F298450

General Info

Members Datasets Scaffolds Average Seq Length
194 143 388 297

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10118640|Ga0070717_101186402
Length 350
Sequence MVRTLSADRLRLRAYRPVGAQLVAAGLAERAGQRRCAVDVDRPKACDHTGVRSGVPAAAWAEQQVAAVRDDPAGRITLMERCYYGPFGNAPRHLPFRRAAMAFMRWQLQRGVLQPSFSDRPGSPWWRAVNERILRDGCEAVGLSGGLPGPGSSRTVDYWMSFADYPIARAWYRAHNGSVVAAYLEHRDLADAENDAERFFMNVVLCRVLYTHALVAAPRMSLGWLRPLAPFLGDPRLGMTGIFLQLSRVLPAEYPLRGSVQSYLSAEHGFGRLVDFGMIVPRLQQLYEWSAHELAAPGLLDCVRDGAMTYAWAFEDRDVWRPPKSFILQMARRALPPERRARGARPLAGH

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
43 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
44 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
45 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
46 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
47 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
48 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
61 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
62 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
63 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
90 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
91 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2671180195 Frankia sp. CcI49 Isolate Nodule
141 2773857922 Frankia sp. CcI49 Isolate Nodule
142 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
143 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 1.03
Rhizoplane 12.37
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10118640 3300006028 Bacteria 2264
2 LJQas_1010773 3300000549 Bacteria 1092
3 Ga0070713_100018298 3300005436 Bacteria 5326
4 Ga0070710_10152545 3300005437 Bacteria 1426
5 Ga0070711_100078194 3300005439 Bacteria 2350
6 Ga0070678_100316243 3300005456 Bacteria 1332
7 Ga0070665_100061671 3300005548 Bacteria 3759
8 Ga0070702_100090895 3300005615 Bacteria 1851
9 Ga0068863_100003607 3300005841 Bacteria 15285
10 Ga0068858_100054539 3300005842 Bacteria 3696
11 Ga0081455_10032786 3300005937 Bacteria 4676
12 Ga0081539_10004296 3300005985 Bacteria 15943
13 Ga0070712_100013963 3300006175 Bacteria 5145
14 Ga0075430_100140138 3300006846 Bacteria 2014
15 Ga0075430_100219995 3300006846 Bacteria 1575
16 Ga0075431_100004440 3300006847 Bacteria 13751
17 Ga0075431_100236338 3300006847 Bacteria 1860
18 Ga0105245_10088538 3300009098 Bacteria 2844
19 Ga0105248_10259197 3300009177 Bacteria 1957
20 Ga0105249_10136333 3300009553 Bacteria 2349
21 Ga0105239_10935308 3300010375 Bacteria 995
22 Ga0163162_10463851 3300013306 Bacteria 1398
23 Ga0157375_10678673 3300013308 Bacteria 1185
24 Ga0163163_10015648 3300014325 Bacteria 7020
25 Ga0163163_10016501 3300014325 Bacteria 6867
26 Ga0213876_10000795 3300021384 Bacteria 21427
27 Ga0213875_10073491 3300021388 Bacteria 1595
28 Ga0207688_10030213 3300025901 Bacteria 2987
29 Ga0207699_10279721 3300025906 Bacteria 1159
30 Ga0207654_10085859 3300025911 Bacteria 1906
31 Ga0207671_10105694 3300025914 Bacteria 2136
32 Ga0207693_10007594 3300025915 Bacteria 8910
33 Ga0207663_10023033 3300025916 Bacteria 3569
34 Ga0207663_10315125 3300025916 Bacteria 1173
35 Ga0207700_10121654 3300025928 Bacteria 2117
36 Ga0207664_10009086 3300025929 Bacteria 6961
37 Ga0207670_10198562 3300025936 Bacteria 1522
38 Ga0207711_10529462 3300025941 Bacteria 1099
