F297497

General Info

Members Datasets Scaffolds Average Seq Length
193 145 386 144

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0080988|Ga0439436_0080988_230_721
Length 163
Sequence MTTQTRTEIDPRGPQFTAAVTSVVLAVILLTAPGTFGLALLGVQTALFALAAAVGVQHTPHAWVFRRVIRPRLDPPSELEDAAPPRFAQAVGLAFAAVGLVGYLTGSDLLGAIAVGLALVAALLNAVFGFCLGCEMYLVIRRVTARFTQTNHPVASTTSTTGN

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
76 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
134 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
137 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
138 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
139 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
140 2626541554 Frankia sp. AvcI.1 Isolate Nodule
141 2643221714 Streptomyces sp. Root264 Isolate Unclassified
142 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
143 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
144 2862574272 Streptomyces sp. AcE210 Isolate Nodule
145 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.3
Metatranscriptomes 2.59
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.39
Nodule 1.04
Rhizoplane 1.55
Rhizosphere 64.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0080988 3300041404 Bacteria 904
2 JGI24740J21852_10067701 3300001979 Bacteria 965
3 JGI24737J22298_10005556 3300001990 Bacteria 4348
4 JGI24735J21928_10003787 3300002067 Bacteria 5129
5 JGI25153J46596_10038625 3300003215 Bacteria 1502
6 Ga0006562J51391_1028626 3300003578 Bacteria 5780
7 Ga0006562J51391_1028627 3300003578 Bacteria 5880
8 Ga0070658_10645890 3300005327 Bacteria 918
9 Ga0070660_101174357 3300005339 Bacteria 650
10 Ga0070668_100376580 3300005347 Bacteria 1207
11 Ga0070671_100107309 3300005355 Bacteria 2345
12 Ga0070673_101694075 3300005364 Bacteria 598
13 Ga0070663_102083524 3300005455 Bacteria 511
14 Ga0068867_100619863 3300005459 Bacteria 946
15 Ga0070707_100447076 3300005468 Bacteria 1253
16 Ga0070698_100066368 3300005471 Bacteria 3632
17 Ga0070672_100094731 3300005543 Bacteria 2414
18 Ga0068857_100588018 3300005577 Bacteria 1051
19 Ga0068857_100604905 3300005577 Bacteria 1036
20 Ga0070702_100503953 3300005615 Bacteria 890
21 Ga0068864_102123804 3300005618 Bacteria 568
22 Ga0068870_10175921 3300005840 Bacteria 1281
23 Ga0075365_10044995 3300006038 Bacteria 2894
24 Ga0075365_10113240 3300006038 Bacteria 1866
25 Ga0075365_10143858 3300006038 Bacteria 1656
26 Ga0075365_10334816 3300006038 Bacteria 1066
27 Ga0075365_10381324 3300006038 Bacteria 995
28 Ga0075365_10503114 3300006038 Bacteria 856
29 Ga0075365_11125779 3300006038 Bacteria 553
30 Ga0075368_10000429 3300006042 Bacteria 12411
31 Ga0075368_10025420 3300006042 Bacteria 2272
32 Ga0075363_100000066 3300006048 Bacteria 21418
33 Ga0075363_100003271 3300006048 Bacteria 6855
34 Ga0075363_100174135 3300006048 Bacteria 1222
35 Ga0075363_100395346 3300006048 Bacteria 812
36 Ga0075367_10006200 3300006178 Bacteria 6023
37 Ga0075367_10008124 3300006178 Bacteria 5419
38 Ga0075367_10660674 3300006178 Bacteria 665
39 Ga0075370_10145507 3300006353 Bacteria 1387
40 Ga0075370_10163107 3300006353 Bacteria 1308
41 Ga0075370_10198397 3300006353 Bacteria 1183
42 Ga0099794_10368264 3300007265 Bacteria 749
