F297613

General Info

Members Datasets Scaffolds Average Seq Length
193 152 193 254

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0017945|Ga0495662_0017945_529_1299
Length 237
Sequence MGVVNVTPDSFSDGGLYLDPEAAIAHGRELLGEGADILDVGGESTRPGAAEVVVEEELRRVLPVVAGLAGEATVSVDTMKAIVNDVTALRGDPEMATVCAEGGATVILMHMVGTPRTMQDDPRYGDVVVEVRDFLAERLEAAVAAGIAEERIWLDPGIGFGKTAEHNLELLRRLRPLVVGTSRKSFIGRVDGSGPRDRVGGTVASSLLAAGAGADVLRVHDVAAMRQALTVAAAVAE

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 9.84
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000013 3300001977 Bacteria 16828
2 Ga0070683_100028965 3300005329 Bacteria 5009
3 Ga0070677_10000021 3300005333 Bacteria 47171
4 Ga0070666_10143015 3300005335 Bacteria 1667
5 Ga0070680_100090142 3300005336 Bacteria 2538
6 Ga0070682_100000009 3300005337 Bacteria 291635
7 Ga0068868_100005148 3300005338 Bacteria 9177
8 Ga0070691_10000055 3300005341 Bacteria 31550
9 Ga0070661_100000255 3300005344 Bacteria 43552
10 Ga0070668_100007576 3300005347 Bacteria 8058
11 Ga0070674_100000074 3300005356 Bacteria 46384
12 Ga0070674_100128095 3300005356 Bacteria 1888
13 Ga0070688_100003033 3300005365 Bacteria 8570
14 Ga0070700_100363204 3300005441 Bacteria 1077
15 Ga0070662_100000001 3300005457 Bacteria 317995
16 Ga0070685_10001479 3300005466 Bacteria 12372
17 Ga0070679_100000362 3300005530 Bacteria 38683
18 Ga0070684_100144644 3300005535 Bacteria 2152
19 Ga0068853_100038176 3300005539 Bacteria 4090
20 Ga0070672_100000314 3300005543 Bacteria 27496
21 Ga0070693_100011281 3300005547 Bacteria 4498
22 Ga0070665_100000022 3300005548 Bacteria 379286
23 Ga0070665_100049652 3300005548 Bacteria 4209
24 Ga0068856_100018573 3300005614 Bacteria 6737
25 Ga0068856_100554746 3300005614 Bacteria 1170
26 Ga0068852_100000132 3300005616 Bacteria 50593
27 Ga0068864_100000024 3300005618 Bacteria 252632
28 Ga0068866_10002023 3300005718 Bacteria 8441
29 Ga0068851_10028071 3300005834 Bacteria 2778
30 Ga0068863_100000229 3300005841 Bacteria 59324
31 Ga0068863_100103459 3300005841 Bacteria 2708
32 Ga0068858_100000017 3300005842 Bacteria 186913
33 Ga0068858_100000140 3300005842 Bacteria 76446
34 Ga0081539_10027128 3300005985 Bacteria 3635
35 Ga0070715_10000041 3300006163 Bacteria 63425
36 Ga0097621_100068633 3300006237 Bacteria 2925
37 Ga0075433_10260705 3300006852 Bacteria 1537
38 Ga0105245_10009411 3300009098 Bacteria 8521
39 Ga0105247_10000832 3300009101 Bacteria 23437
40 Ga0105243_10132982 3300009148 Bacteria 2113
41 Ga0105241_10742824 3300009174 Bacteria 899
42 Ga0105242_10000139 3300009176 Bacteria 52585
43 Ga0105242_10008101 3300009176 Bacteria 8084
44 Ga0105248_10000017 3300009177 Bacteria 298089
45 Ga0105238_10000016 3300009551 Bacteria 236218
46 Ga0105239_10562727 3300010375 Bacteria 1299
47 Ga0157370_10008954 3300013104 Bacteria 10749
48 Ga0157369_10010434 3300013105 Bacteria 10586
49 Ga0157378_10168539 3300013297 Bacteria 2052
50 Ga0157372_10000556 3300013307 Bacteria 41040
