F298754

General Info

Members Datasets Scaffolds Average Seq Length
194 141 388 133

Family's Representative Sequence

Representative Sequence 3300025918|Ga0207662_10382752|Ga0207662_103827521
Length 147
Sequence MQLIYSAQTERKGKDMATVPDSHRDLLDAPVATLATVGADGRPQLSAVWFLADGDDVRLSLNNSRQKAKNLTKNRAATLFILDTANPARYLELRGDATLAPDDDYAFADRVGAKYGGVDLRNMDQPGEKRLVVTIEPARINAVDMSR

Samples

Sample ID Description Type Environment
1 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 6.19
Rhizosphere 88.66
Stem 0
Stem Tuber 0
Unclassified 18.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207662_10382752 3300025918 Bacteria 951
2 Ga0070658_10176317 3300005327 Bacteria 1797
3 Ga0070683_100194928 3300005329 Bacteria 1924
4 Ga0070683_100330130 3300005329 Bacteria 1452
5 Ga0070690_100837510 3300005330 Bacteria 716
6 Ga0070680_100251835 3300005336 Bacteria 1493
7 Ga0070682_101153797 3300005337 Unclassified 651
8 Ga0068868_101756072 3300005338 Unclassified 585
9 Ga0070689_100170614 3300005340 Unclassified 1763
10 Ga0070687_100196367 3300005343 Bacteria 1220
11 Ga0070687_100827522 3300005343 Bacteria 658
12 Ga0070669_100622747 3300005353 Bacteria 906
13 Ga0070671_100522636 3300005355 Bacteria 1022
14 Ga0070674_100293903 3300005356 Bacteria 1293
15 Ga0070673_100620392 3300005364 Bacteria 988
16 Ga0070673_100714660 3300005364 Bacteria 921
17 Ga0070700_100203505 3300005441 Bacteria 1392
18 Ga0070678_100719025 3300005456 Bacteria 901
19 Ga0070678_102233513 3300005456 Bacteria 519
20 Ga0068867_100090234 3300005459 Unclassified 2325
21 Ga0070706_102029043 3300005467 Unclassified 521
22 Ga0070699_100860896 3300005518 Unclassified 830
23 Ga0070679_100224514 3300005530 Bacteria 1839
24 Ga0070684_100185469 3300005535 Unclassified 1892
25 Ga0070672_100508312 3300005543 Bacteria 1043
26 Ga0070672_101621125 3300005543 Unclassified 581
27 Ga0070686_100816975 3300005544 Bacteria 752
28 Ga0070695_101192505 3300005545 Bacteria 626
29 Ga0068857_101593063 3300005577 Bacteria 637
30 Ga0068852_101890986 3300005616 Unclassified 619
31 Ga0068866_10262106 3300005718 Bacteria 1063
32 Ga0068861_100276219 3300005719 Bacteria 1445
33 Ga0068870_10996106 3300005840 Unclassified 597
34 Ga0068863_102272953 3300005841 Bacteria 552
35 Ga0068862_100207066 3300005844 Bacteria 1771
36 Ga0081455_10025024 3300005937 Bacteria 5515
37 Ga0081538_10000416 3300005981 Bacteria 47909
38 Ga0075363_100738007 3300006048 Unclassified 596
39 Ga0097621_100542425 3300006237 Bacteria 1058
40 Ga0068871_100142355 3300006358 Bacteria 2040
41 Ga0075436_100135260 3300006914 Bacteria 1730
42 Ga0111539_10912952 3300009094 Bacteria 1021
43 Ga0105245_10217755 3300009098 Bacteria 1841
44 Ga0105247_10578708 3300009101 Bacteria 830
45 Ga0105243_10203777 3300009148 Bacteria 1737
46 Ga0105242_10047342 3300009176 Unclassified 3491
47 Ga0105248_10399842 3300009177 Bacteria 1547
48 Ga0105237_12754452 3300009545 Unclassified 503
49 Ga0105249_10466530 3300009553 Bacteria 1303
50 Ga0105239_11835431 3300010375 Archaea 703
51 Ga0157369_10059228 3300013105 Bacteria 4129
52 Ga0157378_10034342 3300013297 Bacteria 4485
53 Ga0163162_11664842 3300013306 Unclassified 728
