F298524

General Info

Members Datasets Scaffolds Average Seq Length
194 145 192 145

Family's Representative Sequence

Representative Sequence 3300006931|Ga0097620_101153214|Ga0097620_1011532142
Length 136
Sequence VNKRDYKFVMPIATRWIDNDVYGHVNNVVYYAYFDTIINKWLIDEGGLDIARGDVIGVCAESQCTYTSSASFPDALDGALRVSKIGNTSVTYEIAIFRGDVACASGRFVHVFVARDTRKPTPIPPRIRAALERLQV

Samples

Sample ID Description Type Environment
1 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
2 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 1.03
Rhizoplane 6.19
Rhizosphere 82.47
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10137492 3300003322 Bacteria 5556
2 Ga0070658_10065977 3300005327 Bacteria 2956
3 Ga0070683_100170258 3300005329 Bacteria 2067
4 Ga0070670_101151894 3300005331 Bacteria 708
5 Ga0068869_100280084 3300005334 Bacteria 1341
6 Ga0070666_10732787 3300005335 Bacteria 726
7 Ga0070680_100114094 3300005336 Bacteria 2251
8 Ga0070682_100007028 3300005337 Bacteria 6332
9 Ga0068868_100004585 3300005338 Bacteria 9702
10 Ga0068868_100129799 3300005338 Bacteria 2062
11 Ga0070689_100707079 3300005340 Bacteria 880
12 Ga0070691_10167669 3300005341 Bacteria 1136
13 Ga0070692_10644977 3300005345 Bacteria 706
14 Ga0070668_100016306 3300005347 Bacteria 5556
15 Ga0070673_100049515 3300005364 Bacteria 3281
16 Ga0070688_100376041 3300005365 Bacteria 1046
17 Ga0070659_100005423 3300005366 Bacteria 9159
18 Ga0070701_10238803 3300005438 Bacteria 1092
19 Ga0070700_100005426 3300005441 Bacteria 6752
20 Ga0070708_102188033 3300005445 Bacteria 511
21 Ga0070663_100153132 3300005455 Bacteria 1769
22 Ga0070662_100713890 3300005457 Bacteria 849
23 Ga0068867_100008677 3300005459 Bacteria 7178
24 Ga0068867_100428943 3300005459 Bacteria 1122
25 Ga0070684_100080571 3300005535 Bacteria 2880
26 Ga0070684_100357025 3300005535 Bacteria 1345
27 Ga0070684_100858239 3300005535 Bacteria 850
28 Ga0070697_100954896 3300005536 Bacteria 761
29 Ga0070672_100034169 3300005543 Bacteria 3857
30 Ga0070664_100014549 3300005564 Bacteria 6419
31 Ga0068856_101485895 3300005614 Bacteria 691
32 Ga0070702_100421545 3300005615 Bacteria 960
33 Ga0068859_100339325 3300005617 Bacteria 1597
34 Ga0068859_101153176 3300005617 Bacteria 853
35 Ga0068864_101425264 3300005618 Bacteria 695
36 Ga0068851_10028981 3300005834 Bacteria 2738
37 Ga0068851_10642822 3300005834 Bacteria 649
38 Ga0068863_100113065 3300005841 Bacteria 2586
39 Ga0068863_101910087 3300005841 Bacteria 604
40 Ga0068858_101095185 3300005842 Bacteria 782
41 Ga0068860_100258434 3300005843 Bacteria 1697
42 Ga0081539_10165597 3300005985 Bacteria 1050
43 Ga0075365_10008805 3300006038 Bacteria 5754
44 Ga0075365_10337495 3300006038 Bacteria 1062
45 Ga0075365_10691324 3300006038 Bacteria 721
46 Ga0075363_100002495 3300006048 Bacteria 7535
47 Ga0075363_100136358 3300006048 Bacteria 1379
48 Ga0075363_100141456 3300006048 Bacteria 1355
