F297613
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 152 | 193 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300046476|Ga0495662_0017945|Ga0495662_0017945_529_1299 |
| Length | 237 |
| Sequence | MGVVNVTPDSFSDGGLYLDPEAAIAHGRELLGEGADILDVGGESTRPGAAEVVVEEELRRVLPVVAGLAGEATVSVDTMKAIVNDVTALRGDPEMATVCAEGGATVILMHMVGTPRTMQDDPRYGDVVVEVRDFLAERLEAAVAAGIAEERIWLDPGIGFGKTAEHNLELLRRLRPLVVGTSRKSFIGRVDGSGPRDRVGGTVASSLLAAGAGADVLRVHDVAAMRQALTVAAAVAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 87 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 88 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 99 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 100 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 0 |
| Rhizoplane | 9.84 |
| Rhizosphere | 89.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000013 | 3300001977 | Bacteria | 16828 |
| 2 | Ga0070683_100028965 | 3300005329 | Bacteria | 5009 |
| 3 | Ga0070677_10000021 | 3300005333 | Bacteria | 47171 |
| 4 | Ga0070666_10143015 | 3300005335 | Bacteria | 1667 |
| 5 | Ga0070680_100090142 | 3300005336 | Bacteria | 2538 |
| 6 | Ga0070682_100000009 | 3300005337 | Bacteria | 291635 |
| 7 | Ga0068868_100005148 | 3300005338 | Bacteria | 9177 |
| 8 | Ga0070691_10000055 | 3300005341 | Bacteria | 31550 |
| 9 | Ga0070661_100000255 | 3300005344 | Bacteria | 43552 |
| 10 | Ga0070668_100007576 | 3300005347 | Bacteria | 8058 |
| 11 | Ga0070674_100000074 | 3300005356 | Bacteria | 46384 |
| 12 | Ga0070674_100128095 | 3300005356 | Bacteria | 1888 |
| 13 | Ga0070688_100003033 | 3300005365 | Bacteria | 8570 |
| 14 | Ga0070700_100363204 | 3300005441 | Bacteria | 1077 |
| 15 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 16 | Ga0070685_10001479 | 3300005466 | Bacteria | 12372 |
| 17 | Ga0070679_100000362 | 3300005530 | Bacteria | 38683 |
| 18 | Ga0070684_100144644 | 3300005535 | Bacteria | 2152 |
| 19 | Ga0068853_100038176 | 3300005539 | Bacteria | 4090 |
| 20 | Ga0070672_100000314 | 3300005543 | Bacteria | 27496 |
| 21 | Ga0070693_100011281 | 3300005547 | Bacteria | 4498 |
| 22 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 23 | Ga0070665_100049652 | 3300005548 | Bacteria | 4209 |
| 24 | Ga0068856_100018573 | 3300005614 | Bacteria | 6737 |
| 25 | Ga0068856_100554746 | 3300005614 | Bacteria | 1170 |
| 26 | Ga0068852_100000132 | 3300005616 | Bacteria | 50593 |
| 27 | Ga0068864_100000024 | 3300005618 | Bacteria | 252632 |
| 28 | Ga0068866_10002023 | 3300005718 | Bacteria | 8441 |
| 29 | Ga0068851_10028071 | 3300005834 | Bacteria | 2778 |
| 30 | Ga0068863_100000229 | 3300005841 | Bacteria | 59324 |
| 31 | Ga0068863_100103459 | 3300005841 | Bacteria | 2708 |
| 32 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 33 | Ga0068858_100000140 | 3300005842 | Bacteria | 76446 |
| 34 | Ga0081539_10027128 | 3300005985 | Bacteria | 3635 |
| 35 | Ga0070715_10000041 | 3300006163 | Bacteria | 63425 |
| 36 | Ga0097621_100068633 | 3300006237 | Bacteria | 2925 |
| 37 | Ga0075433_10260705 | 3300006852 | Bacteria | 1537 |
| 38 | Ga0105245_10009411 | 3300009098 | Bacteria | 8521 |
| 39 | Ga0105247_10000832 | 3300009101 | Bacteria | 23437 |
| 40 | Ga0105243_10132982 | 3300009148 | Bacteria | 2113 |
| 41 | Ga0105241_10742824 | 3300009174 | Bacteria | 899 |
| 42 | Ga0105242_10000139 | 3300009176 | Bacteria | 52585 |
| 43 | Ga0105242_10008101 | 3300009176 | Bacteria | 8084 |
| 44 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 45 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 46 | Ga0105239_10562727 | 3300010375 | Bacteria | 1299 |