39 Ga0207658_10163254 3300025986 Bacteria 1827
40 Ga0207641_10024063 3300026088 Bacteria 5018
41 Ga0207641_10110502 3300026088 Bacteria 2436
42 Ga0207676_10101691 3300026095 Bacteria 2384
43 Ga0207683_10404169 3300026121 Bacteria 1257
44 Ga0207428_10201130 3300027907 Bacteria 1499
45 Ga0268266_10044196 3300028379 Bacteria 3808
46 Ga0307509_10110002 3300031507 Bacteria 2763
47 Ga0373953_0042630 3300035117 Bacteria 1809
48 Ga0373954_0165363 3300035118 Bacteria 1083
49 Ga0373955_0097289 3300035172 Bacteria 1685
50 Ga0373924_0067877 3300035410 Bacteria 1500
51 Ga0373933_0004483 3300035724 Bacteria 7658
52 Ga0373947_0177624 3300035725 Bacteria 1384
53 Ga0373937_0063420 3300036401 Bacteria 3398
54 Ga0373925_0037915 3300037068 Bacteria 3560
55 Ga0373925_0097721 3300037068 Bacteria 2252
56 Ga0436364_1346727 3300037853 Bacteria 1567
57 Ga0436365_0928916 3300039437 Bacteria 34395
58 Ga0466961_0012577 3300044693 Bacteria 5418
59 Ga0466968_0019235 3300044735 Bacteria 2748
60 Ga0466968_0096924 3300044735 Bacteria 1313
61 Ga0466958_0152426 3300045836 Bacteria 1458
62 Ga0495592_0033614 3300046454 Bacteria 3867
63 Ga0495592_0140522 3300046454 Bacteria 1680
64 Ga0495603_0004541 3300046455 Bacteria 8281
65 Ga0495603_0017428 3300046455 Bacteria 4346
66 Ga0495629_0010718 3300046459 Bacteria 6666
67 Ga0495629_0015635 3300046459 Bacteria 5449
68 Ga0495629_0019671 3300046459 Bacteria 4821
69 Ga0495641_0009340 3300046461 Bacteria 5835
70 Ga0495651_0108581 3300046462 Bacteria 2055
71 Ga0495653_0009054 3300046463 Bacteria 8143
72 Ga0495653_0015304 3300046463 Bacteria 6253
73 Ga0495582_0074730 3300046473 Bacteria 1877
74 Ga0495639_0055111 3300046475 Bacteria 1813
75 Ga0495639_0063840 3300046475 Bacteria 1691
76 Ga0495662_0007882 3300046476 Bacteria 5243
77 Ga0495662_0037271 3300046476 Bacteria 2348
78 Ga0495662_0156208 3300046476 Bacteria 1123
79 Ga0495594_0193658 3300046499 Bacteria 1158
80 Ga0495618_0020999 3300046514 Bacteria 4022
81 Ga0495618_0039348 3300046514 Bacteria 2972
82 Ga0495630_0051788 3300046517 Bacteria 3072
83 Ga0495630_0125040 3300046517 Bacteria 1951
84 Ga0495630_0253113 3300046517 Bacteria 1346
85 Ga0495666_0015456 3300046526 Bacteria 3800
86 Ga0495652_0067442 3300046529 Bacteria 3000
87 Ga0495665_0001840 3300046531 Bacteria 11455
88 Ga0495640_0035766 3300046533 Bacteria 3514
89 Ga0495640_0036185 3300046533 Bacteria 3488
90 Ga0495640_0085108 3300046533 Bacteria 2095
91 Ga0495586_0061595 3300046535 Unclassified 2042
92 Ga0495645_0017452 3300046543 Bacteria 5141
93 Ga0495634_0028250 3300046642 Bacteria 3895
94 Ga0495634_0041630 3300046642 Bacteria 3119
95 Ga0495634_0115852 3300046642 Bacteria 1719
96 Ga0495625_0000171 3300046660 Bacteria 101895
97 Ga0495588_0094865 3300046674 Bacteria 1564
98 Ga0495657_0056093 3300046675 Bacteria 2625
99 Ga0495599_0014370 3300046678 Bacteria 4902
100 Ga0495646_0072096 3300046680 Bacteria 2032
101 Ga0495647_0030882 3300046681 Bacteria 1990
102 Ga0495658_0005750 3300046683 Bacteria 6092
103 Ga0495658_0132379 3300046683 Unclassified 1519
104 Ga0495613_0000497 3300046689 Bacteria 33262
105 Ga0495613_0012369 3300046689 Bacteria 6341
106 Ga0495624_0136156 3300046690 Bacteria 1505
107 Ga0495649_0099543 3300046694 Bacteria 1546
108 Ga0495600_0053942 3300046809 Bacteria 2625