51 Ga0157375_10019793 3300013308 Bacteria 6133
52 Ga0157375_10341101 3300013308 Bacteria 1664
53 Ga0163163_10379970 3300014325 Bacteria 1470
54 Ga0157380_10152448 3300014326 Bacteria 2000
55 Ga0157379_10039277 3300014968 Bacteria 4222
56 Ga0163161_10000103 3300017792 Bacteria 81496
57 Ga0207656_10040962 3300025321 Bacteria 1966
58 Ga0207653_10027978 3300025885 Bacteria 1811
59 Ga0207682_10000020 3300025893 Bacteria 64537
60 Ga0207642_10000136 3300025899 Bacteria 20531
61 Ga0207710_10000096 3300025900 Bacteria 116063
62 Ga0207680_10008312 3300025903 Bacteria 5085
63 Ga0207685_10000037 3300025905 Bacteria 63409
64 Ga0207654_10488954 3300025911 Bacteria 868
65 Ga0207707_10003109 3300025912 Bacteria 14734
66 Ga0207693_10030587 3300025915 Bacteria 4253
67 Ga0207660_10062700 3300025917 Bacteria 2679
68 Ga0207649_10000015 3300025920 Bacteria 245662
69 Ga0207652_10001682 3300025921 Bacteria 19376
70 Ga0207694_10000012 3300025924 Bacteria 411218
71 Ga0207650_10145896 3300025925 Bacteria 1864
72 Ga0207687_10007755 3300025927 Bacteria 7041
73 Ga0207706_10000003 3300025933 Bacteria 345011
74 Ga0207686_10000035 3300025934 Bacteria 130483
75 Ga0207686_10002089 3300025934 Bacteria 11005
76 Ga0207709_10084878 3300025935 Bacteria 2051
77 Ga0207709_10086243 3300025935 Bacteria 2038
78 Ga0207669_10000002 3300025937 Bacteria 377651
79 Ga0207691_10000286 3300025940 Bacteria 49918
80 Ga0207711_10000011 3300025941 Bacteria 518817
81 Ga0207661_10007061 3300025944 Bacteria 7971
82 Ga0207640_10000907 3300025981 Bacteria 16634
83 Ga0207677_10000956 3300026023 Bacteria 16043
84 Ga0207703_10000020 3300026035 Bacteria 251603
85 Ga0207703_10000030 3300026035 Bacteria 199014
86 Ga0207639_10017318 3300026041 Bacteria 5108
87 Ga0207708_10075453 3300026075 Bacteria 2585
88 Ga0207702_10056339 3300026078 Bacteria 3337
89 Ga0207702_10062233 3300026078 Bacteria 3186
90 Ga0207641_10001448 3300026088 Bacteria 23281
91 Ga0207641_10012452 3300026088 Bacteria 6974
92 Ga0207676_10000048 3300026095 Bacteria 147853
93 Ga0207683_10076310 3300026121 Bacteria 2967
94 Ga0207698_10000014 3300026142 Bacteria 240703
95 Ga0268266_10000029 3300028379 Bacteria 424015
96 Ga0268266_10004781 3300028379 Bacteria 12874
97 Ga0268265_10742293 3300028380 Bacteria 952
98 Ga0265337_1000282 3300028556 Bacteria 27585
99 Ga0265326_10000033 3300028558 Bacteria 91972
100 Ga0265322_10000017 3300028654 Bacteria 114833
101 Ga0265336_10001223 3300028666 Bacteria 12183
102 Ga0265324_10000479 3300029957 Bacteria 28017
103 Ga0265328_10001388 3300031239 Bacteria 11151
104 Ga0265320_10000010 3300031240 Bacteria 250501
105 Ga0265329_10005234 3300031242 Bacteria 5271
106 Ga0265331_10000505 3300031250 Bacteria 36592
107 Ga0265327_10000040 3300031251 Bacteria 291052
108 Ga0265316_10003339 3300031344 Bacteria 16267
109 Ga0265314_10000803 3300031711 Bacteria 37303
110 Ga0373937_0079580 3300036401 Bacteria 3029
111 Ga0466957_0004550 3300044842 Bacteria 7744
112 Ga0466967_0013927 3300045976 Bacteria 6239
