F298723

General Info

Members Datasets Scaffolds Average Seq Length
194 148 388 193

Family's Representative Sequence

Representative Sequence 3300025233|Ga0209437_101600|Ga0209437_1016002
Length 223
Sequence MKGIEISKLAPSERTQDRGWYEKGNVQMKIGVLALQGAVTEHIRSIERAGAEGVAIKQVQQLHDLDGLILPGGESTTIGKLMRKYGFMDAIRVFAAEGKPVFGTCAGLIVMAKHITGQEEAHLELMDMTVSRNAFGRQRESFETDLPVKGIEETVRAVFIRAPLIESVGDQVEVLSTYNDEIVTARQGHLLACSYHPELTDDYRLHAYFVDMAKSYKHTVDPK

Samples

Sample ID Description Type Environment
1 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
9 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
13 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
19 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
20 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
21 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
22 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
23 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
24 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
25 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
26 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
27 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
28 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
29 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
30 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
31 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
32 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
33 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
34 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
35 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
36 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
37 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
38 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
39 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
40 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
41 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
42 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
43 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
44 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
45 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
46 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
50 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
51 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
52 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
53 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
54 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
55 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
56 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
57 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
58 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
59 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
60 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
61 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
62 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
63 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
64 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
65 2643221735 Bacillus sp. Root920 Isolate Unclassified
66 2671180694 Paenibacillus sp. A3 Isolate Unclassified
67 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
68 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
69 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
70 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
71 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
72 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
73 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
74 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
75 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
76 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
77 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
78 2811994870 Bacillus sp. JB4 Isolate Unclassified
79 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
80 2818991459 Paenibacillus sp. 597 Isolate Unclassified
81 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
82 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
83 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
84 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
85 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
86 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
87 2857472729 Cohnella sp. R-74144 Isolate Unclassified
88 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
89 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
90 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
91 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
92 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
93 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
94 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
95 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
96 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
97 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
98 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
99 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
100 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
101 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
102 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
103 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
104 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
105 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
106 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
107 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
108 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
109 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
110 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
111 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
112 2919726948 Bacillus pumilus 4489 Isolate Unclassified
113 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
114 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
115 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
116 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
117 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
118 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
119 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
120 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
121 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
122 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
123 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
124 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
125 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
126 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
127 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
128 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
129 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
130 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
131 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
132 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
133 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
134 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
135 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
136 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
137 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
138 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
139 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
140 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
141 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
142 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
143 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
144 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
145 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
146 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
147 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
148 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 45.88
Metatranscriptomes 2.58
Isolates 51.55

