclassified 834
168 Ga0495594_0221314 3300046499 Bacteria 1079
169 Ga0495630_0064369 3300046517 Bacteria 2755
170 Ga0495630_0342491 3300046517 Bacteria 1144
171 Ga0495665_0031549 3300046531 Bacteria 2836
172 Ga0495657_0181224 3300046675 Bacteria 1293
173 Ga0495658_0024120 3300046683 Bacteria 3236
174 Ga0495613_0093340 3300046689 Bacteria 2179
175 Ga0495674_0100614 3300047319 Bacteria 2460
176 Ga0495674_0404669 3300047319 Unclassified 1101
177 Ga0495602_0173394 3300048088 Bacteria 1672
178 Ga0495602_0390424 3300048088 Bacteria 995
179 Ga0496100_0100378 3300048903 Unclassified 1994
180 Ga0496102_0097192 3300048905 Unclassified 2731
181 Ga0496102_0203772 3300048905 Bacteria 1865
182 Ga0496103_0321727 3300048906 Unclassified 995
183 Ga0496109_0049899 3300048912 Bacteria 3811
184 Ga0496112_0680670 3300048915 Bacteria 957
185 nmdc:mga06r32_211872_c1 3300050510 Bacteria 1925
186 nmdc:mga0n895_3115_c1 3300050512 Bacteria 13216
187 nmdc:mga0rr50_1398_c1 3300050513 Bacteria 13221
188 nmdc:mga0rr50_32823_c1 3300050513 Unclassified 3703
189 nmdc:mga08x19_14643_c1 3300050514 Unclassified 4761
190 nmdc:mga08x19_17986_c1 3300050514 Unclassified 4329
191 nmdc:mga08x19_58386_c1 3300050514 Bacteria 2496
192 nmdc:mga0a205_55698_c1 3300050515 Unclassified 3819
193 nmdc:mga0a205_79735_c2 3300050515 Bacteria 2054
194 Ga0495601_0012004 3300053077 Bacteria 5191
195 Ga0265762_1019369
196 Ga0070670_100087008
197 Ga0068869_100075448
198 Ga0068868_100070110
199 Ga0070660_100046872
200 Ga0070659_100124678
201 Ga0070709_10064160
202 Ga0070714_100000567
203 Ga0070714_100101920
204 Ga0070714_100346606
205 Ga0070714_100413760
206 Ga0070713_100043477
207 Ga0070713_100055133
208 Ga0070713_100069817
209 Ga0070711_100003411
210 Ga0070708_100000206
211 Ga0070708_100025741
212 Ga0070708_100041598
213 Ga0070708_100055824
214 Ga0070708_100101118
215 Ga0070708_100318354
216 Ga0070708_100821175
217 Ga0070681_10232860
218 Ga0070706_100059592
219 Ga0070706_100827597
220 Ga0070707_100000305
221 Ga0070707_100016147
222 Ga0070707_100033254
223 Ga0070707_100431426
224 Ga0070698_100000324
225 Ga0070699_100000336
226 Ga0070699_100024989
227 Ga0070699_100038490
228 Ga0070699_100243520
229 Ga0070699_100390579
230 Ga0070699_100598007
231 Ga0070697_100000232
232 Ga0070697_100000509
233 Ga0070697_100026708
234 Ga0070665_100297883
235 Ga0068854_100021078
236 Ga0068861_100310229
237 Ga0068862_100034846
238 Ga0081540_1071551
239 Ga0081540_1083586
240 Ga0070717_10017268
241 Ga0070717_10051831
242 Ga0070717_10098179
243 Ga0070717_10110522
244 Ga0070717_10145372
245 Ga0070717_10236419
246 Ga0070717_10680966
247 Ga0070717_10696329
248 Ga0070716_100191675
249 Ga0070712_100003389
250 Ga0075431_100201128
251 Ga0075433_10000697
252 Ga0075433_10062624
253 Ga0075433_10093507
254 Ga0075434_100000303
255 Ga0075434_100000455
256 Ga0075429_100063714
257 Ga0075436_100020101
258 Ga0075436_100022740
259 Ga0075435_100001940
260 Ga0099794_10209945
261 Ga0099795_10064268
262 Ga0105240_10063656
263 Ga0114129_10598342
264 Ga0105241_10031513
265 Ga0105239_10084959
266 Ga0157370_10308156
267 Ga0157370_10489405
268 Ga0157369_10000176
269 Ga0157369_10096006
270 Ga0157374_10002408
271 Ga0157372_10013216
272 Ga0157372_10025846
273 Ga0163163_10040916
274 Ga0163163_10157984
275 Ga0157376_10140189
276 Ga0182007_10007551
277 Ga0182007_10009199
278 Ga0207699_10026588
279 Ga0207684_10000384
280 Ga0207684_10126134
281 Ga0207695_10798576
282 Ga0207671_10048367
283 Ga0207693_10008012
284 Ga0207663_10003876
285 Ga0207663_10043161
286 Ga0207652_10152198
287 Ga0207646_10000620
288 Ga0207646_10051758
289 Ga0207646_10141224
290 Ga0207646_10283521
291 Ga0207646_10358498
292 Ga0207646_10365837
293 Ga0207694_10094360
294 Ga0207650_10101444
295 Ga0207700_10068792
296 Ga0207700_10222496
297 Ga0207664_10000052
298 Ga0207664_10046498
299 Ga0207664_10074634
300 Ga0207706_10466373
301 Ga0207665_10001737
302 Ga0207665_10105646
303 Ga0207667_10562524
304 Ga0207640_10572145
305 Ga0207677_10012432
306 Ga0207702_10428514
307 Ga0207641_10052703
308 Ga0207674_10044106
309 Ga0268264_10135375
310 Ga0265338_10000352
311 Ga0265338_10198731
312 Ga0265762_1001711
313 Ga0265330_10069852
314 Ga0265328_10120335
315 Ga0265340_10081488
316 Ga0265340_10131806
317 Ga0265339_10010588
318 Ga0265339_10011633
319 Ga0265339_10014495
320 Ga0265316_10017731
321 Ga0265316_10091499
322 Ga0265316_10108043
323 Ga0265316_10142601
324 Ga0265314_10013725
325 Ga0265314_10018574
326 Ga0373926_0008734
327 Ga0373944_0021044
328 Ga0373923_0047943
329 Ga0373936_0022046
330 Ga0373945_0024618
331 Ga0373945_0031383
332 Ga0373953_0074968
333 Ga0373943_0027282
334 Ga0373955_0052012
335 Ga0373924_0025565
336 Ga0373924_0034138
337 Ga0373931_0048546
338 Ga0373935_0010413
339 Ga0373933_0192012
340 Ga0373933_0201541
341 Ga0373933_0405892
342 Ga0373947_0126399
343 Ga0373937_0354532
344 Ga0373925_0028679
345 Ga0373925_0040707
346 Ga0436363_0876930
347 Ga0436363_1266164
348 Ga0453683_0003114
349 Ga0466964_0043867
350 Ga0451576_0757842
351 Ga0466967_0114457
352 Ga0466967_0137533
353 Ga0495603_0230536
354 Ga0495629_0186675
355 Ga0495580_0001154
356 Ga0495580_0006882
357 Ga0495580_0007681
358 Ga0495580_0095390
359 Ga0495580_0208438
360 Ga0495580_0367317
361 Ga0495580_0478055
362 Ga0495594_0221314
363 Ga0495630_0064369
364 Ga0495630_0342491
365 Ga0495665_0031549
366 Ga0495657_0181224
367 Ga0495658_0024120
368 Ga0495613_0093340
369 Ga0495674_0100614
370 Ga0495674_0404669
371 Ga0495602_0173394
372 Ga0495602_0390424
373 Ga0496100_0100378
374 Ga0496102_0097192
375 Ga0496102_0203772
376 Ga0496103_0321727
377 Ga0496109_0049899
378 Ga0496112_0680670
379 nmdc:mga06r32_211872_c1
380 nmdc:mga0n895_3115_c1
381 nmdc:mga0rr50_1398_c1
382 nmdc:mga0rr50_32823_c1
383 nmdc:mga08x19_14643_c1
384 nmdc:mga08x19_17986_c1
385 nmdc:mga08x19_58386_c1
386 nmdc:mga0a205_55698_c1
387 nmdc:mga0a205_79735_c2
388 Ga0495601_0012004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