| 47 | Ga0157370_10008954 | 3300013104 | Bacteria | 10749 |
| 48 | Ga0157369_10010434 | 3300013105 | Bacteria | 10586 |
| 49 | Ga0157378_10168539 | 3300013297 | Bacteria | 2052 |
| 50 | Ga0157372_10000556 | 3300013307 | Bacteria | 41040 |
| 51 | Ga0157375_10019793 | 3300013308 | Bacteria | 6133 |
| 52 | Ga0157375_10341101 | 3300013308 | Bacteria | 1664 |
| 53 | Ga0163163_10379970 | 3300014325 | Bacteria | 1470 |
| 54 | Ga0157380_10152448 | 3300014326 | Bacteria | 2000 |
| 55 | Ga0157379_10039277 | 3300014968 | Bacteria | 4222 |
| 56 | Ga0163161_10000103 | 3300017792 | Bacteria | 81496 |
| 57 | Ga0207656_10040962 | 3300025321 | Bacteria | 1966 |
| 58 | Ga0207653_10027978 | 3300025885 | Bacteria | 1811 |
| 59 | Ga0207682_10000020 | 3300025893 | Bacteria | 64537 |
| 60 | Ga0207642_10000136 | 3300025899 | Bacteria | 20531 |
| 61 | Ga0207710_10000096 | 3300025900 | Bacteria | 116063 |
| 62 | Ga0207680_10008312 | 3300025903 | Bacteria | 5085 |
| 63 | Ga0207685_10000037 | 3300025905 | Bacteria | 63409 |
| 64 | Ga0207654_10488954 | 3300025911 | Bacteria | 868 |
| 65 | Ga0207707_10003109 | 3300025912 | Bacteria | 14734 |
| 66 | Ga0207693_10030587 | 3300025915 | Bacteria | 4253 |
| 67 | Ga0207660_10062700 | 3300025917 | Bacteria | 2679 |
| 68 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 69 | Ga0207652_10001682 | 3300025921 | Bacteria | 19376 |
| 70 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 71 | Ga0207650_10145896 | 3300025925 | Bacteria | 1864 |
| 72 | Ga0207687_10007755 | 3300025927 | Bacteria | 7041 |
| 73 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 74 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 75 | Ga0207686_10002089 | 3300025934 | Bacteria | 11005 |
| 76 | Ga0207709_10084878 | 3300025935 | Bacteria | 2051 |
| 77 | Ga0207709_10086243 | 3300025935 | Bacteria | 2038 |
| 78 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 79 | Ga0207691_10000286 | 3300025940 | Bacteria | 49918 |
| 80 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 81 | Ga0207661_10007061 | 3300025944 | Bacteria | 7971 |
| 82 | Ga0207640_10000907 | 3300025981 | Bacteria | 16634 |
| 83 | Ga0207677_10000956 | 3300026023 | Bacteria | 16043 |
| 84 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 85 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 86 | Ga0207639_10017318 | 3300026041 | Bacteria | 5108 |
| 87 | Ga0207708_10075453 | 3300026075 | Bacteria | 2585 |
| 88 | Ga0207702_10056339 | 3300026078 | Bacteria | 3337 |
| 89 | Ga0207702_10062233 | 3300026078 | Bacteria | 3186 |
| 90 | Ga0207641_10001448 | 3300026088 | Bacteria | 23281 |
| 91 | Ga0207641_10012452 | 3300026088 | Bacteria | 6974 |
| 92 | Ga0207676_10000048 | 3300026095 | Bacteria | 147853 |
| 93 | Ga0207683_10076310 | 3300026121 | Bacteria | 2967 |
| 94 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 95 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 96 | Ga0268266_10004781 | 3300028379 | Bacteria | 12874 |
| 97 | Ga0268265_10742293 | 3300028380 | Bacteria | 952 |
| 98 | Ga0265337_1000282 | 3300028556 | Bacteria | 27585 |
| 99 | Ga0265326_10000033 | 3300028558 | Bacteria | 91972 |
| 100 | Ga0265322_10000017 | 3300028654 | Bacteria | 114833 |
| 101 | Ga0265336_10001223 | 3300028666 | Bacteria | 12183 |
| 102 | Ga0265324_10000479 | 3300029957 | Bacteria | 28017 |
| 103 | Ga0265328_10001388 | 3300031239 | Bacteria | 11151 |
| 104 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 105 | Ga0265329_10005234 | 3300031242 | Bacteria | 5271 |
| 106 | Ga0265331_10000505 | 3300031250 | Bacteria | 36592 |