43 Ga0105244_10120829 3300009036 Bacteria 1268
44 Ga0105245_10284227 3300009098 Bacteria 1618
45 Ga0105243_10807563 3300009148 Bacteria 925
46 Ga0105248_10029484 3300009177 Bacteria 6121
47 Ga0157375_10691501 3300013308 Bacteria 1174
48 Ga0163163_10126539 3300014325 Bacteria 2593
49 Ga0163163_10159935 3300014325 Bacteria 2297
50 Ga0163163_11096263 3300014325 Bacteria 859
51 Ga0157380_10377044 3300014326 Bacteria 1337
52 Ga0157376_11331160 3300014969 Bacteria 749
53 Ga0206350_10738901 3300020080 Bacteria 959
54 Ga0209758_1003249 3300025297 Bacteria 15073
55 Ga0207647_10121952 3300025904 Bacteria 1536
56 Ga0207643_10186499 3300025908 Bacteria 1257
57 Ga0207646_10903224 3300025922 Bacteria 783
58 Ga0207687_10023849 3300025927 Bacteria 4082
59 Ga0207691_10113116 3300025940 Bacteria 2412
60 Ga0207679_10670708 3300025945 Bacteria 939
61 Ga0207679_11463354 3300025945 Bacteria 627
62 Ga0207658_10242567 3300025986 Bacteria 1527
63 Ga0207677_10692520 3300026023 Bacteria 903
64 Ga0207639_10633242 3300026041 Bacteria 988
65 Ga0207678_10456095 3300026067 Bacteria 1112
66 Ga0207708_10184568 3300026075 Bacteria 1657
67 Ga0207676_10657511 3300026095 Bacteria 1012
68 Ga0207675_100107221 3300026118 Bacteria 2634
69 Ga0207675_100905118 3300026118 Bacteria 899
70 Ga0209813_10007403 3300027866 Bacteria 2734
71 Ga0209813_10010128 3300027866 Bacteria 2430
72 Ga0268264_11883813 3300028381 Bacteria 608
73 Ga0307517_10019851 3300028786 Bacteria 8596
74 Ga0307511_10217257 3300030521 Bacteria 966
75 Ga0307508_10160869 3300031616 Bacteria 1849
76 Ga0307514_10005798 3300031649 Bacteria 10911
77 Ga0307516_10004895 3300031730 Bacteria 16297
78 Ga0307405_11354911 3300031731 Bacteria 621
79 Ga0307405_12135820 3300031731 Bacteria 503
80 Ga0307413_10062078 3300031824 Bacteria 2310
81 Ga0307413_10627611 3300031824 Bacteria 883
82 Ga0307518_10279260 3300031838 Bacteria 1035
83 Ga0307410_10039944 3300031852 Bacteria 3085
84 Ga0307410_11414152 3300031852 Bacteria 611
85 Ga0307407_10036559 3300031903 Bacteria 2707
86 Ga0307407_10521505 3300031903 Bacteria 874
87 Ga0307409_100074493 3300031995 Bacteria 2713
88 Ga0307409_100080404 3300031995 Bacteria 2630
89 Ga0307409_100253692 3300031995 Bacteria 1610
90 Ga0307416_100461023 3300032002 Bacteria 1326
91 Ga0307415_100276096 3300032126 Bacteria 1379
92 Ga0307510_10042130 3300033180 Bacteria 4979
93 Ga0373933_0208222 3300035724 Bacteria 1252
94 Ga0395900_0210892 3300037418 Bacteria 1961
95 Ga0395900_1130512 3300037418 Bacteria 700
96 Ga0395898_0001876 3300037466 Bacteria 26857
97 Ga0395901_0050700 3300038443 Bacteria 4311
98 Ga0439436_0025864 3300041404 Bacteria 1722
99 Ga0439439_0072099 3300041406 Bacteria 926
100 Ga0451800_0165305 3300041459 Bacteria 773
101 Ga0451802_1449469 3300041460 Bacteria 550
102 Ga0439449_0076835 3300042007 Bacteria 1231
103 Ga0439457_008168 3300042014 Bacteria 2477
104 Ga0450898_006258 3300042134 Bacteria 1822
105 Ga0466972_0039208 3300044658 Bacteria 2312
106 Ga0466961_0255597 3300044693 Bacteria 1075
107 Ga0466963_0304332 3300044694 Bacteria 1121
108 Ga0466970_0055078 3300044765 Bacteria 2124
109 Ga0466957_0367524 3300044842 Bacteria 979
110 Ga0466960_0030391 3300044901 Bacteria 2485
111 Ga0466958_0753258 3300045836 Bacteria 635