49 Ga0075363_100348849 3300006048 Bacteria 864
50 Ga0075364_10054709 3300006051 Bacteria 2610
51 Ga0075364_10356735 3300006051 Bacteria 997
52 Ga0070715_10553901 3300006163 Bacteria 667
53 Ga0075367_10100978 3300006178 Bacteria 1764
54 Ga0097621_100041903 3300006237 Bacteria 3687
55 Ga0075433_10860830 3300006852 Bacteria 791
56 Ga0068865_100023941 3300006881 Bacteria 4002
57 Ga0097620_100339294 3300006931 Bacteria 1597
58 Ga0097620_101153214 3300006931 Bacteria 853
59 Ga0079104_1000422 3300006946 Bacteria 48334
60 Ga0111539_10104545 3300009094 Bacteria 3322
61 Ga0111539_10724817 3300009094 Bacteria 1157
62 Ga0105245_11749155 3300009098 Bacteria 674
63 Ga0105243_10015151 3300009148 Bacteria 5834
64 Ga0105242_10183477 3300009176 Bacteria 1848
65 Ga0105242_10475972 3300009176 Bacteria 1182
66 Ga0105242_10667027 3300009176 Bacteria 1013
67 Ga0105242_10708996 3300009176 Bacteria 985
68 Ga0105248_12855026 3300009177 Bacteria 551
69 Ga0105238_10782657 3300009551 Bacteria 969
70 Ga0105249_12119765 3300009553 Bacteria 635
71 Ga0105239_10089547 3300010375 Bacteria 3393
72 Ga0157372_12931058 3300013307 Bacteria 546
73 Ga0157375_10111143 3300013308 Bacteria 2839
74 Ga0163163_12461174 3300014325 Bacteria 579
75 Ga0157380_10024184 3300014326 Bacteria 4594
76 Ga0157380_11631353 3300014326 Bacteria 701
77 Ga0157377_10148670 3300014745 Bacteria 1446
78 Ga0157376_10113394 3300014969 Bacteria 2390
79 Ga0182006_1014147 3300015261 Bacteria 3444
80 Ga0207656_10057582 3300025321 Bacteria 1696
81 Ga0207705_10113787 3300025909 Bacteria 2001
82 Ga0207660_10316969 3300025917 Bacteria 1244
83 Ga0207650_11006861 3300025925 Bacteria 709
84 Ga0207644_11520960 3300025931 Bacteria 562
85 Ga0207690_10221624 3300025932 Bacteria 1447
86 Ga0207706_10016766 3300025933 Bacteria 6612
87 Ga0207686_10441806 3300025934 Bacteria 999
88 Ga0207686_10475935 3300025934 Bacteria 965
89 Ga0207669_10011736 3300025937 Bacteria 4278
90 Ga0207669_10255874 3300025937 Bacteria 1307
91 Ga0207704_10233875 3300025938 Bacteria 1368
92 Ga0207704_10946343 3300025938 Bacteria 726
93 Ga0207691_10042202 3300025940 Bacteria 4206
94 Ga0207689_10308062 3300025942 Bacteria 1313
95 Ga0207661_10039662 3300025944 Bacteria 3698
96 Ga0207661_10256723 3300025944 Bacteria 1556
97 Ga0207679_10059858 3300025945 Bacteria 2827
98 Ga0207679_11017759 3300025945 Bacteria 759
99 Ga0207679_11782102 3300025945 Bacteria 563
100 Ga0207651_10035026 3300025960 Bacteria 3259
101 Ga0207712_10462178 3300025961 Bacteria 1078
102 Ga0207712_10772106 3300025961 Bacteria 843
103 Ga0207668_10026019 3300025972 Bacteria 3795
104 Ga0207640_10042625 3300025981 Bacteria 2895
105 Ga0207677_10002699 3300026023 Bacteria 9359
106 Ga0207678_10007285 3300026067 Bacteria 9805
107 Ga0207678_10620435 3300026067 Bacteria 949
108 Ga0207708_10001444 3300026075 Bacteria 17790
109 Ga0207708_10069763 3300026075 Bacteria 2691