109 Ga0495581_0015785 3300047315 Bacteria 4385
110 Ga0495581_0018551 3300047315 Bacteria 4040
111 Ga0495604_0271222 3300047317 Bacteria 1149
112 Ga0495674_0007684 3300047319 Bacteria 10298
113 Ga0495674_0028157 3300047319 Bacteria 5128
114 Ga0495680_0072068 3300047322 Bacteria 2628
115 Ga0495684_0032352 3300047471 Bacteria 4015
116 Ga0495593_0022898 3300047673 Bacteria 3476
117 Ga0495602_0150702 3300048088 Bacteria 1828
118 Ga0496100_0052438 3300048903 Bacteria 2652
119 Ga0496102_0083772 3300048905 Bacteria 2942
120 Ga0496102_0140590 3300048905 Bacteria 2263
121 Ga0496102_0195880 3300048905 Bacteria 1904
122 Ga0496102_0230278 3300048905 Bacteria 1747
123 Ga0496103_0080765 3300048906 Bacteria 2045
124 Ga0496103_0242449 3300048906 Bacteria 1160
125 Ga0496104_0016936 3300048907 Bacteria 6630
126 Ga0496104_0067520 3300048907 Bacteria 3397
127 Ga0496105_0231133 3300048908 Bacteria 1503
128 Ga0496106_0277820 3300048909 Bacteria 1342
129 Ga0496107_0161642 3300048910 Bacteria 1660
130 Ga0496108_0107766 3300048911 Bacteria 2379
131 Ga0496108_0124310 3300048911 Bacteria 2214
132 Ga0496110_0037372 3300048913 Bacteria 4220
133 Ga0496111_0167648 3300048914 Bacteria 1631
134 Ga0496112_0021701 3300048915 Bacteria 6108
135 Ga0496112_0032709 3300048915 Bacteria 5050
136 Ga0496113_0253280 3300048916 Bacteria 1406
137 Ga0496114_0018404 3300048917 Bacteria 5647
138 Ga0496114_0126586 3300048917 Bacteria 2203
139 Ga0496114_0538595 3300048917 Bacteria 1032
140 Ga0496115_0016045 3300048918 Bacteria 5696
141 Ga0496115_0169588 3300048918 Bacteria 1805
142 Ga0501031_0044256 3300049568 Bacteria 2905
143 Ga0501033_0015540 3300049570 Bacteria 5773
144 Ga0501036_0022953 3300049572 Bacteria 5253
145 Ga0501036_0393460 3300049572 Bacteria 1156
146 Ga0501038_0026609 3300049574 Bacteria 5151
147 Ga0501039_0016354 3300049575 Bacteria 5685
148 Ga0501040_0002933 3300049576 Bacteria 11031
149 Ga0501041_0003373 3300049577 Bacteria 9192
150 Ga0501041_0092343 3300049577 Bacteria 1869
151 Ga0501041_0098121 3300049577 Bacteria 1812
152 Ga0501043_0020891 3300049579 Bacteria 5135
153 Ga0501048_0020484 3300049582 Bacteria 4846
154 Ga0501068_0064904 3300049584 Bacteria 2222
155 Ga0501070_0425350 3300049586 Bacteria 1072
156 Ga0501071_0013570 3300049587 Bacteria 5555
157 Ga0501071_0061924 3300049587 Bacteria 2710
158 Ga0501074_0055785 3300049590 Bacteria 2847
159 Ga0501075_0003971 3300049591 Bacteria 9975
160 Ga0501075_0307257 3300049591 Bacteria 1208
161 Ga0501076_0101207 3300049592 Bacteria 2322
162 Ga0501079_0006279 3300049741 Bacteria 8914
163 Ga0501080_0017616 3300049742 Bacteria 6606
164 Ga0501081_0009661 3300049743 Bacteria 6289
165 Ga0501035_0235176 3300049822 Bacteria 1560
166 Ga0501044_0182290 3300049823 Bacteria 2066
167 Ga0501045_0010067 3300049824 Bacteria 6614
168 Ga0501045_0071631 3300049824 Bacteria 2551
169 nmdc:mga05p37_351372_c1 3300050507 Bacteria 1736
170 nmdc:mga05p37_6142_c1 3300050507 Bacteria 14134
171 nmdc:mga09592_1898_c1 3300050508 Bacteria 16810
172 nmdc:mga0qj67_228945_c1 3300050509 Bacteria 1508
173 nmdc:mga0qj67_2824_c1 3300050509 Bacteria 12457
174 nmdc:mga06r32_129110_c1 3300050510 Bacteria 2498
175 nmdc:mga06r32_3846_c1 3300050510 Bacteria 13434
176 nmdc:mga06r32_4116_c2 3300050510 Bacteria 7157
177 nmdc:mga06r32_737_c1 3300050510 Bacteria 28697
178 nmdc:mga08y16_391654_c1 3300050511 Bacteria 1423
179 Ga0495601_0218910 3300053077 Bacteria 1243
180 Ga0495619_0031241 3300053085 Bacteria 3450
181 Ga0495619_0098430 3300053085 Bacteria 1988
182 Ga0500568_0000189 3300053139 Bacteria 53789
183 Ga0500604_0015979 3300053151 Bacteria 2062
184 Ga0500616_0002246 3300053153 Bacteria 16514
185 Ga0501084_0018161 3300054114 Bacteria 5856
186 Ga0501084_0411778 3300054114 Bacteria 1143
187 Ga0501082_0036893 3300060353 Bacteria 4211
188 Ga0501082_0106156 3300060353 Bacteria 2430
189 Ga0530510_0011290 3300061734 Bacteria 6269
190 Ga0530510_0029047 3300061734 Bacteria 3967
191 2671833475 2671180195 Bacteria 9757215
192 2774851631 2773857922 Bacteria 9757215
193 2902795010 2902792274 Bacteria 7270173
194 2918504643 2918501144 Bacteria 8668083
195 Ga0070717_10118640
196 LJQas_1010773
197 Ga0070713_100018298
198 Ga0070710_10152545
199 Ga0070711_100078194
200 Ga0070678_100316243
201 Ga0070665_100061671
202 Ga0070702_100090895
203 Ga0068863_100003607
204 Ga0068858_100054539
205 Ga0081455_10032786
206 Ga0081539_10004296
207 Ga0070712_100013963
208 Ga0075430_100140138
209 Ga0075430_100219995
210 Ga0075431_100004440
211 Ga0075431_100236338
212 Ga0105245_10088538
213 Ga0105248_10259197
214 Ga0105249_10136333
215 Ga0105239_10935308
216 Ga0163162_10463851
217 Ga0157375_10678673
218 Ga0163163_10015648
219 Ga0163163_10016501
220 Ga0213876_10000795
221 Ga0213875_10073491
222 Ga0207688_10030213
223 Ga0207699_10279721
224 Ga0207654_10085859
225 Ga0207671_10105694
226 Ga0207693_10007594
227 Ga0207663_10023033
228 Ga0207663_10315125
229 Ga0207700_10121654
230 Ga0207664_10009086
231 Ga0207670_10198562
232 Ga0207711_10529462
233 Ga0207658_10163254
234 Ga0207641_10024063
235 Ga0207641_10110502
236 Ga0207676_10101691
237 Ga0207683_10404169
238 Ga0207428_10201130
239 Ga0268266_10044196
240 Ga0307509_10110002
241 Ga0373953_0042630
242 Ga0373954_0165363
243 Ga0373955_0097289
244 Ga0373924_0067877
245 Ga0373933_0004483
246 Ga0373947_0177624
247 Ga0373937_0063420
248 Ga0373925_0037915
249 Ga0373925_0097721
250 Ga0436364_1346727
251 Ga0436365_0928916
252 Ga0466961_0012577
253 Ga0466968_0019235
254 Ga0466968_0096924
255 Ga0466958_0152426
256 Ga0495592_0033614
257 Ga0495592_0140522
258 Ga0495603_0004541
259 Ga0495603_0017428
260 Ga0495629_0010718
261 Ga0495629_0015635
262 Ga0495629_0019671
263 Ga0495641_0009340
264 Ga0495651_0108581
265 Ga0495653_0009054
266 Ga0495653_0015304
267 Ga0495582_0074730
268 Ga0495639_0055111
269 Ga0495639_0063840
270 Ga0495662_0007882
271 Ga0495662_0037271
272 Ga0495662_0156208
273 Ga0495594_0193658
274 Ga0495618_0020999
275 Ga0495618_0039348
276 Ga0495630_0051788
277 Ga0495630_0125040
278 Ga0495630_0253113
279 Ga0495666_0015456
280 Ga0495652_0067442
281 Ga0495665_0001840
282 Ga0495640_0035766
283 Ga0495640_0036185
284 Ga0495640_0085108
285 Ga0495586_0061595
286 Ga0495645_0017452
287 Ga0495634_0028250
288 Ga0495634_0041630
289 Ga0495634_0115852
290 Ga0495625_0000171
291 Ga0495588_0094865
292 Ga0495657_0056093
293 Ga0495599_0014370
294 Ga0495646_0072096
295 Ga0495647_0030882
296 Ga0495658_0005750
297 Ga0495658_0132379
298 Ga0495613_0000497
299 Ga0495613_0012369
300 Ga0495624_0136156
301 Ga0495649_0099543
302 Ga0495600_0053942
303 Ga0495581_0015785
304 Ga0495581_0018551
305 Ga0495604_0271222
306 Ga0495674_0007684
307 Ga0495674_0028157
308 Ga0495680_0072068
309 Ga0495684_0032352
310 Ga0495593_0022898
311 Ga0495602_0150702
312 Ga0496100_0052438
313 Ga0496102_0083772
314 Ga0496102_0140590
315 Ga0496102_0195880
316 Ga0496102_0230278
317 Ga0496103_0080765
318 Ga0496103_0242449
319 Ga0496104_0016936
320 Ga0496104_0067520
321 Ga0496105_0231133
322 Ga0496106_0277820
323 Ga0496107_0161642
324 Ga0496108_0107766
325 Ga0496108_0124310
326 Ga0496110_0037372
327 Ga0496111_0167648
328 Ga0496112_0021701
329 Ga0496112_0032709
330 Ga0496113_0253280
331 Ga0496114_0018404
332 Ga0496114_0126586
333 Ga0496114_0538595
334 Ga0496115_0016045
335 Ga0496115_0169588
336 Ga0501031_0044256
337 Ga0501033_0015540
338 Ga0501036_0022953
339 Ga0501036_0393460
340 Ga0501038_0026609
341 Ga0501039_0016354
342 Ga0501040_0002933
343 Ga0501041_0003373
344 Ga0501041_0092343
345 Ga0501041_0098121
346 Ga0501043_0020891
347 Ga0501048_0020484
348 Ga0501068_0064904
349 Ga0501070_0425350
350 Ga0501071_0013570
351 Ga0501071_0061924
352 Ga0501074_0055785
353 Ga0501075_0003971
354 Ga0501075_0307257
355 Ga0501076_0101207
356 Ga0501079_0006279
357 Ga0501080_0017616
358 Ga0501081_0009661
359 Ga0501035_0235176
360 Ga0501044_0182290
361 Ga0501045_0010067
362 Ga0501045_0071631
363 nmdc:mga05p37_351372_c1
364 nmdc:mga05p37_6142_c1
365 nmdc:mga09592_1898_c1
366 nmdc:mga0qj67_228945_c1
367 nmdc:mga0qj67_2824_c1
368 nmdc:mga06r32_129110_c1
369 nmdc:mga06r32_3846_c1
370 nmdc:mga06r32_4116_c2
371 nmdc:mga06r32_737_c1
372 nmdc:mga08y16_391654_c1
373 Ga0495601_0218910
374 Ga0495619_0031241
375 Ga0495619_0098430
376 Ga0500568_0000189
377 Ga0500604_0015979
378 Ga0500616_0002246
379 Ga0501084_0018161
380 Ga0501084_0411778
381 Ga0501082_0036893
382 Ga0501082_0106156
383 Ga0530510_0011290
384 Ga0530510_0029047
385 2671833475
386 2774851631
387 2902795010
388 2918504643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kcu-assembly1.cif.gz_C structure of formate channel 0.2002 19 247
3kcu-assembly1.cif.gz_C structure of formate channel 0.1879 19 247
3q7k-assembly1.cif.gz_D formate channel foca from salmonella typhimurium 0.1684 19 248
3klz-assembly1.cif.gz_A pentameric formate channel with formate bound 0.1665 13 281
4akv-assembly1.cif.gz_A crystal structure of human sorting nexin 33 (snx33) 0.162 7 246
ID Description Score Start End Superfamily
5azdC00 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3084 21 253 1.20.1070.10
5azdC00 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.265 21 253 1.20.1070.10
af_P42173_268_857_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.2296 4 214 1.25.10.10
af_I1KY01_6_220_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.2058 4 194 1.20.120.1770
af_A0A087WSB9_85_220_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2048 22 197 1.20.140.150
ID Description Score Start End GO Terms
AF-C1ARE3-F1-model_v4 Uncharacterized protein 0.9686 2 284
AF-A0A0M9Z7M0-F1-model_v4 deleted 0.9671 2 284
AF-A0A810NVM9-F1-model_v4 Uncharacterized protein 0.9635 1 284
AF-F5XHU0-F1-model_v4 ER-bound oxygenase mpaB/mpaB'/Rubber oxygenase catalytic domain-containing protein 0.9633 2 284
AF-A0A1G6SVJ8-F1-model_v4 Immunity protein 49 0.9633 52 284

Map