| 107 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 108 | Ga0265316_10003339 | 3300031344 | Bacteria | 16267 |
| 109 | Ga0265314_10000803 | 3300031711 | Bacteria | 37303 |
| 110 | Ga0373937_0079580 | 3300036401 | Bacteria | 3029 |
| 111 | Ga0466957_0004550 | 3300044842 | Bacteria | 7744 |
| 112 | Ga0466967_0013927 | 3300045976 | Bacteria | 6239 |
| 113 | Ga0466967_0039087 | 3300045976 | Bacteria | 4076 |
| 114 | Ga0495592_0000733 | 3300046454 | Bacteria | 22899 |
| 115 | Ga0495592_0117463 | 3300046454 | Bacteria | 1875 |
| 116 | Ga0495592_0157054 | 3300046454 | Bacteria | 1568 |
| 117 | Ga0495629_0009419 | 3300046459 | Bacteria | 7141 |
| 118 | Ga0495629_0335040 | 3300046459 | Bacteria | 1033 |
| 119 | Ga0495641_0000010 | 3300046461 | Bacteria | 158798 |
| 120 | Ga0495653_0138218 | 3300046463 | Bacteria | 1716 |
| 121 | Ga0495662_0000077 | 3300046476 | Bacteria | 35063 |
| 122 | Ga0495662_0017945 | 3300046476 | Bacteria | 3424 |
| 123 | Ga0495606_0001199 | 3300046507 | Bacteria | 36449 |
| 124 | Ga0495608_0001842 | 3300046511 | Bacteria | 15131 |
| 125 | Ga0495618_0000051 | 3300046514 | Bacteria | 87668 |
| 126 | Ga0495620_0000154 | 3300046515 | Bacteria | 55875 |
| 127 | Ga0495628_0215798 | 3300046516 | Bacteria | 1442 |
| 128 | Ga0495628_0274350 | 3300046516 | Bacteria | 1254 |
| 129 | Ga0495628_0286637 | 3300046516 | Bacteria | 1221 |
| 130 | Ga0495630_0000125 | 3300046517 | Bacteria | 61325 |
| 131 | Ga0495630_0001740 | 3300046517 | Bacteria | 15204 |
| 132 | Ga0495652_0024398 | 3300046529 | Bacteria | 5353 |
| 133 | Ga0495586_0012238 | 3300046535 | Bacteria | 4553 |
| 134 | Ga0495587_0217896 | 3300046536 | Bacteria | 1077 |
| 135 | Ga0495621_0001754 | 3300046539 | Bacteria | 5685 |
| 136 | Ga0495645_0065210 | 3300046543 | Bacteria | 2634 |
| 137 | Ga0495645_0252286 | 3300046543 | Bacteria | 1172 |
| 138 | Ga0495634_0000728 | 3300046642 | Bacteria | 31906 |
| 139 | Ga0495634_0002377 | 3300046642 | Bacteria | 15680 |
| 140 | Ga0495634_0036516 | 3300046642 | Bacteria | 3361 |
| 141 | Ga0495635_0000017 | 3300046663 | Bacteria | 195506 |
| 142 | Ga0495635_0498857 | 3300046663 | Bacteria | 802 |
| 143 | Ga0495588_0000204 | 3300046674 | Bacteria | 58892 |
| 144 | Ga0495657_0005201 | 3300046675 | Bacteria | 10306 |
| 145 | Ga0495599_0005793 | 3300046678 | Bacteria | 7416 |
| 146 | Ga0495647_0002433 | 3300046681 | Bacteria | 5866 |
| 147 | Ga0495658_0001925 | 3300046683 | Bacteria | 10608 |
| 148 | Ga0495669_0000067 | 3300046684 | Bacteria | 68406 |
| 149 | Ga0495613_0000067 | 3300046689 | Bacteria | 101960 |
| 150 | Ga0495624_0000465 | 3300046690 | Bacteria | 31713 |
| 151 | Ga0495624_0253909 | 3300046690 | Bacteria | 1063 |
| 152 | Ga0495649_0003197 | 3300046694 | Bacteria | 11200 |
| 153 | Ga0495604_0000252 | 3300047317 | Bacteria | 47517 |
| 154 | Ga0495604_0021975 | 3300047317 | Bacteria | 5092 |
| 155 | Ga0495676_0003495 | 3300047321 | Bacteria | 14222 |
| 156 | Ga0495676_0191453 | 3300047321 | Bacteria | 1427 |
| 157 | Ga0495680_0008509 | 3300047322 | Bacteria | 9322 |
| 158 | Ga0495680_0022242 | 3300047322 | Bacteria | 5288 |
| 159 | Ga0495680_0031484 | 3300047322 | Bacteria | 4316 |
| 160 | Ga0495679_010789 | 3300047446 | Bacteria | 3564 |
| 161 | Ga0495593_0166609 | 3300047673 | Bacteria | 1111 |
| 162 | Ga0495602_0000548 | 3300048088 | Bacteria | 35114 |
| 163 | Ga0495602_0162755 | 3300048088 | Bacteria | 1740 |
| 164 | Ga0496100_0000006 | 3300048903 | Bacteria | 297429 |
| 165 | Ga0496101_0000009 | 3300048904 | Bacteria | 297429 |