185

249

0.92

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

85

232

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

39

226

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mu1-assembly1.cif.gz_A nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4 0.8057 98 220
2pr7-assembly2.cif.gz_B crystal structure of uncharacterized protein (np_599989.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.44 a resolution 0.7778 102 195
1ek2-assembly1.cif.gz_A crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor 0.7424 102 220
3ib6-assembly1.cif.gz_C crystal structure of an uncharacterized protein from listeria monocytogenes serotype 4b 0.7229 3 218
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.7226 1 219
ID Description Score Start End Superfamily
af_K7VLP6_12_77_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9349 103 163 3.40.50.1000
af_Q9BI82_131_243_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.926 102 211 3.40.50.1000
af_Q54P82_223_296_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9212 150 193 3.40.50.1000
af_Q9W4W5_191_295_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9147 149 194 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8978 97 193 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V9SK66-F1-model_v4 HAD family hydrolase 0.9932 97 220
AF-A0A1Q7CNK7-F1-model_v4 Haloacid dehalogenase 0.9925 3 220
AF-A0A2V9PFF4-F1-model_v4 HAD family hydrolase 0.9897 2 176 GO:0016791
GO:0044283
AF-A0A2V7X2X5-F1-model_v4 HAD family hydrolase 0.9888 2 219
AF-A0A2V9SK66-F1-model_v4 HAD family hydrolase 0.9853 97 220

Map