Biome Distribution

Category Percentage (%)
Aerial Root 1.03
Bulb 0
Endosphere 9.79
Nodule 1.03
Rhizoplane 1.03
Rhizosphere 40.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209437_101600 3300025233 Bacteria 5218
2 Ga0006562J51391_1000455 3300003578 Bacteria 14071
3 Ga0006562J51391_1005512 3300003578 Bacteria 3995
4 Ga0055538_1000224 3300003751 Bacteria 31879
5 Ga0055535_1002346 3300003761 Bacteria 6837
6 Ga0055541_1000295 3300003841 Bacteria 16798
7 Ga0055541_1000703 3300003841 Bacteria 8634
8 Ga0055541_1001409 3300003841 Bacteria 5217
9 Ga0105244_10160409 3300009036 Bacteria 1074
10 Ga0105244_10169255 3300009036 Bacteria 1040
11 Ga0105246_10000167 3300011119 Bacteria 31688
12 Ga0105246_10446107 3300011119 Bacteria 1086
13 Ga0157371_10003191 3300013102 Bacteria 15052
14 Ga0209784_100169 3300025224 Bacteria 56390
15 Ga0209566_100098 3300025225 Bacteria 134926
16 Ga0209566_100158 3300025225 Bacteria 76076
17 Ga0209566_100762 3300025225 Bacteria 17387
18 Ga0209258_103476 3300025242 Bacteria 3377
19 Ga0209759_1034950 3300025256 Bacteria 933
20 Ga0209675_1007349 3300025291 Bacteria 4239
21 Ga0209675_1022285 3300025291 Bacteria 1668
22 Ga0209675_1055979 3300025291 Bacteria 795
23 Ga0209676_1010754 3300025292 Bacteria 3770
24 Ga0209025_1000466 3300025294 Bacteria 79039
25 Ga0209025_1002628 3300025294 Bacteria 18425
26 Ga0209025_1024327 3300025294 Bacteria 3129
27 Ga0209025_1025575 3300025294 Bacteria 2998
28 Ga0207655_1032629 3300025728 Bacteria 2376
29 Ga0207681_10757018 3300025923 Bacteria 810
30 Ga0400489_63290 3300039093 Bacteria 1535
31 Ga0439436_0001825 3300041404 Bacteria 6274
32 Ga0439439_0003905 3300041406 Bacteria 3319
33 Ga0439433_0003719 3300041999 Bacteria 3277
34 Ga0439449_0000035 3300042007 Bacteria 39811
35 Ga0439449_0008332 3300042007 Bacteria 3943
36 Ga0439462_0000792 3300042015 Bacteria 6572
37 Ga0450906_034261 3300042145 Bacteria 897
38 Ga0466969_0006565 3300044656 Bacteria 6184
39 Ga0466961_0042308 3300044693 Bacteria 2920
40 Ga0466968_0005618 3300044735 Bacteria 4697
41 Ga0466959_0070648 3300045049 Bacteria 2529
42 Ga0466967_0501027 3300045976 Bacteria 1192
43 Ga0495590_0020060 3300046457 Bacteria 2376
44 Ga0495590_0039601 3300046457 Bacteria 1644
45 Ga0495661_0043383 3300046665 Bacteria 2765
46 Ga0495626_0032140 3300048091 Bacteria 2522
47 Ga0495626_0169491 3300048091 Bacteria 911
48 Ga0496110_0052085 3300048913 Bacteria 3598
49 Ga0496116_0001979 3300048919 Bacteria 22071
50 Ga0496116_0020634 3300048919 Bacteria 4998
51 Ga0496116_0022001 3300048919 Bacteria 4794
52 Ga0496116_0034051 3300048919 Bacteria 3602
53 Ga0496116_0045540 3300048919 Bacteria 2968
54 Ga0496116_0067583 3300048919 Bacteria 2282
55 Ga0496116_0097302 3300048919 Bacteria 1770
56 Ga0496116_0233262 3300048919 Bacteria 931
57 Ga0496117_0020367 3300048920 Bacteria 5408
58 Ga0496117_0032537 3300048920 Bacteria 3961
59 Ga0496117_0419938 3300048920 Bacteria 669
60 Ga0496118_0025930 3300048921 Bacteria 5010
61 Ga0496119_0002766 3300048922 Bacteria 18871
62 Ga0496119_0014963 3300048922 Bacteria 6022
63 Ga0496120_0000613 3300048923 Bacteria 54133
64 Ga0496120_0056611 3300048923 Bacteria 2212
65 Ga0496121_0028668 3300048924 Bacteria 5176
66 Ga0496121_0140606 3300048924 Bacteria 1792
67 Ga0496122_0003646 3300048925 Bacteria 20021
68 Ga0496122_0005450 3300048925 Bacteria 15141
69 Ga0496122_0013095 3300048925 Bacteria 8164
70 Ga0496122_0017960 3300048925 Bacteria 6565
71 Ga0496122_0062639 3300048925 Bacteria 2721
72 Ga0496122_0245450 3300048925 Bacteria 1006
73 Ga0496123_0007878 3300048926 Bacteria 9902
74 Ga0496123_0084948 3300048926 Bacteria 1906
75 Ga0496123_0306950 3300048926 Bacteria 755
76 Ga0496124_0001112 3300048927 Bacteria 42310
77 Ga0496124_0002395 3300048927 Bacteria 24663
78 Ga0496124_0021364 3300048927 Bacteria 5966
79 Ga0496124_0051083 3300048927 Bacteria 3519
80 Ga0496124_0081869 3300048927 Bacteria 2651
81 Ga0496124_0216141 3300048927 Bacteria 1446
82 Ga0496125_0001868 3300048928 Bacteria 28928
83 Ga0496125_0010452 3300048928 Bacteria 9387
84 Ga0496125_0029904 3300048928 Bacteria 4884
85 Ga0496125_0228723 3300048928 Bacteria 1191
86 Ga0496125_0411616 3300048928 Bacteria 787