113 Ga0466967_0039087 3300045976 Bacteria 4076
114 Ga0495592_0000733 3300046454 Bacteria 22899
115 Ga0495592_0117463 3300046454 Bacteria 1875
116 Ga0495592_0157054 3300046454 Bacteria 1568
117 Ga0495629_0009419 3300046459 Bacteria 7141
118 Ga0495629_0335040 3300046459 Bacteria 1033
119 Ga0495641_0000010 3300046461 Bacteria 158798
120 Ga0495653_0138218 3300046463 Bacteria 1716
121 Ga0495662_0000077 3300046476 Bacteria 35063
122 Ga0495662_0017945 3300046476 Bacteria 3424
123 Ga0495606_0001199 3300046507 Bacteria 36449
124 Ga0495608_0001842 3300046511 Bacteria 15131
125 Ga0495618_0000051 3300046514 Bacteria 87668
126 Ga0495620_0000154 3300046515 Bacteria 55875
127 Ga0495628_0215798 3300046516 Bacteria 1442
128 Ga0495628_0274350 3300046516 Bacteria 1254
129 Ga0495628_0286637 3300046516 Bacteria 1221
130 Ga0495630_0000125 3300046517 Bacteria 61325
131 Ga0495630_0001740 3300046517 Bacteria 15204
132 Ga0495652_0024398 3300046529 Bacteria 5353
133 Ga0495586_0012238 3300046535 Bacteria 4553
134 Ga0495587_0217896 3300046536 Bacteria 1077
135 Ga0495621_0001754 3300046539 Bacteria 5685
136 Ga0495645_0065210 3300046543 Bacteria 2634
137 Ga0495645_0252286 3300046543 Bacteria 1172
138 Ga0495634_0000728 3300046642 Bacteria 31906
139 Ga0495634_0002377 3300046642 Bacteria 15680
140 Ga0495634_0036516 3300046642 Bacteria 3361
141 Ga0495635_0000017 3300046663 Bacteria 195506
142 Ga0495635_0498857 3300046663 Bacteria 802
143 Ga0495588_0000204 3300046674 Bacteria 58892
144 Ga0495657_0005201 3300046675 Bacteria 10306
145 Ga0495599_0005793 3300046678 Bacteria 7416
146 Ga0495647_0002433 3300046681 Bacteria 5866
147 Ga0495658_0001925 3300046683 Bacteria 10608
148 Ga0495669_0000067 3300046684 Bacteria 68406
149 Ga0495613_0000067 3300046689 Bacteria 101960
150 Ga0495624_0000465 3300046690 Bacteria 31713
151 Ga0495624_0253909 3300046690 Bacteria 1063
152 Ga0495649_0003197 3300046694 Bacteria 11200
153 Ga0495604_0000252 3300047317 Bacteria 47517
154 Ga0495604_0021975 3300047317 Bacteria 5092
155 Ga0495676_0003495 3300047321 Bacteria 14222
156 Ga0495676_0191453 3300047321 Bacteria 1427
157 Ga0495680_0008509 3300047322 Bacteria 9322
158 Ga0495680_0022242 3300047322 Bacteria 5288
159 Ga0495680_0031484 3300047322 Bacteria 4316
160 Ga0495679_010789 3300047446 Bacteria 3564
161 Ga0495593_0166609 3300047673 Bacteria 1111
162 Ga0495602_0000548 3300048088 Bacteria 35114
163 Ga0495602_0162755 3300048088 Bacteria 1740
164 Ga0496100_0000006 3300048903 Bacteria 297429
165 Ga0496101_0000009 3300048904 Bacteria 297429
166 Ga0496103_0000001 3300048906 Bacteria 643471
167 Ga0496104_0000008 3300048907 Bacteria 516976
168 Ga0496105_0000003 3300048908 Bacteria 713251
169 Ga0496105_0003974 3300048908 Bacteria 11065
170 Ga0496106_0000072 3300048909 Bacteria 80978
171 Ga0496106_0001291 3300048909 Bacteria 18817
172 Ga0496107_0000015 3300048910 Bacteria 173644
173 Ga0496108_0000004 3300048911 Bacteria 545055