54 Ga0157372_10596779 3300013307 Bacteria 1287
55 Ga0157375_10406086 3300013308 Bacteria 1529
56 Ga0157375_10696105 3300013308 Bacteria 1170
57 Ga0157380_11109358 3300014326 Bacteria 830
58 Ga0157380_11168675 3300014326 Bacteria 812
59 Ga0157379_10027324 3300014968 Bacteria 5081
60 Ga0157379_10206717 3300014968 Bacteria 1776
61 Ga0206356_10309894 3300020070 Bacteria 1389
62 Ga0206356_10411758 3300020070 Unclassified 508
63 Ga0206350_10988954 3300020080 Bacteria 613
64 Ga0213875_10000892 3300021388 Bacteria 21840
65 Ga0207647_10426772 3300025904 Bacteria 745
66 Ga0207643_10834341 3300025908 Unclassified 597
67 Ga0207705_10234858 3300025909 Bacteria 1395
68 Ga0207662_10131012 3300025918 Bacteria 1581
69 Ga0207652_10176477 3300025921 Bacteria 1919
70 Ga0207681_10731154 3300025923 Bacteria 824
71 Ga0207687_10254363 3300025927 Bacteria 1398
72 Ga0207706_10852335 3300025933 Bacteria 772
73 Ga0207669_10139999 3300025937 Bacteria 1678
74 Ga0207691_10284945 3300025940 Bacteria 1421
75 Ga0207691_10643509 3300025940 Bacteria 896
76 Ga0207689_10606055 3300025942 Unclassified 921
77 Ga0207661_10370462 3300025944 Bacteria 1295
78 Ga0207661_10396142 3300025944 Bacteria 1251
79 Ga0207651_10329177 3300025960 Bacteria 1280
80 Ga0207712_10105304 3300025961 Bacteria 2105
81 Ga0207668_11570781 3300025972 Bacteria 594
82 Ga0207640_11688035 3300025981 Unclassified 572
83 Ga0207677_11443825 3300026023 Unclassified 634
84 Ga0207703_10365061 3300026035 Bacteria 1332
85 Ga0207708_10128348 3300026075 Bacteria 1980
86 Ga0207708_10129083 3300026075 Bacteria 1975
87 Ga0207648_10019617 3300026089 Bacteria 6101
88 Ga0207683_10144619 3300026121 Bacteria 2144
89 Ga0207683_11739659 3300026121 Bacteria 573
90 Ga0207698_10397829 3300026142 Bacteria 1316
91 Ga0268265_10255900 3300028380 Bacteria 1554
92 Ga0265338_10002028 3300028800 Bacteria 31414
93 Ga0265338_10003377 3300028800 Bacteria 22544
94 Ga0265327_10000106 3300031251 Bacteria 184297
95 Ga0373934_0076492 3300035086 Bacteria 1342
96 Ga0373934_0092082 3300035086 Bacteria 1222
97 Ga0373923_0191351 3300035111 Unclassified 943
98 Ga0373954_0029943 3300035118 Bacteria 2510
99 Ga0373954_0357791 3300035118 Unclassified 721
100 Ga0373956_0235155 3300035119 Unclassified 870
101 Ga0373957_0014605 3300035120 Bacteria 2688
102 Ga0373957_0104290 3300035120 Bacteria 1137
103 Ga0373955_0007847 3300035172 Bacteria 4923
104 Ga0373955_0357905 3300035172 Bacteria 884
105 Ga0373924_0175473 3300035410 Bacteria 942
106 Ga0373931_0517535 3300035691 Unclassified 772
107 Ga0373933_0132147 3300035724 Bacteria 1570
108 Ga0373933_0133155 3300035724 Bacteria 1564
109 Ga0373937_0032962 3300036401 Bacteria 4700
110 Ga0373937_0087385 3300036401 Bacteria 2885
111 Ga0373925_1489520 3300037068 Bacteria 554
112 Ga0436364_0384514 3300037853 Bacteria 4329
113 Ga0436364_0390119 3300037853 Bacteria 23235
114 Ga0436364_1322817 3300037853 Unclassified 1526
115 Ga0436365_1927141 3300039437 Unclassified 860
116 Ga0436363_0412624 3300039450 Bacteria 1055
117 Ga0451797_1284810 3300041453 Bacteria 1066
118 Ga0451849_1298245 3300041505 Bacteria 578
119 Ga0466972_0227236 3300044658 Bacteria 873
120 Ga0466966_0075286 3300044684 Unclassified 2109