87 Ga0496126_0000584 3300048929 Bacteria 69179
88 Ga0496126_0001745 3300048929 Bacteria 32222
89 Ga0496126_0010768 3300048929 Bacteria 9550
90 Ga0496126_0324078 3300048929 Bacteria 1266
91 Ga0501232_014315 3300049757 Bacteria 949
92 Ga0587070_003830 3300059491 Bacteria 1849
93 Ga0587083_0008218 3300059505 Bacteria 1626
94 Ga0587067_001235 3300059640 Bacteria 2701
95 2511175940 2510917027 Bacteria 5287437
96 2512640387 2512564013 Bacteria 6286191
97 2512729438 2512564039 Bacteria 8739048
98 2524191886 2524023129 Bacteria 6762600
99 2550903277 2548877040 Bacteria 7507281
100 2556065963 2554235469 Bacteria 3590176
101 2571530206 2571042143 Bacteria 6986194
102 2573039926 2571042588 Bacteria 5045676
103 2578334592 2576861424 Bacteria 5270569
104 2580934307 2579778775 Bacteria 5360914
105 2587743530 2585428059 Bacteria 8696589
106 2595320252 2593339198 Bacteria 7267884
107 2601636968 2600255286 Bacteria 5390125
108 2621272619 2619619294 Bacteria 5575484
109 2643738988 2643221543 Bacteria 6628015
110 2644423824 2643221676 Bacteria 8119172
111 2644740396 2643221735 Bacteria 3676263
112 2673821923 2671180694 Bacteria 7506943
113 2686995193 2684623153 Bacteria 3878815
114 2687496441 2687453109 Bacteria 3860091
115 2687580372 2687453129 Bacteria 4387428
116 2712199825 2711768088 Bacteria 3195027
117 2723601438 2721755693 Bacteria 6126117
118 2728529671 2728368933 Bacteria 7044283
119 2730137561 2728369359 Bacteria 5621728
120 2745169622 2744054657 Bacteria 5016802
121 2753813295 2751185905 Bacteria 6142767
122 2793183117 2791355222 Bacteria 5898266
123 2802440764 2802428803 Bacteria 5806948
124 2812314329 2811994870 Bacteria 3776934
125 2817616301 2816332336 Bacteria 5207640
126 2819675725 2818991459 Bacteria 8736032
127 2819726174 2818991468 Bacteria 3723169
128 2821118409 2821111986 Bacteria 6894338
129 2823526280 2823526263 Bacteria 3765752
130 2857460205 2857453340 Bacteria 8090534
131 2857464223 2857460504 Bacteria 5194327
132 2857472128 2857465823 Bacteria 6772595
133 2857474340 2857472729 Bacteria 6568124
134 2864739264 2864733723 Bacteria 6770668
135 2865002761 2864997549 Bacteria 5139696
136 2865006777 2865002811 Bacteria 6333767
137 2881639776 2881636855 Bacteria 5205297
138 2885530008 2885526491 Bacteria 7164189
139 2888579018 2888578766 Bacteria 6743310
140 2889042534 2889042446 Bacteria 7618936
141 2889052439 2889049205 Bacteria 7524325
142 2889277533 2889276214 Bacteria 5979355
143 2889299288 2889295896 Bacteria 4704906
144 2898908233 2898907183 Bacteria 4067722
145 2904116680 2904113452 Bacteria 7796941
146 2904167324 2904162308 Bacteria 7086713
147 2904497048 2904490793 Bacteria 7046938
148 2904601254 2904595352 Bacteria 6124848
149 2904755532 2904755435 Bacteria 7986759
150 2907205083 2907202186 Bacteria 6632024
151 2908669371 2908665501 Bacteria 3678115
152 2915598458 2915597211 Bacteria 6475886
153 2915610797 2915606848 Bacteria 6032732
154 2916973322 2916971899 Bacteria 4250608
155 2919097119 2919093281 Bacteria 3660974
156 2919166289 2919160200 Bacteria 6929020
157 2919430690 2919425241 Bacteria 8055701
158 2919730802 2919726948 Bacteria 3696050
159 2925329220 2925326138 Bacteria 9652120
160 2929183596 2929183550 Bacteria 6377511
161 2929206921 2929206907 Bacteria 5918291
162 2931385960 2931384279 Bacteria 7299545
163 2938653946 2938649242 Bacteria 7118381
164 2939685246 2939679117 Bacteria 6921672
165 2939706989 2939702853 Bacteria 5139229
166 2945995434 2945991243 Bacteria 7008369
167 2954776213 2954773129 Bacteria 3741715
168 2968562936 2968558590 Bacteria 6956864
169 2971407562 2971403814 Bacteria 7370929
170 2971416716 2971410472 Bacteria 8311090
171 2971513938 2971511577 Bacteria 5404012
172 2980130392 2980125574 Bacteria 5567337
173 2980179620 2980176882 Bacteria 5397533
174 2980187764 2980182181 Bacteria 9454109
175 2981288943 2981284811 Bacteria 4641497
176 2981293606 2981289755 Bacteria 4641509
177 2981984549 2981980479 Bacteria 4641628
178 2981989323 2981985349 Bacteria 4641497
179 2984532027 2984527788 Bacteria 5288478
180 2984533282 2984532647 Bacteria 5288506
181 2988230386 2988225383 Bacteria 7221625
182 2996637447 2996632988 Bacteria 6921523