174 Ga0496108_0010435 3300048911 Bacteria 7543
175 Ga0496108_0134675 3300048911 Bacteria 2124
176 Ga0496109_0000011 3300048912 Bacteria 234908
177 Ga0496109_0000031 3300048912 Bacteria 163998
178 Ga0496110_0035633 3300048913 Bacteria 4318
179 Ga0496112_0015640 3300048915 Bacteria 7087
180 Ga0496113_0000204 3300048916 Bacteria 27481
181 Ga0496115_0000022 3300048918 Bacteria 164224
182 Ga0496115_0000027 3300048918 Bacteria 145505
183 Ga0501075_0241659 3300049591 Bacteria 1377
184 nmdc:mga0a205_313783_c1 3300050515 Bacteria 1440
185 Ga0495601_0003507 3300053077 Bacteria 9009
186 Ga0495601_0206395 3300053077 Bacteria 1283
187 Ga0495612_0004584 3300053078 Bacteria 5730
188 Ga0495612_0022871 3300053078 Bacteria 2506
189 Ga0495595_0001165 3300053084 Bacteria 10189
190 Ga0495595_0034437 3300053084 Bacteria 2290
191 Ga0495619_0000177 3300053085 Bacteria 46800
192 Ga0495619_0030038 3300053085 Bacteria 3516
193 Ga0500614_000125 3300053123 Bacteria 18595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046690 Ga0495624_0000465 Ga0495624_0000465_9679_10458 211
2 3300053085 Ga0495619_0030038 Ga0495619_0030038_639_1424 213
3 3300048918 Ga0496115_0000022 Ga0496115_0000022_33272_34063 219
4 3300006237 Ga0097621_100068633 Ga0097621_1000686332 221
5 3300046476 Ga0495662_0017945 Ga0495662_0017945_529_1299 222
6 3300005341 Ga0070691_10000055 Ga0070691_1000005518 226
7 3300046663 Ga0495635_0498857 Ga0495635_0498857_35_763 226
8 3300005841 Ga0068863_100000229 Ga0068863_10000022960 227
9 3300026088 Ga0207641_10001448 Ga0207641_100014482 227
10 3300005539 Ga0068853_100038176 Ga0068853_1000381766 229
11 3300046454 Ga0495592_0000733 Ga0495592_0000733_15597_16382 231
12 3300047322 Ga0495680_0022242 Ga0495680_0022242_1823_2605 231
13 3300045976 Ga0466967_0039087 Ga0466967_0039087_2567_3340 232
14 3300046674 Ga0495588_0000204 Ga0495588_0000204_16299_17072 232
15 3300005356 Ga0070674_100000074 Ga0070674_10000007441 233
16 3300005457 Ga0070662_100000001 Ga0070662_100000001245 233
17 3300005718 Ga0068866_10002023 Ga0068866_100020239 233
18 3300005985 Ga0081539_10027128 Ga0081539_100271286 233
19 3300009148 Ga0105243_10132982 Ga0105243_101329823 233
20 3300025915 Ga0207693_10030587 Ga0207693_100305872 233
21 3300025933 Ga0207706_10000003 Ga0207706_1000000386 233
22 3300048909 Ga0496106_0001291 Ga0496106_0001291_17513_18292 233
23 3300013308 Ga0157375_10019793 Ga0157375_100197938 234
24 3300014968 Ga0157379_10039277 Ga0157379_100392772 234
25 3300025899 Ga0207642_10000136 Ga0207642_1000013618 234
26 3300025935 Ga0207709_10084878 Ga0207709_100848782 234
27 3300025937 Ga0207669_10000002 Ga0207669_1000000242 234
28 3300026041 Ga0207639_10017318 Ga0207639_100173187 234
29 3300044842 Ga0466957_0004550 Ga0466957_0004550_6131_6910 234
30 3300046684 Ga0495669_0000067 Ga0495669_0000067_13885_14655 234
31 3300048907 Ga0496104_0000008 Ga0496104_0000008_316963_317733 234
32 3300048908 Ga0496105_0000003 Ga0496105_0000003_316963_317733 234