| 166 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 167 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 168 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 169 | Ga0496105_0003974 | 3300048908 | Bacteria | 11065 |
| 170 | Ga0496106_0000072 | 3300048909 | Bacteria | 80978 |
| 171 | Ga0496106_0001291 | 3300048909 | Bacteria | 18817 |
| 172 | Ga0496107_0000015 | 3300048910 | Bacteria | 173644 |
| 173 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 174 | Ga0496108_0010435 | 3300048911 | Bacteria | 7543 |
| 175 | Ga0496108_0134675 | 3300048911 | Bacteria | 2124 |
| 176 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 177 | Ga0496109_0000031 | 3300048912 | Bacteria | 163998 |
| 178 | Ga0496110_0035633 | 3300048913 | Bacteria | 4318 |
| 179 | Ga0496112_0015640 | 3300048915 | Bacteria | 7087 |
| 180 | Ga0496113_0000204 | 3300048916 | Bacteria | 27481 |
| 181 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 182 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 183 | Ga0501075_0241659 | 3300049591 | Bacteria | 1377 |
| 184 | nmdc:mga0a205_313783_c1 | 3300050515 | Bacteria | 1440 |
| 185 | Ga0495601_0003507 | 3300053077 | Bacteria | 9009 |
| 186 | Ga0495601_0206395 | 3300053077 | Bacteria | 1283 |
| 187 | Ga0495612_0004584 | 3300053078 | Bacteria | 5730 |
| 188 | Ga0495612_0022871 | 3300053078 | Bacteria | 2506 |
| 189 | Ga0495595_0001165 | 3300053084 | Bacteria | 10189 |
| 190 | Ga0495595_0034437 | 3300053084 | Bacteria | 2290 |
| 191 | Ga0495619_0000177 | 3300053085 | Bacteria | 46800 |
| 192 | Ga0495619_0030038 | 3300053085 | Bacteria | 3516 |
| 193 | Ga0500614_000125 | 3300053123 | Bacteria | 18595 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046690 | Ga0495624_0000465 | Ga0495624_0000465_9679_10458 | 211 |
| 2 | 3300053085 | Ga0495619_0030038 | Ga0495619_0030038_639_1424 | 213 |
| 3 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_33272_34063 | 219 |
| 4 | 3300006237 | Ga0097621_100068633 | Ga0097621_1000686332 | 221 |
| 5 | 3300046476 | Ga0495662_0017945 | Ga0495662_0017945_529_1299 | 222 |
| 6 | 3300005341 | Ga0070691_10000055 | Ga0070691_1000005518 | 226 |
| 7 | 3300046663 | Ga0495635_0498857 | Ga0495635_0498857_35_763 | 226 |
| 8 | 3300005841 | Ga0068863_100000229 | Ga0068863_10000022960 | 227 |
| 9 | 3300026088 | Ga0207641_10001448 | Ga0207641_100014482 | 227 |
| 10 | 3300005539 | Ga0068853_100038176 | Ga0068853_1000381766 | 229 |
| 11 | 3300046454 | Ga0495592_0000733 | Ga0495592_0000733_15597_16382 | 231 |
| 12 | 3300047322 | Ga0495680_0022242 | Ga0495680_0022242_1823_2605 | 231 |
| 13 | 3300045976 | Ga0466967_0039087 | Ga0466967_0039087_2567_3340 | 232 |
| 14 | 3300046674 | Ga0495588_0000204 | Ga0495588_0000204_16299_17072 | 232 |
| 15 | 3300005356 | Ga0070674_100000074 | Ga0070674_10000007441 | 233 |
| 16 | 3300005457 | Ga0070662_100000001 | Ga0070662_100000001245 | 233 |
| 17 | 3300005718 | Ga0068866_10002023 | Ga0068866_100020239 | 233 |
| 18 | 3300005985 | Ga0081539_10027128 | Ga0081539_100271286 | 233 |
| 19 | 3300009148 | Ga0105243_10132982 | Ga0105243_101329823 | 233 |
| 20 | 3300025915 | Ga0207693_10030587 | Ga0207693_100305872 | 233 |
| 21 | 3300025933 | Ga0207706_10000003 | Ga0207706_1000000386 | 233 |
| 22 | 3300048909 | Ga0496106_0001291 | Ga0496106_0001291_17513_18292 | 233 |
| 23 | 3300013308 | Ga0157375_10019793 | Ga0157375_100197938 | 234 |
| 24 | 3300014968 | Ga0157379_10039277 | Ga0157379_100392772 | 234 |
| 25 | 3300025899 | Ga0207642_10000136 | Ga0207642_1000013618 | 234 |
| 26 | 3300025935 | Ga0207709_10084878 | Ga0207709_100848782 | 234 |
| 27 | 3300025937 | Ga0207669_10000002 | Ga0207669_1000000242 | 234 |