110 Ga0207641_10244743 3300026088 Bacteria 1673
111 Ga0207648_10026624 3300026089 Bacteria 5137
112 Ga0207648_10084857 3300026089 Bacteria 2762
113 Ga0207648_10568863 3300026089 Bacteria 1043
114 Ga0207674_10374547 3300026116 Bacteria 1376
115 Ga0207674_10405137 3300026116 Bacteria 1318
116 Ga0207674_10927135 3300026116 Bacteria 839
117 Ga0207683_11646330 3300026121 Bacteria 591
118 Ga0207698_10051218 3300026142 Bacteria 3155
119 Ga0207698_12385230 3300026142 Bacteria 540
120 Ga0209281_1000167 3300027111 Bacteria 155556
121 Ga0268265_10685183 3300028380 Bacteria 989
122 Ga0268264_11003537 3300028381 Bacteria 841
123 Ga0307408_100150208 3300031548 Bacteria 1838
124 Ga0316578_10230621 3300031728 Bacteria 1112
125 Ga0307405_10171543 3300031731 Bacteria 1548
126 Ga0307413_10352783 3300031824 Bacteria 1136
127 Ga0307413_11305366 3300031824 Bacteria 635
128 Ga0307410_10066345 3300031852 Bacteria 2486
129 Ga0307410_10751177 3300031852 Bacteria 826
130 Ga0307409_100919554 3300031995 Bacteria 889
131 Ga0307416_100317932 3300032002 Bacteria 1557
132 Ga0307415_100229752 3300032126 Bacteria 1493
133 Ga0307415_100244158 3300032126 Bacteria 1455
134 Ga0307415_100276645 3300032126 Bacteria 1378
135 Ga0316574_0103604 3300035398 Bacteria 1822
136 Ga0316584_0042211 3300036712 Bacteria 3401
137 Ga0436365_0788786 3300039437 Bacteria 855
138 Ga0436365_0979009 3300039437 Bacteria 1204
139 Ga0436360_0218816 3300039438 Bacteria 1456
140 Ga0436360_1034734 3300039438 Bacteria 627
141 Ga0436362_0198402 3300039453 Bacteria 562
142 Ga0436362_1201998 3300039453 Bacteria 751
143 Ga0466959_0039168 3300045049 Bacteria 3503
144 Ga0466967_0083222 3300045976 Bacteria 2893
145 Ga0466967_0089439 3300045976 Bacteria 2796
146 Ga0495617_003391 3300046452 Bacteria 6007
147 Ga0495627_003181 3300046453 Bacteria 7391
148 Ga0495603_0108793 3300046455 Bacteria 1618
149 Ga0495610_0000068 3300046512 Bacteria 122949
150 Ga0495637_0001630 3300046520 Bacteria 13014
151 Ga0495643_0156226 3300046522 Bacteria 1126
152 Ga0495648_0000992 3300046524 Bacteria 29186
153 Ga0495656_0469366 3300046615 Bacteria 665
154 Ga0495661_0111141 3300046665 Bacteria 1527
155 Ga0495681_0000155 3300047470 Bacteria 57469
156 Ga0495686_0000518 3300047472 Bacteria 55768
157 Ga0496103_0257712 3300048906 Bacteria 1122
158 Ga0496103_0899525 3300048906 Bacteria 555
159 Ga0496108_0016907 3300048911 Bacteria 5962
160 Ga0496108_0356838 3300048911 Bacteria 1276
161 Ga0496109_0105571 3300048912 Bacteria 2616
162 Ga0496109_0177338 3300048912 Bacteria 2001
163 Ga0496109_0515602 3300048912 Bacteria 1128
164 Ga0496110_0517078 3300048913 Bacteria 1086
165 Ga0496111_0167678 3300048914 Bacteria 1631
166 Ga0496112_1457546 3300048915 Bacteria 599
167 Ga0496113_0031235 3300048916 Bacteria 3864
168 Ga0496113_0525052 3300048916 Bacteria 950
169 Ga0496121_0035900 3300048924 Bacteria 4429