33 3300048911 Ga0496108_0000004 Ga0496108_0000004_254152_254922 234
34 3300048912 Ga0496109_0000031 Ga0496109_0000031_100365_101135 234
35 3300049591 Ga0501075_0241659 Ga0501075_0241659_263_1048 234
36 3300005548 Ga0070665_100000022 Ga0070665_100000022196 235
37 3300005842 Ga0068858_100000140 Ga0068858_10000014064 235
38 3300026035 Ga0207703_10000020 Ga0207703_10000020249 235
39 3300028379 Ga0268266_10000029 Ga0268266_10000029255 235
40 3300046461 Ga0495641_0000010 Ga0495641_0000010_157880_158665 235
41 3300053078 Ga0495612_0022871 Ga0495612_0022871_996_1784 235
42 3300053123 Ga0500614_000125 Ga0500614_000125_6450_7235 235
43 3300005547 Ga0070693_100011281 Ga0070693_1000112812 236
44 3300013104 Ga0157370_10008954 Ga0157370_100089542 236
45 3300005616 Ga0068852_100000132 Ga0068852_10000013210 237
46 3300026142 Ga0207698_10000014 Ga0207698_10000014225 237
47 3300046689 Ga0495613_0000067 Ga0495613_0000067_78230_79039 237
48 3300014326 Ga0157380_10152448 Ga0157380_101524482 238
49 3300005618 Ga0068864_100000024 Ga0068864_100000024166 239
50 3300026095 Ga0207676_10000048 Ga0207676_1000004887 239
51 3300028380 Ga0268265_10742293 Ga0268265_107422931 239
52 3300045976 Ga0466967_0013927 Ga0466967_0013927_4437_5231 239
53 3300048912 Ga0496109_0000011 Ga0496109_0000011_137083_137856 240
54 3300005333 Ga0070677_10000021 Ga0070677_1000002144 241
55 3300005347 Ga0070668_100007576 Ga0070668_1000075762 241
56 3300005614 Ga0068856_100554746 Ga0068856_1005547462 241
57 3300005842 Ga0068858_100000017 Ga0068858_10000001766 241
58 3300006852 Ga0075433_10260705 Ga0075433_102607052 241
59 3300009174 Ga0105241_10742824 Ga0105241_107428241 241
60 3300025893 Ga0207682_10000020 Ga0207682_1000002026 241
61 3300025911 Ga0207654_10488954 Ga0207654_104889541 241
62 3300026035 Ga0207703_10000030 Ga0207703_1000003064 241
63 3300046515 Ga0495620_0000154 Ga0495620_0000154_38178_38960 241
64 3300046535 Ga0495586_0012238 Ga0495586_0012238_3665_4450 241
65 3300046536 Ga0495587_0217896 Ga0495587_0217896_295_1065 241
66 3300046678 Ga0495599_0005793 Ga0495599_0005793_6597_7367 241
67 3300046683 Ga0495658_0001925 Ga0495658_0001925_2382_3176 241
68 3300046694 Ga0495649_0003197 Ga0495649_0003197_10370_11140 241
69 3300047317 Ga0495604_0000252 Ga0495604_0000252_38045_38833 241
70 3300047321 Ga0495676_0003495 Ga0495676_0003495_443_1249 241
71 3300047446 Ga0495679_010789 Ga0495679_010789_1492_2262 241
72 3300048903 Ga0496100_0000006 Ga0496100_0000006_127502_128272 241
73 3300048904 Ga0496101_0000009 Ga0496101_0000009_127502_128272 241
74 3300048909 Ga0496106_0000072 Ga0496106_0000072_73258_74028 241
75 3300048910 Ga0496107_0000015 Ga0496107_0000015_23730_24500 241
76 3300050515 nmdc:mga0a205_313783_c1 nmdc:mga0a205_313783_c1_25_807 241
77 3300009101 Ga0105247_10000832 Ga0105247_100008329 242
78 3300009176 Ga0105242_10008101 Ga0105242_100081012 242
79 3300025900 Ga0207710_10000096 Ga0207710_100000968 242
80 3300025934 Ga0207686_10000035 Ga0207686_1000003563 242