| 28 | 3300026041 | Ga0207639_10017318 | Ga0207639_100173187 | 234 |
| 29 | 3300044842 | Ga0466957_0004550 | Ga0466957_0004550_6131_6910 | 234 |
| 30 | 3300046684 | Ga0495669_0000067 | Ga0495669_0000067_13885_14655 | 234 |
| 31 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_316963_317733 | 234 |
| 32 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_316963_317733 | 234 |
| 33 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_254152_254922 | 234 |
| 34 | 3300048912 | Ga0496109_0000031 | Ga0496109_0000031_100365_101135 | 234 |
| 35 | 3300049591 | Ga0501075_0241659 | Ga0501075_0241659_263_1048 | 234 |
| 36 | 3300005548 | Ga0070665_100000022 | Ga0070665_100000022196 | 235 |
| 37 | 3300005842 | Ga0068858_100000140 | Ga0068858_10000014064 | 235 |
| 38 | 3300026035 | Ga0207703_10000020 | Ga0207703_10000020249 | 235 |
| 39 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029255 | 235 |
| 40 | 3300046461 | Ga0495641_0000010 | Ga0495641_0000010_157880_158665 | 235 |
| 41 | 3300053078 | Ga0495612_0022871 | Ga0495612_0022871_996_1784 | 235 |
| 42 | 3300053123 | Ga0500614_000125 | Ga0500614_000125_6450_7235 | 235 |
| 43 | 3300005547 | Ga0070693_100011281 | Ga0070693_1000112812 | 236 |
| 44 | 3300013104 | Ga0157370_10008954 | Ga0157370_100089542 | 236 |
| 45 | 3300005616 | Ga0068852_100000132 | Ga0068852_10000013210 | 237 |
| 46 | 3300026142 | Ga0207698_10000014 | Ga0207698_10000014225 | 237 |
| 47 | 3300046689 | Ga0495613_0000067 | Ga0495613_0000067_78230_79039 | 237 |
| 48 | 3300014326 | Ga0157380_10152448 | Ga0157380_101524482 | 238 |
| 49 | 3300005618 | Ga0068864_100000024 | Ga0068864_100000024166 | 239 |
| 50 | 3300026095 | Ga0207676_10000048 | Ga0207676_1000004887 | 239 |
| 51 | 3300028380 | Ga0268265_10742293 | Ga0268265_107422931 | 239 |
| 52 | 3300045976 | Ga0466967_0013927 | Ga0466967_0013927_4437_5231 | 239 |
| 53 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_137083_137856 | 240 |
| 54 | 3300005333 | Ga0070677_10000021 | Ga0070677_1000002144 | 241 |
| 55 | 3300005347 | Ga0070668_100007576 | Ga0070668_1000075762 | 241 |
| 56 | 3300005614 | Ga0068856_100554746 | Ga0068856_1005547462 | 241 |
| 57 | 3300005842 | Ga0068858_100000017 | Ga0068858_10000001766 | 241 |
| 58 | 3300006852 | Ga0075433_10260705 | Ga0075433_102607052 | 241 |
| 59 | 3300009174 | Ga0105241_10742824 | Ga0105241_107428241 | 241 |
| 60 | 3300025893 | Ga0207682_10000020 | Ga0207682_1000002026 | 241 |
| 61 | 3300025911 | Ga0207654_10488954 | Ga0207654_104889541 | 241 |
| 62 | 3300026035 | Ga0207703_10000030 | Ga0207703_1000003064 | 241 |
| 63 | 3300046515 | Ga0495620_0000154 | Ga0495620_0000154_38178_38960 | 241 |
| 64 | 3300046535 | Ga0495586_0012238 | Ga0495586_0012238_3665_4450 | 241 |
| 65 | 3300046536 | Ga0495587_0217896 | Ga0495587_0217896_295_1065 | 241 |
| 66 | 3300046678 | Ga0495599_0005793 | Ga0495599_0005793_6597_7367 | 241 |
| 67 | 3300046683 | Ga0495658_0001925 | Ga0495658_0001925_2382_3176 | 241 |
| 68 | 3300046694 | Ga0495649_0003197 | Ga0495649_0003197_10370_11140 | 241 |
| 69 | 3300047317 | Ga0495604_0000252 | Ga0495604_0000252_38045_38833 | 241 |
| 70 | 3300047321 | Ga0495676_0003495 | Ga0495676_0003495_443_1249 | 241 |
| 71 | 3300047446 | Ga0495679_010789 | Ga0495679_010789_1492_2262 | 241 |
| 72 | 3300048903 | Ga0496100_0000006 | Ga0496100_0000006_127502_128272 | 241 |
| 73 | 3300048904 | Ga0496101_0000009 | Ga0496101_0000009_127502_128272 | 241 |
| 74 | 3300048909 | Ga0496106_0000072 | Ga0496106_0000072_73258_74028 | 241 |
| 75 | 3300048910 | Ga0496107_0000015 | Ga0496107_0000015_23730_24500 | 241 |