170 Ga0501034_0857625 3300049571 Bacteria 798
171 Ga0501042_0083927 3300049578 Bacteria 2284
172 Ga0501067_0161731 3300049583 Bacteria 1247
173 Ga0501069_0319334 3300049585 Bacteria 912
174 Ga0501070_0147030 3300049586 Bacteria 1945
175 Ga0501070_0198804 3300049586 Bacteria 1646
176 Ga0501072_0283818 3300049588 Bacteria 1317
177 Ga0501072_0347540 3300049588 Bacteria 1177
178 Ga0501073_0133019 3300049589 Bacteria 1724
179 Ga0501074_0346118 3300049590 Bacteria 1055
180 Ga0501079_0620160 3300049741 Bacteria 851
181 Ga0501080_0417589 3300049742 Bacteria 1206
182 Ga0501044_1613573 3300049823 Bacteria 514
183 Ga0501045_0119951 3300049824 Bacteria 1953
184 nmdc:mga03n38_131461_c1 3300050490 Bacteria 1241
185 nmdc:mga00v17_269023_c1 3300050491 Bacteria 1106
186 nmdc:mga0yw44_16139_c1 3300050492 Bacteria 4027
187 nmdc:mga0yw44_766718_c1 3300050492 Bacteria 655
188 nmdc:mga0qj67_450616_c1 3300050509 Bacteria 1036
189 nmdc:mga08y16_132149_c1 3300050511 Bacteria 2595
190 Ga0500652_086281 3300053131 Bacteria 1309
191 Ga0500645_000078 3300053730 Bacteria 76931
192 Ga0501084_0820142 3300054114 Bacteria 783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_101095185 Ga0068858_1010951852 128
2 3300026089 Ga0207648_10084857 Ga0207648_100848572 128
3 3300039453 Ga0436362_0198402 Ga0436362_0198402_46_432 128
4 3300031731 Ga0307405_10171543 Ga0307405_101715432 131
5 3300049578 Ga0501042_0083927 Ga0501042_0083927_112_522 133
6 3300049823 Ga0501044_1613573 Ga0501044_1613573_22_432 133
7 3300050509 nmdc:mga0qj67_450616_c1 nmdc:mga0qj67_450616_c1_268_675 135
8 iso_pu_bacteria 2651869719 2652545047 135
9 iso_pu_bacteria 3007866637 3007870741 135
10 3300005617 Ga0068859_101153176 Ga0068859_1011531761 136
11 3300005841 Ga0068863_100113065 Ga0068863_1001130652 136
12 3300006931 Ga0097620_101153214 Ga0097620_1011532142 136
13 3300005331 Ga0070670_101151894 Ga0070670_1011518941 137
14 3300005340 Ga0070689_100707079 Ga0070689_1007070791 137
15 3300005535 Ga0070684_100858239 Ga0070684_1008582392 137
16 3300005985 Ga0081539_10165597 Ga0081539_101655971 137
17 3300014325 Ga0163163_12461174 Ga0163163_124611742 137
18 3300025925 Ga0207650_11006861 Ga0207650_110068612 137
19 3300026116 Ga0207674_10927135 Ga0207674_109271352 137
20 3300031852 Ga0307410_10751177 Ga0307410_107511772 137
21 3300039437 Ga0436365_0979009 Ga0436365_0979009_689_1102 137
22 3300046455 Ga0495603_0108793 Ga0495603_0108793_413_826 137
23 3300048911 Ga0496108_0356838 Ga0496108_0356838_40_453 137
24 3300048912 Ga0496109_0105571 Ga0496109_0105571_1326_1739 137
25 3300048913 Ga0496110_0517078 Ga0496110_0517078_352_765 137
26 3300048915 Ga0496112_1457546 Ga0496112_1457546_109_522 137
27 3300048916 Ga0496113_0525052 Ga0496113_0525052_112_525 137
28 3300005338 Ga0068868_100004585 Ga0068868_1000045858 138
29 3300005345 Ga0070692_10644977 Ga0070692_106449772 138
30 3300005459 Ga0068867_100428943 Ga0068867_1004289432 138
31 3300005535 Ga0070684_100357025 Ga0070684_1003570252 138
32 3300005615 Ga0070702_100421545 Ga0070702_1004215452 138
33 3300005834 Ga0068851_10642822 Ga0068851_106428221 138
34 3300006038 Ga0075365_10691324 Ga0075365_106913242 138
35 3300006048 Ga0075363_100348849 Ga0075363_1003488492 138
36 3300006237 Ga0097621_100041903 Ga0097621_1000419034 138
37 3300009094 Ga0111539_10724817 Ga0111539_107248172 138
38 3300009098 Ga0105245_11749155 Ga0105245_117491551 138
39 3300009176 Ga0105242_10183477 Ga0105242_101834772 138
40 3300009176 Ga0105242_10667027 Ga0105242_106670272 138
41 3300009551 Ga0105238_10782657 Ga0105238_107826571 138
42 3300014969 Ga0157376_10113394 Ga0157376_101133942 138
43 3300025931 Ga0207644_11520960 Ga0207644_115209601 138
44 3300025934 Ga0207686_10441806 Ga0207686_104418062 138
45 3300025934 Ga0207686_10475935 Ga0207686_104759352 138
46 3300025937 Ga0207669_10255874 Ga0207669_102558742 138
47 3300025938 Ga0207704_10946343 Ga0207704_109463432 138
48 3300025945 Ga0207679_11782102 Ga0207679_117821022 138
49 3300026023 Ga0207677_10002699 Ga0207677_100026994 138
50 3300026075 Ga0207708_10069763 Ga0207708_100697633 138
51 3300026088 Ga0207641_10244743 Ga0207641_102447432 138
52 3300026089 Ga0207648_10568863 Ga0207648_105688632 138
53 3300026121 Ga0207683_11646330 Ga0207683_116463301 138
54 3300026142 Ga0207698_12385230 Ga0207698_123852302 138
55 3300046615 Ga0495656_0469366 Ga0495656_0469366_31_447 138
56 3300048906 Ga0496103_0899525 Ga0496103_0899525_74_490 138
57 3300048912 Ga0496109_0177338 Ga0496109_0177338_1070_1486 138
58 3300048924 Ga0496121_0035900 Ga0496121_0035900_3599_4015 138
59 3300006048 Ga0075363_100002495 Ga0075363_1000024956 139
60 3300006048 Ga0075363_100136358 Ga0075363_1001363582 139
61 3300006051 Ga0075364_10054709 Ga0075364_100547092 139
62 3300006946 Ga0079104_1000422 Ga0079104_100042243 139
63 3300015261 Ga0182006_1014147 Ga0182006_10141473 139
64 3300027111 Ga0209281_1000167 Ga0209281_100016738 139
65 3300031824 Ga0307413_10352783 Ga0307413_103527832 139
66 3300032126 Ga0307415_100229752 Ga0307415_1002297521 139
67 3300045976 Ga0466967_0089439 Ga0466967_0089439_20_439 139
68 3300050490 nmdc:mga03n38_131461_c1 nmdc:mga03n38_131461_c1_634_1071 139
69 3300050492 nmdc:mga0yw44_766718_c1 nmdc:mga0yw44_766718_c1_168_605 139
70 3300005614 Ga0068856_101485895 Ga0068856_1014858952 140
71 3300009553 Ga0105249_12119765 Ga0105249_121197651 140
72 3300014326 Ga0157380_11631353 Ga0157380_116313531 140
73 3300014745 Ga0157377_10148670 Ga0157377_101486702 140
74 3300025944 Ga0207661_10256723 Ga0207661_102567232 140
75 3300026067 Ga0207678_10620435 Ga0207678_106204352 140
76 3300045976 Ga0466967_0083222 Ga0466967_0083222_949_1401 140
77 3300046522 Ga0495643_0156226 Ga0495643_0156226_100_522 140
78 3300006852 Ga0075433_10860830 Ga0075433_108608302 141
79 3300032126 Ga0307415_100276645 Ga0307415_1002766452 143
80 3300039438 Ga0436360_0218816 Ga0436360_0218816_563_1000 143
81 3300039453 Ga0436362_1201998 Ga0436362_1201998_195_632 143
82 3300049588 Ga0501072_0283818 Ga0501072_0283818_386_820 143
83 3300049741 Ga0501079_0620160 Ga0501079_0620160_353_790 143
84 3300049824 Ga0501045_0119951 Ga0501045_0119951_1039_1473 143
85 3300054114 Ga0501084_0820142 Ga0501084_0820142_257_691 143
86 3300005327 Ga0070658_10065977 Ga0070658_100659772 144
87 3300005329 Ga0070683_100170258 Ga0070683_1001702582 144
88 3300005334 Ga0068869_100280084 Ga0068869_1002800842 144
89 3300005335 Ga0070666_10732787 Ga0070666_107327871 144
90 3300005336 Ga0070680_100114094 Ga0070680_1001140942 144
91 3300005337 Ga0070682_100007028 Ga0070682_1000070282 144
92 3300005338 Ga0068868_100129799 Ga0068868_1001297992 144
93 3300005341 Ga0070691_10167669 Ga0070691_101676692 144
94 3300005347 Ga0070668_100016306 Ga0070668_1000163065 144
95 3300005364 Ga0070673_100049515 Ga0070673_1000495153 144
96 3300005365 Ga0070688_100376041 Ga0070688_1003760412 144
97 3300005366 Ga0070659_100005423 Ga0070659_1000054238 144
98 3300005438 Ga0070701_10238803 Ga0070701_102388032 144
99 3300005441 Ga0070700_100005426 Ga0070700_1000054262 144
100 3300005455 Ga0070663_100153132 Ga0070663_1001531323 144
101 3300005457 Ga0070662_100713890 Ga0070662_1007138902 144
102 3300005459 Ga0068867_100008677 Ga0068867_1000086774 144
103 3300005535 Ga0070684_100080571 Ga0070684_1000805711 144
104 3300005536 Ga0070697_100954896 Ga0070697_1009548961 144
105 3300005543 Ga0070672_100034169 Ga0070672_1000341693 144
106 3300005564 Ga0070664_100014549 Ga0070664_1000145498 144
107 3300005617 Ga0068859_100339325 Ga0068859_1003393252 144
108 3300005618 Ga0068864_101425264 Ga0068864_1014252642 144
109 3300005834 Ga0068851_10028981 Ga0068851_100289812 144
110 3300005841 Ga0068863_101910087 Ga0068863_1019100872 144
111 3300005843 Ga0068860_100258434 Ga0068860_1002584342 144
112 3300006038 Ga0075365_10008805 Ga0075365_100088057 144
113 3300006048 Ga0075363_100141456 Ga0075363_1001414562 144
114 3300006178 Ga0075367_10100978 Ga0075367_101009783 144
115 3300006881 Ga0068865_100023941 Ga0068865_1000239416 144
116 3300006931 Ga0097620_100339294 Ga0097620_1003392942 144
117 3300009094 Ga0111539_10104545 Ga0111539_101045452 144
118 3300009148 Ga0105243_10015151 Ga0105243_100151514 144
119 3300009176 Ga0105242_10475972 Ga0105242_104759722 144
120 3300009177 Ga0105248_12855026 Ga0105248_128550261 144
121 3300010375 Ga0105239_10089547 Ga0105239_100895473 144
122 3300013307 Ga0157372_12931058 Ga0157372_129310581 144
123 3300013308 Ga0157375_10111143 Ga0157375_101111432 144
124 3300014326 Ga0157380_10024184 Ga0157380_100241843 144
125 3300025321 Ga0207656_10057582 Ga0207656_100575822 144
126 3300025909 Ga0207705_10113787 Ga0207705_101137872 144
127 3300025917 Ga0207660_10316969 Ga0207660_103169692 144
128 3300025932 Ga0207690_10221624 Ga0207690_102216242 144
129 3300025933 Ga0207706_10016766 Ga0207706_100167663 144
130 3300025937 Ga0207669_10011736 Ga0207669_100117364 144
131 3300025938 Ga0207704_10233875 Ga0207704_102338752 144
132 3300025940 Ga0207691_10042202 Ga0207691_100422024 144
133 3300025942 Ga0207689_10308062 Ga0207689_103080622 144
134 3300025944 Ga0207661_10039662 Ga0207661_100396622 144
135 3300025945 Ga0207679_10059858 Ga0207679_100598583 144
136 3300025945 Ga0207679_11017759 Ga0207679_110177592 144
137 3300025960 Ga0207651_10035026 Ga0207651_100350265 144
138 3300025961 Ga0207712_10462178 Ga0207712_104621782 144
139 3300025972 Ga0207668_10026019 Ga0207668_100260193 144
140 3300025981 Ga0207640_10042625 Ga0207640_100426253 144
141 3300026067 Ga0207678_10007285 Ga0207678_100072852 144
142 3300026075 Ga0207708_10001444 Ga0207708_100014448 144
143 3300026089 Ga0207648_10026624 Ga0207648_100266247 144
144 3300026116 Ga0207674_10374547 Ga0207674_103745472 144
145 3300026142 Ga0207698_10051218 Ga0207698_100512184 144
146 3300028380 Ga0268265_10685183 Ga0268265_106851832 144
147 3300028381 Ga0268264_11003537 Ga0268264_110035372 144
148 3300031548 Ga0307408_100150208 Ga0307408_1001502083 144
149 3300031728 Ga0316578_10230621 Ga0316578_102306213 144
150 3300031824 Ga0307413_11305366 Ga0307413_113053662 144
151 3300031852 Ga0307410_10066345 Ga0307410_100663453 144
152 3300031995 Ga0307409_100919554 Ga0307409_1009195541 144
153 3300032002 Ga0307416_100317932 Ga0307416_1003179321 144
154 3300035398 Ga0316574_0103604 Ga0316574_0103604_1193_1642 144
155 3300036712 Ga0316584_0042211 Ga0316584_0042211_2246_2692 144
156 3300039437 Ga0436365_0788786 Ga0436365_0788786_277_711 144
157 3300048906 Ga0496103_0257712 Ga0496103_0257712_477_914 144
158 3300048911 Ga0496108_0016907 Ga0496108_0016907_324_773 144
159 3300048912 Ga0496109_0515602 Ga0496109_0515602_189_638 144
160 3300048914 Ga0496111_0167678 Ga0496111_0167678_415_864 144
161 3300048916 Ga0496113_0031235 Ga0496113_0031235_1428_1877 144
162 3300050491 nmdc:mga00v17_269023_c1 nmdc:mga00v17_269023_c1_226_675 144
163 3300050492 nmdc:mga0yw44_16139_c1 nmdc:mga0yw44_16139_c1_3417_3866 144
164 3300050511 nmdc:mga08y16_132149_c1 nmdc:mga08y16_132149_c1_2067_2516 144
165 3300006163 Ga0070715_10553901 Ga0070715_105539011 145
166 3300032126 Ga0307415_100244158 Ga0307415_1002441583 145
167 3300039438 Ga0436360_1034734 Ga0436360_1034734_150_593 145
168 3300045049 Ga0466959_0039168 Ga0466959_0039168_1507_1968 145
169 3300046452 Ga0495617_003391 Ga0495617_003391_621_1058 145
170 3300046453 Ga0495627_003181 Ga0495627_003181_921_1358 145
171 3300046512 Ga0495610_0000068 Ga0495610_0000068_14606_15043 145
172 3300046524 Ga0495648_0000992 Ga0495648_0000992_6241_6678 145
173 3300046665 Ga0495661_0111141 Ga0495661_0111141_1049_1486 145