81 3300025941 Ga0207711_10000011 Ga0207711_10000011203 242
82 3300028556 Ga0265337_1000282 Ga0265337_100028218 242
83 3300028558 Ga0265326_10000033 Ga0265326_1000003317 242
84 3300028654 Ga0265322_10000017 Ga0265322_1000001731 242
85 3300028666 Ga0265336_10001223 Ga0265336_1000122310 242
86 3300029957 Ga0265324_10000479 Ga0265324_1000047917 242
87 3300031239 Ga0265328_10001388 Ga0265328_100013887 242
88 3300031240 Ga0265320_10000010 Ga0265320_1000001017 242
89 3300031242 Ga0265329_10005234 Ga0265329_100052345 242
90 3300031250 Ga0265331_10000505 Ga0265331_1000050517 242
91 3300031251 Ga0265327_10000040 Ga0265327_10000040290 242
92 3300031344 Ga0265316_10003339 Ga0265316_1000333911 242
93 3300031711 Ga0265314_10000803 Ga0265314_1000080322 242
94 3300046454 Ga0495592_0157054 Ga0495592_0157054_780_1553 242
95 3300046459 Ga0495629_0335040 Ga0495629_0335040_60_833 242
96 3300048915 Ga0496112_0015640 Ga0496112_0015640_560_1333 242
97 3300048916 Ga0496113_0000204 Ga0496113_0000204_87_860 242
98 3300053085 Ga0495619_0000177 Ga0495619_0000177_34442_35215 242
99 3300010375 Ga0105239_10562727 Ga0105239_105627272 243
100 3300009098 Ga0105245_10009411 Ga0105245_100094112 244
101 3300025927 Ga0207687_10007755 Ga0207687_100077552 244
102 3300046517 Ga0495630_0001740 Ga0495630_0001740_3408_4187 244
103 3300046663 Ga0495635_0000017 Ga0495635_0000017_83537_84316 244
104 3300005329 Ga0070683_100028965 Ga0070683_1000289657 245
105 3300005441 Ga0070700_100363204 Ga0070700_1003632042 245
106 3300005535 Ga0070684_100144644 Ga0070684_1001446442 245
107 3300005841 Ga0068863_100103459 Ga0068863_1001034592 245
108 3300009176 Ga0105242_10000139 Ga0105242_1000013957 245
109 3300013105 Ga0157369_10010434 Ga0157369_100104342 245
110 3300025885 Ga0207653_10027978 Ga0207653_100279783 245
111 3300025934 Ga0207686_10002089 Ga0207686_1000208911 245
112 3300025944 Ga0207661_10007061 Ga0207661_100070619 245
113 3300026075 Ga0207708_10075453 Ga0207708_100754531 245
114 3300026088 Ga0207641_10012452 Ga0207641_100124522 245
115 3300046539 Ga0495621_0001754 Ga0495621_0001754_2336_3118 245
116 3300046642 Ga0495634_0002377 Ga0495634_0002377_6257_7039 245
117 3300047321 Ga0495676_0191453 Ga0495676_0191453_523_1305 245
118 3300005335 Ga0070666_10143015 Ga0070666_101430152 246
119 3300005336 Ga0070680_100090142 Ga0070680_1000901422 246
120 3300005337 Ga0070682_100000009 Ga0070682_100000009105 246
121 3300005338 Ga0068868_100005148 Ga0068868_1000051482 246
122 3300005344 Ga0070661_100000255 Ga0070661_1000002556 246
123 3300005365 Ga0070688_100003033 Ga0070688_1000030338 246
124 3300005466 Ga0070685_10001479 Ga0070685_100014792 246
125 3300005530 Ga0070679_100000362 Ga0070679_1000003625 246
126 3300005543 Ga0070672_100000314 Ga0070672_10000031411 246
127 3300005548 Ga0070665_100049652 Ga0070665_1000496522 246
128 3300005834 Ga0068851_10028071 Ga0068851_100280713 246
129 3300006163 Ga0070715_10000041 Ga0070715_1000004122 246