| 76 | 3300050515 | nmdc:mga0a205_313783_c1 | nmdc:mga0a205_313783_c1_25_807 | 241 |
| 77 | 3300009101 | Ga0105247_10000832 | Ga0105247_100008329 | 242 |
| 78 | 3300009176 | Ga0105242_10008101 | Ga0105242_100081012 | 242 |
| 79 | 3300025900 | Ga0207710_10000096 | Ga0207710_100000968 | 242 |
| 80 | 3300025934 | Ga0207686_10000035 | Ga0207686_1000003563 | 242 |
| 81 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011203 | 242 |
| 82 | 3300028556 | Ga0265337_1000282 | Ga0265337_100028218 | 242 |
| 83 | 3300028558 | Ga0265326_10000033 | Ga0265326_1000003317 | 242 |
| 84 | 3300028654 | Ga0265322_10000017 | Ga0265322_1000001731 | 242 |
| 85 | 3300028666 | Ga0265336_10001223 | Ga0265336_1000122310 | 242 |
| 86 | 3300029957 | Ga0265324_10000479 | Ga0265324_1000047917 | 242 |
| 87 | 3300031239 | Ga0265328_10001388 | Ga0265328_100013887 | 242 |
| 88 | 3300031240 | Ga0265320_10000010 | Ga0265320_1000001017 | 242 |
| 89 | 3300031242 | Ga0265329_10005234 | Ga0265329_100052345 | 242 |
| 90 | 3300031250 | Ga0265331_10000505 | Ga0265331_1000050517 | 242 |
| 91 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040290 | 242 |
| 92 | 3300031344 | Ga0265316_10003339 | Ga0265316_1000333911 | 242 |
| 93 | 3300031711 | Ga0265314_10000803 | Ga0265314_1000080322 | 242 |
| 94 | 3300046454 | Ga0495592_0157054 | Ga0495592_0157054_780_1553 | 242 |
| 95 | 3300046459 | Ga0495629_0335040 | Ga0495629_0335040_60_833 | 242 |
| 96 | 3300048915 | Ga0496112_0015640 | Ga0496112_0015640_560_1333 | 242 |
| 97 | 3300048916 | Ga0496113_0000204 | Ga0496113_0000204_87_860 | 242 |
| 98 | 3300053085 | Ga0495619_0000177 | Ga0495619_0000177_34442_35215 | 242 |
| 99 | 3300010375 | Ga0105239_10562727 | Ga0105239_105627272 | 243 |
| 100 | 3300009098 | Ga0105245_10009411 | Ga0105245_100094112 | 244 |
| 101 | 3300025927 | Ga0207687_10007755 | Ga0207687_100077552 | 244 |
| 102 | 3300046517 | Ga0495630_0001740 | Ga0495630_0001740_3408_4187 | 244 |
| 103 | 3300046663 | Ga0495635_0000017 | Ga0495635_0000017_83537_84316 | 244 |
| 104 | 3300005329 | Ga0070683_100028965 | Ga0070683_1000289657 | 245 |
| 105 | 3300005441 | Ga0070700_100363204 | Ga0070700_1003632042 | 245 |
| 106 | 3300005535 | Ga0070684_100144644 | Ga0070684_1001446442 | 245 |
| 107 | 3300005841 | Ga0068863_100103459 | Ga0068863_1001034592 | 245 |
| 108 | 3300009176 | Ga0105242_10000139 | Ga0105242_1000013957 | 245 |
| 109 | 3300013105 | Ga0157369_10010434 | Ga0157369_100104342 | 245 |
| 110 | 3300025885 | Ga0207653_10027978 | Ga0207653_100279783 | 245 |
| 111 | 3300025934 | Ga0207686_10002089 | Ga0207686_1000208911 | 245 |
| 112 | 3300025944 | Ga0207661_10007061 | Ga0207661_100070619 | 245 |
| 113 | 3300026075 | Ga0207708_10075453 | Ga0207708_100754531 | 245 |
| 114 | 3300026088 | Ga0207641_10012452 | Ga0207641_100124522 | 245 |
| 115 | 3300046539 | Ga0495621_0001754 | Ga0495621_0001754_2336_3118 | 245 |
| 116 | 3300046642 | Ga0495634_0002377 | Ga0495634_0002377_6257_7039 | 245 |
| 117 | 3300047321 | Ga0495676_0191453 | Ga0495676_0191453_523_1305 | 245 |
| 118 | 3300005335 | Ga0070666_10143015 | Ga0070666_101430152 | 246 |
| 119 | 3300005336 | Ga0070680_100090142 | Ga0070680_1000901422 | 246 |
| 120 | 3300005337 | Ga0070682_100000009 | Ga0070682_100000009105 | 246 |
| 121 | 3300005338 | Ga0068868_100005148 | Ga0068868_1000051482 | 246 |
| 122 | 3300005344 | Ga0070661_100000255 | Ga0070661_1000002556 | 246 |
| 123 | 3300005365 | Ga0070688_100003033 | Ga0070688_1000030338 | 246 |
| 124 | 3300005466 | Ga0070685_10001479 | Ga0070685_100014792 | 246 |