121 Ga0466966_0586195 3300044684 Bacteria 671
122 Ga0466961_0029255 3300044693 Bacteria 3542
123 Ga0466961_0051502 3300044693 Unclassified 2629
124 Ga0466961_0073680 3300044693 Bacteria 2165
125 Ga0466963_0011596 3300044694 Bacteria 5366
126 Ga0466963_0018715 3300044694 Bacteria 4335
127 Ga0466963_0353410 3300044694 Bacteria 1035
128 Ga0466963_1206125 3300044694 Unclassified 532
129 Ga0466963_1271195 3300044694 Bacteria 517
130 Ga0466971_0014002 3300044719 Bacteria 3525
131 Ga0466971_0180975 3300044719 Bacteria 991
132 Ga0466971_0194075 3300044719 Bacteria 957
133 Ga0466968_0090835 3300044735 Bacteria 1353
134 Ga0466970_0401844 3300044765 Bacteria 782
135 Ga0466970_0410685 3300044765 Bacteria 773
136 Ga0466957_0009911 3300044842 Bacteria 5447
137 Ga0466960_0010370 3300044901 Bacteria 3868
138 Ga0466960_0037016 3300044901 Bacteria 2288
139 Ga0466960_0442864 3300044901 Unclassified 754
140 Ga0466960_0524820 3300044901 Bacteria 696
141 Ga0466959_0202989 3300045049 Bacteria 1379
142 Ga0466959_0593930 3300045049 Unclassified 745
143 Ga0466958_0001581 3300045836 Bacteria 10942
144 Ga0466958_0185842 3300045836 Bacteria 1320
145 Ga0466958_0238691 3300045836 Bacteria 1161
146 Ga0466958_0428679 3300045836 Unclassified 855
147 Ga0466958_1016884 3300045836 Bacteria 541
148 Ga0466967_0044991 3300045976 Bacteria 3833
149 Ga0466967_0240210 3300045976 Bacteria 1728
150 Ga0466967_0442039 3300045976 Bacteria 1270
151 Ga0466967_0893023 3300045976 Bacteria 884
152 Ga0466967_1144129 3300045976 Bacteria 775
153 Ga0495592_0083968 3300046454 Bacteria 2299
154 Ga0495651_0052508 3300046462 Bacteria 3139
155 Ga0495651_0292151 3300046462 Bacteria 1096
156 Ga0495653_0177780 3300046463 Bacteria 1463
157 Ga0495653_0246078 3300046463 Bacteria 1189
158 Ga0495628_0080108 3300046516 Bacteria 2539
159 Ga0495652_0056247 3300046529 Bacteria 3342
160 Ga0495587_0488521 3300046536 Unclassified 681
161 Ga0495667_0015272 3300046559 Bacteria 5185
162 Ga0495657_0015958 3300046675 Bacteria 5480
163 Ga0495657_0126752 3300046675 Bacteria 1603
164 Ga0495623_0042153 3300046679 Bacteria 2908
165 Ga0495646_0040780 3300046680 Bacteria 2857
166 Ga0495604_0023965 3300047317 Bacteria 4871
167 Ga0495680_0038201 3300047322 Bacteria 3839
168 Ga0495684_0188459 3300047471 Bacteria 1526
169 Ga0495602_0025879 3300048088 Bacteria 5671
170 Ga0495602_0198513 3300048088 Bacteria 1532
171 Ga0496100_0459089 3300048903 Bacteria 977
172 Ga0496102_0339819 3300048905 Bacteria 1414
173 Ga0496102_0488437 3300048905 Bacteria 1153
174 Ga0496104_0554124 3300048907 Bacteria 1060
175 Ga0496105_0402376 3300048908 Bacteria 1086
176 Ga0496106_0853462 3300048909 Bacteria 721
177 Ga0496107_0265448 3300048910 Bacteria 1277
178 Ga0496109_0930961 3300048912 Bacteria 807
179 Ga0496111_0256991 3300048914 Bacteria 1296
180 Ga0496113_0971165 3300048916 Bacteria 670
181 Ga0496114_0580873 3300048917 Bacteria 989
182 Ga0501036_1396122 3300049572 Unclassified 568
183 Ga0501036_1680361 3300049572 Bacteria 512
184 Ga0501047_0779981 3300049581 Bacteria 771
185 Ga0501047_1091938 3300049581 Unclassified 611
186 Ga0501048_0748571 3300049582 Bacteria 702
187 Ga0501081_0239006 3300049743 Bacteria 1324
188 nmdc:mga06r32_1801770_c1 3300050510 Unclassified 548
189 nmdc:mga08y16_1543091_c1 3300050511 Bacteria 623
190 nmdc:mga08x19_18907_c1 3300050514 Bacteria 4224
191 Ga0495619_0174077 3300053085 Bacteria 1489
192 Ga0500616_0050135 3300053153 Bacteria 2206
193 Ga0500616_0188252 3300053153 Bacteria 924
194 Ga0466962_0027233 3300061719 Bacteria 2744
195 Ga0207662_10382752
196 Ga0070658_10176317
197 Ga0070683_100194928
198 Ga0070683_100330130
199 Ga0070690_100837510
200 Ga0070680_100251835
201 Ga0070682_101153797
202 Ga0068868_101756072
203 Ga0070689_100170614
204 Ga0070687_100196367
205 Ga0070687_100827522
206 Ga0070669_100622747
207 Ga0070671_100522636
208 Ga0070674_100293903
209 Ga0070673_100620392
210 Ga0070673_100714660
211 Ga0070700_100203505
212 Ga0070678_100719025
213 Ga0070678_102233513
214 Ga0068867_100090234
215 Ga0070706_102029043
216 Ga0070699_100860896
217 Ga0070679_100224514
218 Ga0070684_100185469
219 Ga0070672_100508312
220 Ga0070672_101621125
221 Ga0070686_100816975
222 Ga0070695_101192505
223 Ga0068857_101593063
224 Ga0068852_101890986
225 Ga0068866_10262106
226 Ga0068861_100276219
227 Ga0068870_10996106
228 Ga0068863_102272953
229 Ga0068862_100207066
230 Ga0081455_10025024
231 Ga0081538_10000416
232 Ga0075363_100738007
233 Ga0097621_100542425
234 Ga0068871_100142355
235 Ga0075436_100135260
236 Ga0111539_10912952
237 Ga0105245_10217755
238 Ga0105247_10578708
239 Ga0105243_10203777
240 Ga0105242_10047342
241 Ga0105248_10399842
242 Ga0105237_12754452
243 Ga0105249_10466530
244 Ga0105239_11835431
245 Ga0157369_10059228
246 Ga0157378_10034342
247 Ga0163162_11664842
248 Ga0157372_10596779
249 Ga0157375_10406086
250 Ga0157375_10696105
251 Ga0157380_11109358
252 Ga0157380_11168675
253 Ga0157379_10027324
254 Ga0157379_10206717
255 Ga0206356_10309894
256 Ga0206356_10411758
257 Ga0206350_10988954
258 Ga0213875_10000892
259 Ga0207647_10426772
260 Ga0207643_10834341
261 Ga0207705_10234858
262 Ga0207662_10131012
263 Ga0207652_10176477
264 Ga0207681_10731154
265 Ga0207687_10254363
266 Ga0207706_10852335
267 Ga0207669_10139999
268 Ga0207691_10284945
269 Ga0207691_10643509
270 Ga0207689_10606055
271 Ga0207661_10370462
272 Ga0207661_10396142
273 Ga0207651_10329177
274 Ga0207712_10105304
275 Ga0207668_11570781
276 Ga0207640_11688035
277 Ga0207677_11443825
278 Ga0207703_10365061
279 Ga0207708_10128348
280 Ga0207708_10129083
281 Ga0207648_10019617
282 Ga0207683_10144619
283 Ga0207683_11739659
284 Ga0207698_10397829
285 Ga0268265_10255900
286 Ga0265338_10002028
287 Ga0265338_10003377
288 Ga0265327_10000106
289 Ga0373934_0076492
290 Ga0373934_0092082
291 Ga0373923_0191351
292 Ga0373954_0029943
293 Ga0373954_0357791
294 Ga0373956_0235155
295 Ga0373957_0014605
296 Ga0373957_0104290
297 Ga0373955_0007847
298 Ga0373955_0357905
299 Ga0373924_0175473
300 Ga0373931_0517535
301 Ga0373933_0132147
302 Ga0373933_0133155
303 Ga0373937_0032962
304 Ga0373937_0087385
305 Ga0373925_1489520
306 Ga0436364_0384514
307 Ga0436364_0390119
308 Ga0436364_1322817
309 Ga0436365_1927141
310 Ga0436363_0412624
311 Ga0451797_1284810
312 Ga0451849_1298245
313 Ga0466972_0227236
314 Ga0466966_0075286
315 Ga0466966_0586195
316 Ga0466961_0029255
317 Ga0466961_0051502
318 Ga0466961_0073680
319 Ga0466963_0011596
320 Ga0466963_0018715
321 Ga0466963_0353410
322 Ga0466963_1206125
323 Ga0466963_1271195
324 Ga0466971_0014002
325 Ga0466971_0180975
326 Ga0466971_0194075
327 Ga0466968_0090835
328 Ga0466970_0401844
329 Ga0466970_0410685
330 Ga0466957_0009911
331 Ga0466960_0010370
332 Ga0466960_0037016
333 Ga0466960_0442864
334 Ga0466960_0524820
335 Ga0466959_0202989
336 Ga0466959_0593930
337 Ga0466958_0001581
338 Ga0466958_0185842
339 Ga0466958_0238691
340 Ga0466958_0428679
341 Ga0466958_1016884
342 Ga0466967_0044991
343 Ga0466967_0240210
344 Ga0466967_0442039
345 Ga0466967_0893023
346 Ga0466967_1144129
347 Ga0495592_0083968
348 Ga0495651_0052508
349 Ga0495651_0292151
350 Ga0495653_0177780
351 Ga0495653_0246078
352 Ga0495628_0080108
353 Ga0495652_0056247
354 Ga0495587_0488521
355 Ga0495667_0015272
356 Ga0495657_0015958
357 Ga0495657_0126752
358 Ga0495623_0042153
359 Ga0495646_0040780
360 Ga0495604_0023965
361 Ga0495680_0038201
362 Ga0495684_0188459
363 Ga0495602_0025879
364 Ga0495602_0198513
365 Ga0496100_0459089
366 Ga0496102_0339819
367 Ga0496102_0488437
368 Ga0496104_0554124
369 Ga0496105_0402376
370 Ga0496106_0853462
371 Ga0496107_0265448
372 Ga0496109_0930961
373 Ga0496111_0256991
374 Ga0496113_0971165
375 Ga0496114_0580873
376 Ga0501036_1396122
377 Ga0501036_1680361
378 Ga0501047_0779981
379 Ga0501047_1091938
380 Ga0501048_0748571
381 Ga0501081_0239006
382 nmdc:mga06r32_1801770_c1
383 nmdc:mga08y16_1543091_c1
384 nmdc:mga08x19_18907_c1
385 Ga0495619_0174077
386 Ga0500616_0050135
387 Ga0500616_0188252
388 Ga0466962_0027233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

19

104

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8812 4 125
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8491 4 125
3dnh-assembly1.cif.gz_B the crystal structure of the protein atu2129 (unknown function) from agrobacterium tumefaciens str. c58 0.8413 11 128
1vl7-assembly1.cif.gz_B crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 a resolution 0.8229 9 127
2arz-assembly1.cif.gz_B crystal structure of protein of unknown function from pseudomonas aeruginosa 0.8004 7 128
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8598 4 125 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8409 4 125 2.30.110.10
1vl7B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8229 9 127 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8106 15 98 2.30.110.10
af_P53210_5_295_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8104 13 87 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A535NGT6-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9962 3 128 GO:0005829
GO:0016627
GO:0070967
AF-A0A535QWW8-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9847 1 128 GO:0005829
GO:0016627
GO:0070967
AF-A0A7K0JUT5-F1-model_v4 deleted 0.9837 2 127
AF-A0A1M3BGI6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9817 1 127 GO:0005829
GO:0016627
GO:0070967
AF-A0A2W4P072-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9806 1 128 GO:0005829
GO:0016627
GO:0070967

Map