130 3300009551 Ga0105238_10000016 Ga0105238_10000016120 246
131 3300013297 Ga0157378_10168539 Ga0157378_101685391 246
132 3300013307 Ga0157372_10000556 Ga0157372_1000055645 246
133 3300013308 Ga0157375_10341101 Ga0157375_103411012 246
134 3300017792 Ga0163161_10000103 Ga0163161_100001039 246
135 3300025321 Ga0207656_10040962 Ga0207656_100409623 246
136 3300025903 Ga0207680_10008312 Ga0207680_100083125 246
137 3300025905 Ga0207685_10000037 Ga0207685_1000003722 246
138 3300025912 Ga0207707_10003109 Ga0207707_1000310912 246
139 3300025917 Ga0207660_10062700 Ga0207660_100627002 246
140 3300025920 Ga0207649_10000015 Ga0207649_10000015121 246
141 3300025921 Ga0207652_10001682 Ga0207652_100016825 246
142 3300025924 Ga0207694_10000012 Ga0207694_10000012301 246
143 3300025925 Ga0207650_10145896 Ga0207650_101458962 246
144 3300025935 Ga0207709_10086243 Ga0207709_100862432 246
145 3300025940 Ga0207691_10000286 Ga0207691_1000028631 246
146 3300025981 Ga0207640_10000907 Ga0207640_100009079 246
147 3300026023 Ga0207677_10000956 Ga0207677_1000095612 246
148 3300026078 Ga0207702_10056339 Ga0207702_100563395 246
149 3300026121 Ga0207683_10076310 Ga0207683_100763102 246
150 3300028379 Ga0268266_10004781 Ga0268266_100047819 246
151 3300036401 Ga0373937_0079580 Ga0373937_0079580_476_1261 246
152 3300046459 Ga0495629_0009419 Ga0495629_0009419_383_1168 246
153 3300046463 Ga0495653_0138218 Ga0495653_0138218_882_1667 246
154 3300046476 Ga0495662_0000077 Ga0495662_0000077_15589_16374 246
155 3300046507 Ga0495606_0001199 Ga0495606_0001199_25277_26065 246
156 3300046511 Ga0495608_0001842 Ga0495608_0001842_10844_11629 246
157 3300046514 Ga0495618_0000051 Ga0495618_0000051_22625_23410 246
158 3300046516 Ga0495628_0274350 Ga0495628_0274350_174_959 246
159 3300046516 Ga0495628_0286637 Ga0495628_0286637_48_833 246
160 3300046517 Ga0495630_0000125 Ga0495630_0000125_38959_39744 246
161 3300046543 Ga0495645_0252286 Ga0495645_0252286_301_1086 246
162 3300046642 Ga0495634_0000728 Ga0495634_0000728_7491_8276 246
163 3300046642 Ga0495634_0036516 Ga0495634_0036516_1482_2267 246
164 3300046681 Ga0495647_0002433 Ga0495647_0002433_1142_1987 246
165 3300046690 Ga0495624_0253909 Ga0495624_0253909_105_890 246
166 3300047317 Ga0495604_0021975 Ga0495604_0021975_2139_2924 246
167 3300047322 Ga0495680_0008509 Ga0495680_0008509_5815_6600 246
168 3300047322 Ga0495680_0031484 Ga0495680_0031484_103_888 246
169 3300048088 Ga0495602_0000548 Ga0495602_0000548_21973_22758 246
170 3300048088 Ga0495602_0162755 Ga0495602_0162755_28_813 246
171 3300048911 Ga0496108_0010435 Ga0496108_0010435_1125_1931 246
172 3300048913 Ga0496110_0035633 Ga0496110_0035633_2881_3666 246
173 3300053077 Ga0495601_0003507 Ga0495601_0003507_1234_2019 246
174 3300053077 Ga0495601_0206395 Ga0495601_0206395_399_1184 246
175 3300053078 Ga0495612_0004584 Ga0495612_0004584_83_868 246
176 3300053084 Ga0495595_0001165 Ga0495595_0001165_6682_7467 246