| 125 | 3300005530 | Ga0070679_100000362 | Ga0070679_1000003625 | 246 |
| 126 | 3300005543 | Ga0070672_100000314 | Ga0070672_10000031411 | 246 |
| 127 | 3300005548 | Ga0070665_100049652 | Ga0070665_1000496522 | 246 |
| 128 | 3300005834 | Ga0068851_10028071 | Ga0068851_100280713 | 246 |
| 129 | 3300006163 | Ga0070715_10000041 | Ga0070715_1000004122 | 246 |
| 130 | 3300009551 | Ga0105238_10000016 | Ga0105238_10000016120 | 246 |
| 131 | 3300013297 | Ga0157378_10168539 | Ga0157378_101685391 | 246 |
| 132 | 3300013307 | Ga0157372_10000556 | Ga0157372_1000055645 | 246 |
| 133 | 3300013308 | Ga0157375_10341101 | Ga0157375_103411012 | 246 |
| 134 | 3300017792 | Ga0163161_10000103 | Ga0163161_100001039 | 246 |
| 135 | 3300025321 | Ga0207656_10040962 | Ga0207656_100409623 | 246 |
| 136 | 3300025903 | Ga0207680_10008312 | Ga0207680_100083125 | 246 |
| 137 | 3300025905 | Ga0207685_10000037 | Ga0207685_1000003722 | 246 |
| 138 | 3300025912 | Ga0207707_10003109 | Ga0207707_1000310912 | 246 |
| 139 | 3300025917 | Ga0207660_10062700 | Ga0207660_100627002 | 246 |
| 140 | 3300025920 | Ga0207649_10000015 | Ga0207649_10000015121 | 246 |
| 141 | 3300025921 | Ga0207652_10001682 | Ga0207652_100016825 | 246 |
| 142 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012301 | 246 |
| 143 | 3300025925 | Ga0207650_10145896 | Ga0207650_101458962 | 246 |
| 144 | 3300025935 | Ga0207709_10086243 | Ga0207709_100862432 | 246 |
| 145 | 3300025940 | Ga0207691_10000286 | Ga0207691_1000028631 | 246 |
| 146 | 3300025981 | Ga0207640_10000907 | Ga0207640_100009079 | 246 |
| 147 | 3300026023 | Ga0207677_10000956 | Ga0207677_1000095612 | 246 |
| 148 | 3300026078 | Ga0207702_10056339 | Ga0207702_100563395 | 246 |
| 149 | 3300026121 | Ga0207683_10076310 | Ga0207683_100763102 | 246 |
| 150 | 3300028379 | Ga0268266_10004781 | Ga0268266_100047819 | 246 |
| 151 | 3300036401 | Ga0373937_0079580 | Ga0373937_0079580_476_1261 | 246 |
| 152 | 3300046459 | Ga0495629_0009419 | Ga0495629_0009419_383_1168 | 246 |
| 153 | 3300046463 | Ga0495653_0138218 | Ga0495653_0138218_882_1667 | 246 |
| 154 | 3300046476 | Ga0495662_0000077 | Ga0495662_0000077_15589_16374 | 246 |
| 155 | 3300046507 | Ga0495606_0001199 | Ga0495606_0001199_25277_26065 | 246 |
| 156 | 3300046511 | Ga0495608_0001842 | Ga0495608_0001842_10844_11629 | 246 |
| 157 | 3300046514 | Ga0495618_0000051 | Ga0495618_0000051_22625_23410 | 246 |
| 158 | 3300046516 | Ga0495628_0274350 | Ga0495628_0274350_174_959 | 246 |
| 159 | 3300046516 | Ga0495628_0286637 | Ga0495628_0286637_48_833 | 246 |
| 160 | 3300046517 | Ga0495630_0000125 | Ga0495630_0000125_38959_39744 | 246 |
| 161 | 3300046543 | Ga0495645_0252286 | Ga0495645_0252286_301_1086 | 246 |
| 162 | 3300046642 | Ga0495634_0000728 | Ga0495634_0000728_7491_8276 | 246 |
| 163 | 3300046642 | Ga0495634_0036516 | Ga0495634_0036516_1482_2267 | 246 |
| 164 | 3300046681 | Ga0495647_0002433 | Ga0495647_0002433_1142_1987 | 246 |
| 165 | 3300046690 | Ga0495624_0253909 | Ga0495624_0253909_105_890 | 246 |
| 166 | 3300047317 | Ga0495604_0021975 | Ga0495604_0021975_2139_2924 | 246 |
| 167 | 3300047322 | Ga0495680_0008509 | Ga0495680_0008509_5815_6600 | 246 |
| 168 | 3300047322 | Ga0495680_0031484 | Ga0495680_0031484_103_888 | 246 |
| 169 | 3300048088 | Ga0495602_0000548 | Ga0495602_0000548_21973_22758 | 246 |
| 170 | 3300048088 | Ga0495602_0162755 | Ga0495602_0162755_28_813 | 246 |
| 171 | 3300048911 | Ga0496108_0010435 | Ga0496108_0010435_1125_1931 | 246 |
| 172 | 3300048913 | Ga0496110_0035633 | Ga0496110_0035633_2881_3666 | 246 |