183 2996707464 2996706504 Bacteria 5757485
184 648168023 648028048 Bacteria 5394884
185 8002318120 8002317523 Bacteria 8051857
186 8046992243 8046991243 Bacteria 8497463
187 8054469433 8054465665 Bacteria 7323556
188 8054798970 8054795415 Bacteria 9785225
189 8055633333 8055632911 Bacteria 5283357
190 8056535948 8056533031 Bacteria 8964429
191 8057473081 8057473075 Bacteria 5892720
192 8057634598 8057632132 Bacteria 4726859
193 8057735833 8057733483 Bacteria 6578323
194 8057982128 8057977335 Bacteria 5694872
195 Ga0209437_101600
196 Ga0006562J51391_1000455
197 Ga0006562J51391_1005512
198 Ga0055538_1000224
199 Ga0055535_1002346
200 Ga0055541_1000295
201 Ga0055541_1000703
202 Ga0055541_1001409
203 Ga0105244_10160409
204 Ga0105244_10169255
205 Ga0105246_10000167
206 Ga0105246_10446107
207 Ga0157371_10003191
208 Ga0209784_100169
209 Ga0209566_100098
210 Ga0209566_100158
211 Ga0209566_100762
212 Ga0209258_103476
213 Ga0209759_1034950
214 Ga0209675_1007349
215 Ga0209675_1022285
216 Ga0209675_1055979
217 Ga0209676_1010754
218 Ga0209025_1000466
219 Ga0209025_1002628
220 Ga0209025_1024327
221 Ga0209025_1025575
222 Ga0207655_1032629
223 Ga0207681_10757018
224 Ga0400489_63290
225 Ga0439436_0001825
226 Ga0439439_0003905
227 Ga0439433_0003719
228 Ga0439449_0000035
229 Ga0439449_0008332
230 Ga0439462_0000792
231 Ga0450906_034261
232 Ga0466969_0006565
233 Ga0466961_0042308
234 Ga0466968_0005618
235 Ga0466959_0070648
236 Ga0466967_0501027
237 Ga0495590_0020060
238 Ga0495590_0039601
239 Ga0495661_0043383
240 Ga0495626_0032140
241 Ga0495626_0169491
242 Ga0496110_0052085
243 Ga0496116_0001979
244 Ga0496116_0020634
245 Ga0496116_0022001
246 Ga0496116_0034051
247 Ga0496116_0045540
248 Ga0496116_0067583
249 Ga0496116_0097302
250 Ga0496116_0233262
251 Ga0496117_0020367
252 Ga0496117_0032537
253 Ga0496117_0419938
254 Ga0496118_0025930
255 Ga0496119_0002766
256 Ga0496119_0014963
257 Ga0496120_0000613
258 Ga0496120_0056611
259 Ga0496121_0028668
260 Ga0496121_0140606
261 Ga0496122_0003646
262 Ga0496122_0005450
263 Ga0496122_0013095
264 Ga0496122_0017960
265 Ga0496122_0062639
266 Ga0496122_0245450
267 Ga0496123_0007878
268 Ga0496123_0084948
269 Ga0496123_0306950
270 Ga0496124_0001112
271 Ga0496124_0002395
272 Ga0496124_0021364
273 Ga0496124_0051083
274 Ga0496124_0081869
275 Ga0496124_0216141
276 Ga0496125_0001868
277 Ga0496125_0010452
278 Ga0496125_0029904
279 Ga0496125_0228723
280 Ga0496125_0411616
281 Ga0496126_0000584
282 Ga0496126_0001745
283 Ga0496126_0010768
284 Ga0496126_0324078
285 Ga0501232_014315
286 Ga0587070_003830
287 Ga0587083_0008218
288 Ga0587067_001235
289 2511175940
290 2512640387
291 2512729438
292 2524191886
293 2550903277
294 2556065963
295 2571530206
296 2573039926
297 2578334592
298 2580934307
299 2587743530
300 2595320252
301 2601636968
302 2621272619
303 2643738988
304 2644423824
305 2644740396
306 2673821923
307 2686995193
308 2687496441
309 2687580372
310 2712199825
311 2723601438
312 2728529671
313 2730137561
314 2745169622
315 2753813295
316 2793183117
317 2802440764
318 2812314329
319 2817616301
320 2819675725
321 2819726174
322 2821118409
323 2823526280
324 2857460205
325 2857464223
326 2857472128
327 2857474340
328 2864739264
329 2865002761
330 2865006777
331 2881639776
332 2885530008
333 2888579018
334 2889042534
335 2889052439
336 2889277533
337 2889299288
338 2898908233
339 2904116680
340 2904167324
341 2904497048
342 2904601254
343 2904755532
344 2907205083
345 2908669371
346 2915598458
347 2915610797
348 2916973322
349 2919097119
350 2919166289
351 2919430690
352 2919730802
353 2925329220
354 2929183596
355 2929206921
356 2931385960
357 2938653946
358 2939685246
359 2939706989
360 2945995434
361 2954776213
362 2968562936
363 2971407562
364 2971416716
365 2971513938
366 2980130392
367 2980179620
368 2980187764
369 2981288943
370 2981293606
371 2981984549
372 2981989323
373 2984532027
374 2984533282
375 2988230386
376 2996637447
377 2996707464
378 648168023
379 8002318120
380 8046992243
381 8054469433
382 8054798970
383 8055633333
384 8056535948
385 8057473081
386 8057634598
387 8057735833
388 8057982128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01174

SNO

SNO glutamine amidotransferase family

32

215

0.98

PF03575

Peptidase_S51

Peptidase family S51

16

136

0.81

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

38

156

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wxy-assembly1.cif.gz_F plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9845 2 193
2nv2-assembly1.cif.gz_J structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis 0.9838 1 196
4wxy-assembly1.cif.gz_L plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9815 2 192
4wxy-assembly1.cif.gz_L plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9713 2 192
4wxy-assembly1.cif.gz_F plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9694 2 193
ID Description Score Start End Superfamily
af_P9WII7_2_198_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9603 1 190 3.40.50.880
2ywdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9496 4 188 3.40.50.880
2ywjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.939 2 187 3.40.50.880
af_Q8LAD0_1_232_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.937 2 195 3.40.50.880
af_Q9UTE4_20_232_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9305 2 192 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A553KKE0-F1-model_v4 glutaminase (EC 3.5.1.2) 1.004 1 102 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A6D0ZZ62-F1-model_v4 deleted 0.9983 5 96
AF-A0A7C3E290-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9911 2 93 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A7C7QBT3-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9886 2 81 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A263BPP5-F1-model_v4 Pyridoxal 5'-phosphate synthase subunit PdxT (EC 4.3.3.6) (Pdx2) (Pyridoxal 5'-phosphate synthase glutaminase subunit) (EC 3.5.1.2) 0.9885 1 195 GO:0004359
GO:0005829
GO:0006543
GO:0008614
GO:0036381
GO:0042823
GO:1903600

Map