177 3300053084 Ga0495595_0034437 Ga0495595_0034437_304_1089 246
178 3300001977 JGI24746J21847_1000013 JGI24746J21847_100001314 247
179 3300005356 Ga0070674_100128095 Ga0070674_1001280953 247
180 3300005614 Ga0068856_100018573 Ga0068856_1000185732 247
181 3300009177 Ga0105248_10000017 Ga0105248_10000017156 247
182 3300014325 Ga0163163_10379970 Ga0163163_103799702 247
183 3300026078 Ga0207702_10062233 Ga0207702_100622332 247
184 3300046454 Ga0495592_0117463 Ga0495592_0117463_223_1017 247
185 3300046516 Ga0495628_0215798 Ga0495628_0215798_458_1246 247
186 3300046529 Ga0495652_0024398 Ga0495652_0024398_1192_1980 247
187 3300046543 Ga0495645_0065210 Ga0495645_0065210_1699_2487 247
188 3300046675 Ga0495657_0005201 Ga0495657_0005201_327_1166 247
189 3300047673 Ga0495593_0166609 Ga0495593_0166609_125_913 247
190 3300048906 Ga0496103_0000001 Ga0496103_0000001_585501_586289 247
191 3300048908 Ga0496105_0003974 Ga0496105_0003974_6271_7095 247
192 3300048911 Ga0496108_0134675 Ga0496108_0134675_301_1098 247
193 3300048918 Ga0496115_0000027 Ga0496115_0000027_37129_37917 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

1

220

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tzf-assembly1.cif.gz_B crystal structure of the yersinia pestis dihydropteroate synthase with sulfonamide drug complex. 0.9557 2 245
3tzf-assembly1.cif.gz_A crystal structure of the yersinia pestis dihydropteroate synthase with sulfonamide drug complex. 0.9551 2 245
3tzn-assembly1.cif.gz_B crystal structure of the yersinia pestis dihydropteroate synthase. 0.9494 2 245
1eye-assembly1.cif.gz_A-2 1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8-dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate 0.9469 2 247
3tyu-assembly1.cif.gz_B crystal structure of dihydropteroate synthetase with product1 0.9412 2 245
ID Description Score Start End Superfamily
3tznB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9494 2 245 3.20.20.20
1eyeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9469 2 247 3.20.20.20
1eyeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9395 2 247 3.20.20.20
2dzaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9374 2 247 3.20.20.20
af_Q4LB35_466_732_3.20.20.20 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9223 5 245 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A534U5W7-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9775 6 246 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A2V7UZ45-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9714 2 245 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A388TDW2-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9704 53 246 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A7C5NV44-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9681 71 246 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872
AF-A0A7V2NME3-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9679 64 245 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map