174 3300047470 Ga0495681_0000155 Ga0495681_0000155_24337_24774 145
175 3300047472 Ga0495686_0000518 Ga0495686_0000518_47770_48207 145
176 3300053131 Ga0500652_086281 Ga0500652_086281_820_1257 145
177 3300053730 Ga0500645_000078 Ga0500645_000078_26193_26630 145
178 3300005445 Ga0070708_102188033 Ga0070708_1021880331 146
179 3300025961 Ga0207712_10772106 Ga0207712_107721062 146
180 3300026116 Ga0207674_10405137 Ga0207674_104051372 148
181 3300049586 Ga0501070_0147030 Ga0501070_0147030_548_1009 148
182 3300049571 Ga0501034_0857625 Ga0501034_0857625_283_747 149
183 3300049583 Ga0501067_0161731 Ga0501067_0161731_414_878 149
184 3300049585 Ga0501069_0319334 Ga0501069_0319334_204_668 149
185 3300049586 Ga0501070_0198804 Ga0501070_0198804_1092_1556 149
186 3300049588 Ga0501072_0347540 Ga0501072_0347540_261_725 149
187 3300049589 Ga0501073_0133019 Ga0501073_0133019_384_848 149
188 3300049590 Ga0501074_0346118 Ga0501074_0346118_483_947 149
189 3300049742 Ga0501080_0417589 Ga0501080_0417589_282_746 149
190 3300006038 Ga0075365_10337495 Ga0075365_103374952 150
191 3300006051 Ga0075364_10356735 Ga0075364_103567352 150
192 3300009176 Ga0105242_10708996 Ga0105242_107089962 150
193 3300003322 rootL2_10137492 rootL2_101374924 151
194 3300046520 Ga0495637_0001630 Ga0495637_0001630_4420_4887 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

22

105

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

14

131

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9484 8 145
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9099 8 145
4r4u-assembly2.cif.gz_C crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.9039 62 122
3cjy-assembly1.cif.gz_A-2 crystal structure of putative thioesterase (yp_496845.1) from novosphingobium aromaticivorans dsm 12444 at 1.70 a resolution 0.9014 70 121
7qv0-assembly1.cif.gz_C-2 covalent complex between scalindua brodae amxfabz and amxacp 0.8989 64 121
ID Description Score Start End Superfamily
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9395 8 146 3.10.129.10
af_Q9DCP4_49_221_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9228 9 146 3.10.129.10
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9202 8 146 3.10.129.10
af_O07408_6_147_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.92 5 143 3.10.129.10
3cjyA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9014 70 121 2.40.160.210
ID Description Score Start End GO Terms
AF-A0A7J9XZC3-F1-model_v4 Acyl-CoA thioesterase 0.9852 43 147
AF-A0A317T2H7-F1-model_v4 Thioesterase domain-containing protein 0.9828 43 147
AF-A0A3D0GPC1-F1-model_v4 Thioesterase 0.9791 51 146 GO:0016790
AF-J2XF73-F1-model_v4 Putative thioesterase 0.9773 33 146 GO:0047617
AF-A0A3D2SRH1-F1-model_v4 Thioesterase 0.9745 39 147 GO:0047617

Feature Viewer

pLDDT pTM Quality
86.73 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map