| 173 | 3300053077 | Ga0495601_0003507 | Ga0495601_0003507_1234_2019 | 246 |
| 174 | 3300053077 | Ga0495601_0206395 | Ga0495601_0206395_399_1184 | 246 |
| 175 | 3300053078 | Ga0495612_0004584 | Ga0495612_0004584_83_868 | 246 |
| 176 | 3300053084 | Ga0495595_0001165 | Ga0495595_0001165_6682_7467 | 246 |
| 177 | 3300053084 | Ga0495595_0034437 | Ga0495595_0034437_304_1089 | 246 |
| 178 | 3300001977 | JGI24746J21847_1000013 | JGI24746J21847_100001314 | 247 |
| 179 | 3300005356 | Ga0070674_100128095 | Ga0070674_1001280953 | 247 |
| 180 | 3300005614 | Ga0068856_100018573 | Ga0068856_1000185732 | 247 |
| 181 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017156 | 247 |
| 182 | 3300014325 | Ga0163163_10379970 | Ga0163163_103799702 | 247 |
| 183 | 3300026078 | Ga0207702_10062233 | Ga0207702_100622332 | 247 |
| 184 | 3300046454 | Ga0495592_0117463 | Ga0495592_0117463_223_1017 | 247 |
| 185 | 3300046516 | Ga0495628_0215798 | Ga0495628_0215798_458_1246 | 247 |
| 186 | 3300046529 | Ga0495652_0024398 | Ga0495652_0024398_1192_1980 | 247 |
| 187 | 3300046543 | Ga0495645_0065210 | Ga0495645_0065210_1699_2487 | 247 |
| 188 | 3300046675 | Ga0495657_0005201 | Ga0495657_0005201_327_1166 | 247 |
| 189 | 3300047673 | Ga0495593_0166609 | Ga0495593_0166609_125_913 | 247 |
| 190 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_585501_586289 | 247 |
| 191 | 3300048908 | Ga0496105_0003974 | Ga0496105_0003974_6271_7095 | 247 |
| 192 | 3300048911 | Ga0496108_0134675 | Ga0496108_0134675_301_1098 | 247 |
| 193 | 3300048918 | Ga0496115_0000027 | Ga0496115_0000027_37129_37917 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tzf-assembly1.cif.gz_B | crystal structure of the yersinia pestis dihydropteroate synthase with sulfonamide drug complex. | 0.9557 | 2 | 245 |
| 3tzf-assembly1.cif.gz_A | crystal structure of the yersinia pestis dihydropteroate synthase with sulfonamide drug complex. | 0.9551 | 2 | 245 |
| 3tzn-assembly1.cif.gz_B | crystal structure of the yersinia pestis dihydropteroate synthase. | 0.9494 | 2 | 245 |
| 1eye-assembly1.cif.gz_A-2 | 1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8-dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate | 0.9469 | 2 | 247 |
| 3tyu-assembly1.cif.gz_B | crystal structure of dihydropteroate synthetase with product1 | 0.9412 | 2 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tznB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9494 | 2 | 245 | 3.20.20.20 |
| 1eyeA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9469 | 2 | 247 | 3.20.20.20 |
| 1eyeA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9395 | 2 | 247 | 3.20.20.20 |
| 2dzaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9374 | 2 | 247 | 3.20.20.20 |
| af_Q4LB35_466_732_3.20.20.20 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like | 0.9223 | 5 | 245 | 3.20.20.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534U5W7-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9775 | 6 | 246 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A2V7UZ45-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9714 | 2 | 245 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A388TDW2-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9704 | 53 | 246 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A7C5NV44-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9681 | 71 | 246 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
| AF-A0A7V2NME3-F1-model_v4 | dihydropteroate synthase (EC 2.5.1.15) | 0.9679 | 64 | 245 |
GO:0004156
GO:0005829 GO:0046654 GO:0046656 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar