F298636

General Info

Members Datasets Scaffolds Average Seq Length
194 139 388 123

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10209851|Ga0099796_102098512
Length 146
Sequence MDSKKLALLCRELADDKKAEDIVILDVREVSSVTDYFVIASGTSEPHLRAIFDTIIDKLRDDHDVRPKAIDGAFQTGWVVLDFFDVIVHVMRGDVRERYDLETLWGDAPRVKIRKSSSLKPQASGKLQAANNKLQFQSWLGLEFRV

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.58
Rhizosphere 96.91
Stem 0
Stem Tuber 0
Unclassified 47.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10209851 3300010159 Unclassified 794
2 rootH1_10199522 3300003323 Unclassified 1117
3 Ga0070658_11220544 3300005327 Unclassified 654
4 Ga0070690_100414791 3300005330 Bacteria 991
5 Ga0070690_100508519 3300005330 Unclassified 902
6 Ga0070670_100680106 3300005331 Bacteria 924
7 Ga0070680_100057681 3300005336 Bacteria 3175
8 Ga0068868_100917007 3300005338 Bacteria 797
9 Ga0070689_100348664 3300005340 Unclassified 1241
10 Ga0070689_101104816 3300005340 Unclassified 709
11 Ga0070691_10117302 3300005341 Unclassified 1337
12 Ga0070711_100251310 3300005439 Bacteria 1387
13 Ga0070705_100167763 3300005440 Unclassified 1474
14 Ga0070705_100628596 3300005440 Unclassified 834
15 Ga0070700_100328382 3300005441 Unclassified 1126
16 Ga0070708_100128655 3300005445 Unclassified 2342
17 Ga0070681_10138615 3300005458 Unclassified 2362
18 Ga0070699_100836389 3300005518 Unclassified 843
19 Ga0070679_100205761 3300005530 Unclassified 1933
20 Ga0070684_101871726 3300005535 Unclassified 566
21 Ga0070697_101042742 3300005536 Unclassified 727
22 Ga0070672_100231427 3300005543 Bacteria 1553
23 Ga0070686_100021607 3300005544 Unclassified 3829
24 Ga0070696_101765570 3300005546 Unclassified 534
25 Ga0068855_100760164 3300005563 Unclassified 1033
26 Ga0068857_100043201 3300005577 Unclassified 3998
27 Ga0068856_100311015 3300005614 Unclassified 1593
28 Ga0068856_100571385 3300005614 Bacteria 1152
29 Ga0070702_100721920 3300005615 Unclassified 762
30 Ga0068859_102465664 3300005617 Unclassified 573
31 Ga0068864_100062039 3300005618 Bacteria 3238
32 Ga0068864_100593465 3300005618 Unclassified 1074
33 Ga0068863_100783386 3300005841 Unclassified 950
34 Ga0068863_101135575 3300005841 Unclassified 786
35 Ga0068858_100140148 3300005842 Bacteria 2270
36 Ga0068862_100773925 3300005844 Bacteria 935
37 Ga0081455_10111852 3300005937 Unclassified 2169
38 Ga0070715_10380341 3300006163 Bacteria 779
39 Ga0070712_100082729 3300006175 Bacteria 2329
40 Ga0097621_100310445 3300006237 Bacteria 1395
41 Ga0075434_100839986 3300006871 Unclassified 934
42 Ga0097620_102465346 3300006931 Unclassified 573
43 Ga0075435_100335508 3300007076 Bacteria 1295
44 Ga0075435_100713400 3300007076 Unclassified 872
45 Ga0075435_101480791 3300007076 Unclassified 595
46 Ga0105240_10060948 3300009093 Bacteria 4703
47 Ga0105240_11140332 3300009093 Unclassified 828
48 Ga0111539_11167952 3300009094 Unclassified 894
49 Ga0105242_10176595 3300009176 Unclassified 1881
50 Ga0105246_10797081 3300011119 Unclassified 838
51 Ga0157371_10538009 3300013102 Unclassified 865
52 Ga0157374_10705014 3300013296 Unclassified 1022
53 Ga0157374_10929091 3300013296 Unclassified 888
54 Ga0157378_10887579 3300013297 Bacteria 922
55 Ga0157375_10071464 3300013308 Bacteria 3484
56 Ga0157375_13289972 3300013308 Unclassified 539
57 Ga0163163_10000153 3300014325 Bacteria 71877
58 Ga0163163_10207895 3300014325 Bacteria 2006
59 Ga0157379_10141646 3300014968 Bacteria 2167
60 Ga0157379_10403469 3300014968 Bacteria 1257
61 Ga0157376_10389129 3300014969 Unclassified 1345
62 Ga0157376_11950481 3300014969 Unclassified 624
63 Ga0207654_10395762 3300025911 Bacteria 959
64 Ga0207695_10047344 3300025913 Bacteria 4552
65 Ga0207695_10261177 3300025913 Bacteria 1629
66 Ga0207650_11520266 3300025925 Unclassified 569
67 Ga0207659_11331255 3300025926 Unclassified 616
68 Ga0207700_10534265 3300025928 Unclassified 1040
69 Ga0207670_10193587 3300025936 Bacteria 1540
70 Ga0207670_11074343 3300025936 Unclassified 679
71 Ga0207670_11718212 3300025936 Unclassified 534
72 Ga0207665_10117617 3300025939 Bacteria 1875
73 Ga0207691_10271371 3300025940 Bacteria 1461
74 Ga0207667_11127412 3300025949 Unclassified 767
75 Ga0207703_10448965 3300026035 Bacteria 1204
76 Ga0207708_10407341 3300026075 Unclassified 1126
77 Ga0207702_10397783 3300026078 Bacteria 1328
78 Ga0207641_11322784 3300026088 Unclassified 721
79 Ga0207676_10051457 3300026095 Bacteria 3216
80 Ga0207676_10902618 3300026095 Unclassified 867
81 Ga0207674_10015657 3300026116 Bacteria 8326
82 Ga0268265_10755242 3300028380 Bacteria 944
83 Ga0268265_11263279 3300028380 Unclassified 738
84 Ga0265337_1015055 3300028556 Unclassified 2544
85 Ga0265338_10013875 3300028800 Bacteria 9050
86 Ga0265338_10446944 3300028800 Unclassified 916
87 Ga0265339_10024528 3300031249 Unclassified 3473
88 Ga0265327_10008266 3300031251 Bacteria 7795
89 Ga0265316_10379285 3300031344 Unclassified 1020
90 Ga0265314_10491625 3300031711 Bacteria 647
91 Ga0307405_10056173 3300031731 Unclassified 2468
92 Ga0373923_0104385 3300035111 Bacteria 1253
93 Ga0373954_0144484 3300035118 Unclassified 1161
94 Ga0373954_0228683 3300035118 Unclassified 915
95 Ga0373960_0343668 3300035121 Bacteria 564
96 Ga0373924_0112963 3300035410 Bacteria 1175
97 Ga0373931_0213141 3300035691 Bacteria 1159
98 Ga0373931_0575127 3300035691 Unclassified 734
99 Ga0373931_1239231 3300035691 Unclassified 512
100 Ga0373935_0458284 3300035692 Bacteria 922
101 Ga0373927_0554324 3300035695 Unclassified 760
102 Ga0373947_0066082 3300035725 Bacteria 2207
103 Ga0373937_0632384 3300036401 Unclassified 1015
104 Ga0373925_0110722 3300037068 Bacteria 2121
105 Ga0373925_0244500 3300037068 Bacteria 1438
106 Ga0451807_0009556 3300041486 Unclassified 554
107 Ga0451577_0083756 3300042876 Bacteria 2845
108 Ga0451577_0220411 3300042876 Bacteria 1715
109 Ga0451577_0821125 3300042876 Bacteria 839
110 Ga0453684_0004245 3300044712 Bacteria 30647
111 Ga0453684_0750913 3300044712 Unclassified 1056
112 Ga0453684_1100583 3300044712 Unclassified 839
113 Ga0451576_0158393 3300045051 Bacteria 2362
114 Ga0451576_0183209 3300045051 Unclassified 2186
115 Ga0451576_0205404 3300045051 Bacteria 2057
116 Ga0451576_0376482 3300045051 Unclassified 1488
117 Ga0451576_0448767 3300045051 Bacteria 1354
118 Ga0451576_0502462 3300045051 Unclassified 1274
119 Ga0451576_1307647 3300045051 Bacteria 756
120 Ga0466958_0626173 3300045836 Unclassified 700
121 Ga0495592_0000035 3300046454 Bacteria 125802
122 Ga0495592_0053354 3300046454 Bacteria 2999
123 Ga0495603_0324551 3300046455 Bacteria 884
124 Ga0495629_0112157 3300046459 Bacteria 1901
125 Ga0495641_0020600 3300046461 Bacteria 3338
126 Ga0495651_0349516 3300046462 Unclassified 977
127 Ga0495653_0605537 3300046463 Unclassified 673
128 Ga0495582_0250418 3300046473 Bacteria 1016
129 Ga0495639_0048235 3300046475 Unclassified 1931
130 Ga0495662_0114851 3300046476 Bacteria 1320
131 Ga0495662_0161917 3300046476 Unclassified 1102
132 Ga0495664_0058928 3300046477 Unclassified 2285
133 Ga0495664_0111241 3300046477 Bacteria 1653
134 Ga0495594_0073888 3300046499 Unclassified 1899
135 Ga0495618_0025908 3300046514 Bacteria 3643
136 Ga0495618_0251740 3300046514 Unclassified 1108
137 Ga0495628_0000465 3300046516 Bacteria 37158
138 Ga0495628_0049078 3300046516 Bacteria 3343
139 Ga0495628_0711907 3300046516 Bacteria 708
140 Ga0495630_0033535 3300046517 Bacteria 3830
141 Ga0495630_0381837 3300046517 Bacteria 1079
142 Ga0495630_0553921 3300046517 Unclassified 882
143 Ga0495630_0944358 3300046517 Bacteria 656
144 Ga0495630_1481212 3300046517 Unclassified 509
145 Ga0495666_0051943 3300046526 Bacteria 1968
146 Ga0495666_0082725 3300046526 Bacteria 1518
147 Ga0495652_0054501 3300046529 Unclassified 3405
148 Ga0495652_0062084 3300046529 Bacteria 3152
149 Ga0495640_0038391 3300046533 Bacteria 3368
150 Ga0495640_0322773 3300046533 Bacteria 956
151 Ga0495586_0001149 3300046535 Bacteria 14845
152 Ga0495586_0009364 3300046535 Bacteria 5211
153 Ga0495586_0688728 3300046535 Bacteria 590
154 Ga0495645_0081947 3300046543 Bacteria 2314
155 Ga0495645_0158598 3300046543 Bacteria 1566
156 Ga0495634_0053220 3300046642 Unclassified 2712
157 Ga0495634_0068566 3300046642 Bacteria 2343
158 Ga0495657_0062905 3300046675 Unclassified 2450
159 Ga0495599_0021032 3300046678 Unclassified 4068
160 Ga0495599_0028244 3300046678 Bacteria 3516
161 Ga0495599_0093010 3300046678 Bacteria 1881
162 Ga0495647_0086411 3300046681 Unclassified 1279
163 Ga0495658_0734140 3300046683 Unclassified 633
164 Ga0495669_0300403 3300046684 Bacteria 774
165 Ga0495613_0006170 3300046689 Bacteria 8975
166 Ga0495613_1006472 3300046689 Unclassified 535
167 Ga0495624_0053929 3300046690 Bacteria 2537
168 Ga0495581_0078469 3300047315 Bacteria 1911
169 Ga0495604_0343612 3300047317 Bacteria 993
170 Ga0495674_0186995 3300047319 Bacteria 1723
171 Ga0495676_0268450 3300047321 Unclassified 1158
172 Ga0495680_0408787 3300047322 Bacteria 936
173 Ga0495684_0097140 3300047471 Bacteria 2229
174 Ga0495602_0914078 3300048088 Bacteria 583
175 Ga0496106_0196183 3300048909 Bacteria 1606
176 Ga0496107_0079035 3300048910 Bacteria 2398
177 Ga0496108_0293893 3300048911 Bacteria 1415
178 Ga0496115_0010256 3300048918 Bacteria 6992
179 Ga0501291_160630 3300049514 Unclassified 513
180 Ga0501031_0174972 3300049568 Bacteria 1402
181 Ga0501032_0058491 3300049569 Bacteria 2588
182 Ga0501033_0014094 3300049570 Bacteria 6079
183 Ga0501034_0449822 3300049571 Unclassified 1206
184 Ga0501038_0525750 3300049574 Unclassified 902
185 Ga0501039_0456434 3300049575 Unclassified 1004
186 Ga0501043_0080461 3300049579 Bacteria 2560
187 Ga0501047_1161843 3300049581 Unclassified 585
188 Ga0501070_1170147 3300049586 Bacteria 591
189 Ga0501257_068659 3300049686 Unclassified 903
190 Ga0501035_0320854 3300049822 Bacteria 1301
191 Ga0501044_0168439 3300049823 Bacteria 2163
192 nmdc:mga0rr50_390611_c1 3300050513 Bacteria 1174
193 nmdc:mga0rr50_761417_c1 3300050513 Unclassified 826
194 nmdc:mga08x19_175407_c1 3300050514 Bacteria 1461
195 Ga0099796_10209851
196 rootH1_10199522
197 Ga0070658_11220544
198 Ga0070690_100414791
199 Ga0070690_100508519
200 Ga0070670_100680106
201 Ga0070680_100057681
202 Ga0068868_100917007
203 Ga0070689_100348664
204 Ga0070689_101104816
205 Ga0070691_10117302
206 Ga0070711_100251310
207 Ga0070705_100167763
208 Ga0070705_100628596
209 Ga0070700_100328382
210 Ga0070708_100128655
211 Ga0070681_10138615
212 Ga0070699_100836389
213 Ga0070679_100205761
214 Ga0070684_101871726
215 Ga0070697_101042742
216 Ga0070672_100231427
217 Ga0070686_100021607
218 Ga0070696_101765570
219 Ga0068855_100760164
220 Ga0068857_100043201
221 Ga0068856_100311015
222 Ga0068856_100571385
223 Ga0070702_100721920
224 Ga0068859_102465664
225 Ga0068864_100062039
226 Ga0068864_100593465
227 Ga0068863_100783386
228 Ga0068863_101135575
229 Ga0068858_100140148
230 Ga0068862_100773925
231 Ga0081455_10111852
232 Ga0070715_10380341
233 Ga0070712_100082729
234 Ga0097621_100310445
235 Ga0075434_100839986
236 Ga0097620_102465346
237 Ga0075435_100335508
238 Ga0075435_100713400
239 Ga0075435_101480791
240 Ga0105240_10060948
241 Ga0105240_11140332
242 Ga0111539_11167952
243 Ga0105242_10176595
244 Ga0105246_10797081
245 Ga0157371_10538009
246 Ga0157374_10705014
247 Ga0157374_10929091
248 Ga0157378_10887579
249 Ga0157375_10071464
250 Ga0157375_13289972
251 Ga0163163_10000153
252 Ga0163163_10207895
253 Ga0157379_10141646
254 Ga0157379_10403469
255 Ga0157376_10389129
256 Ga0157376_11950481
257 Ga0207654_10395762
258 Ga0207695_10047344
259 Ga0207695_10261177
260 Ga0207650_11520266
261 Ga0207659_11331255
262 Ga0207700_10534265
263 Ga0207670_10193587
264 Ga0207670_11074343
265 Ga0207670_11718212
266 Ga0207665_10117617
267 Ga0207691_10271371
268 Ga0207667_11127412
269 Ga0207703_10448965
270 Ga0207708_10407341
271 Ga0207702_10397783
272 Ga0207641_11322784
273 Ga0207676_10051457
274 Ga0207676_10902618
275 Ga0207674_10015657
276 Ga0268265_10755242
277 Ga0268265_11263279
278 Ga0265337_1015055
279 Ga0265338_10013875
280 Ga0265338_10446944
281 Ga0265339_10024528
282 Ga0265327_10008266
283 Ga0265316_10379285
284 Ga0265314_10491625
285 Ga0307405_10056173
286 Ga0373923_0104385
287 Ga0373954_0144484
288 Ga0373954_0228683
289 Ga0373960_0343668
290 Ga0373924_0112963
291 Ga0373931_0213141
292 Ga0373931_0575127
293 Ga0373931_1239231
294 Ga0373935_0458284
295 Ga0373927_0554324
296 Ga0373947_0066082
297 Ga0373937_0632384
298 Ga0373925_0110722
299 Ga0373925_0244500
300 Ga0451807_0009556
301 Ga0451577_0083756
302 Ga0451577_0220411
303 Ga0451577_0821125
304 Ga0453684_0004245
305 Ga0453684_0750913
306 Ga0453684_1100583
307 Ga0451576_0158393
308 Ga0451576_0183209
309 Ga0451576_0205404
310 Ga0451576_0376482
311 Ga0451576_0448767
312 Ga0451576_0502462
313 Ga0451576_1307647
314 Ga0466958_0626173
315 Ga0495592_0000035
316 Ga0495592_0053354
317 Ga0495603_0324551
318 Ga0495629_0112157
319 Ga0495641_0020600
320 Ga0495651_0349516
321 Ga0495653_0605537
322 Ga0495582_0250418
323 Ga0495639_0048235
324 Ga0495662_0114851
325 Ga0495662_0161917
326 Ga0495664_0058928
327 Ga0495664_0111241
328 Ga0495594_0073888
329 Ga0495618_0025908
330 Ga0495618_0251740
331 Ga0495628_0000465
332 Ga0495628_0049078
333 Ga0495628_0711907
334 Ga0495630_0033535
335 Ga0495630_0381837
336 Ga0495630_0553921
337 Ga0495630_0944358
338 Ga0495630_1481212
339 Ga0495666_0051943
340 Ga0495666_0082725
341 Ga0495652_0054501
342 Ga0495652_0062084
343 Ga0495640_0038391
344 Ga0495640_0322773
345 Ga0495586_0001149
346 Ga0495586_0009364
347 Ga0495586_0688728
348 Ga0495645_0081947
349 Ga0495645_0158598
350 Ga0495634_0053220
351 Ga0495634_0068566
352 Ga0495657_0062905
353 Ga0495599_0021032
354 Ga0495599_0028244
355 Ga0495599_0093010
356 Ga0495647_0086411
357 Ga0495658_0734140
358 Ga0495669_0300403
359 Ga0495613_0006170
360 Ga0495613_1006472
361 Ga0495624_0053929
362 Ga0495581_0078469
363 Ga0495604_0343612
364 Ga0495674_0186995
365 Ga0495676_0268450
366 Ga0495680_0408787
367 Ga0495684_0097140
368 Ga0495602_0914078
369 Ga0496106_0196183
370 Ga0496107_0079035
371 Ga0496108_0293893
372 Ga0496115_0010256
373 Ga0501291_160630
374 Ga0501031_0174972
375 Ga0501032_0058491
376 Ga0501033_0014094
377 Ga0501034_0449822
378 Ga0501038_0525750
379 Ga0501039_0456434
380 Ga0501043_0080461
381 Ga0501047_1161843
382 Ga0501070_1170147
383 Ga0501257_068659
384 Ga0501035_0320854
385 Ga0501044_0168439
386 nmdc:mga0rr50_390611_c1
387 nmdc:mga0rr50_761417_c1
388 nmdc:mga08x19_175407_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

8

105

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9236 3 111
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9202 3 109
2id1-assembly2.cif.gz_B x-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5. 0.9197 1 109
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.901 1 110
7bl5-assembly1.cif.gz_6 pre-50s-obge particle 0.8991 2 99
ID Description Score Start End Superfamily
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9574 2 112 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9522 4 105 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9368 2 106 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9281 2 106 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9245 2 112 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A2V5W1X4-F1-model_v4 Ribosome silencing factor 0.9879 1 93 GO:0017148
GO:0043023
GO:0090071
AF-A0A4P5QNZ9-F1-model_v4 Ribosomal silencing factor RsfS 0.9839 1 113 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A257X574-F1-model_v4 Ribosome silencing factor 0.983 1 91 GO:0017148
GO:0043023
GO:0090071
AF-A0A7W1CQ75-F1-model_v4 Ribosomal silencing factor RsfS 0.9825 1 112 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A4Y8PA54-F1-model_v4 Ribosomal silencing factor RsfS 0.9799 2 111 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Map