112 Ga0495603_0004980 3300046455 Bacteria 7949
113 Ga0495629_0035790 3300046459 Bacteria 3507
114 Ga0495638_0015474 3300046460 Bacteria 5121
115 Ga0495638_0031161 3300046460 Bacteria 3428
116 Ga0495638_0270729 3300046460 Bacteria 927
117 Ga0495605_0136282 3300046474 Bacteria 1104
118 Ga0495594_0157520 3300046499 Bacteria 1290
119 Ga0495594_0402985 3300046499 Bacteria 778
120 Ga0495631_0049720 3300046518 Bacteria 1835
121 Ga0495643_0210932 3300046522 Bacteria 927
122 Ga0495644_0047220 3300046523 Bacteria 1618
123 Ga0495666_0091666 3300046526 Bacteria 1434
124 Ga0495640_0126630 3300046533 Bacteria 1656
125 Ga0495611_0320319 3300046648 Bacteria 713
126 Ga0495635_0113652 3300046663 Bacteria 1848
127 Ga0495657_0059089 3300046675 Bacteria 2544
128 Ga0495658_0899075 3300046683 Bacteria 566
129 Ga0495613_0094275 3300046689 Bacteria 2166
130 Ga0495624_0292478 3300046690 Bacteria 983
131 Ga0495670_0096627 3300046691 Bacteria 1517
132 Ga0495604_0139627 3300047317 Bacteria 1732
133 Ga0495636_0042050 3300047318 Bacteria 1898
134 Ga0495676_0048794 3300047321 Bacteria 3409
135 Ga0495676_0074474 3300047321 Bacteria 2599
136 Ga0495685_005213 3300047447 Bacteria 4234
137 Ga0495614_0040719 3300048089 Bacteria 1994
138 Ga0496109_1187983 3300048912 Bacteria 700
139 Ga0496122_0007675 3300048925 Bacteria 11893
140 Ga0496122_0090125 3300048925 Bacteria 2094
141 Ga0496123_0001428 3300048926 Bacteria 33368
142 Ga0501307_031099 3300049162 Bacteria 740
143 Ga0501318_016789 3300049534 Bacteria 888
144 Ga0501031_0056503 3300049568 Bacteria 2557
145 Ga0501032_0021759 3300049569 Bacteria 4455
146 Ga0501033_0077112 3300049570 Bacteria 2446
147 Ga0501034_0605852 3300049571 Bacteria 1000
148 Ga0501036_0253228 3300049572 Bacteria 1475
149 Ga0501037_0212932 3300049573 Bacteria 1362
150 Ga0501038_0351216 3300049574 Bacteria 1148
151 Ga0501042_0359415 3300049578 Bacteria 1054
152 Ga0501043_0757050 3300049579 Bacteria 706
153 Ga0501046_0561154 3300049580 Bacteria 813
154 Ga0501047_0001575 3300049581 Bacteria 22284
155 Ga0501047_0326668 3300049581 Bacteria 1373
156 Ga0501070_0769312 3300049586 Bacteria 758
157 Ga0501070_1396664 3300049586 Bacteria 532
158 Ga0501071_0325568 3300049587 Bacteria 1167
159 Ga0501071_0723326 3300049587 Bacteria 767
160 Ga0501035_0127574 3300049822 Bacteria 2220
161 Ga0501044_0082850 3300049823 Bacteria 3244
162 nmdc:mga03n38_386608_c1 3300050490 Bacteria 768
163 nmdc:mga03n38_38770_c1 3300050490 Bacteria 2063
164 nmdc:mga03n38_5729_c1 3300050490 Bacteria 4257
165 nmdc:mga00v17_516717_c1 3300050491 Bacteria 773
166 nmdc:mga0yw44_1007100_c1 3300050492 Bacteria 564
167 nmdc:mga0yw44_162317_c1 3300050492 Bacteria 1463
168 nmdc:mga0yw44_23389_c1 3300050492 Bacteria 3481
169 nmdc:mga0yw44_346399_c1 3300050492 Bacteria 1000
170 nmdc:mga0yw44_39098_c1 3300050492 Bacteria 2811
171 nmdc:mga0yw44_741352_c1 3300050492 Bacteria 667
172 nmdc:mga06z11_25341_c1 3300050494 Bacteria 2810
173 nmdc:mga06z11_298112_c1 3300050494 Bacteria 958
174 nmdc:mga06z11_3265_c1 3300050494 Bacteria 6270
175 nmdc:mga04h51_11869_c1 3300050495 Bacteria 2430
176 nmdc:mga07m45_165297_c1 3300050496 Bacteria 1285
177 nmdc:mga07m45_202715_c1 3300050496 Bacteria 1154
178 nmdc:mga07m45_32636_c1 3300050496 Bacteria 2887
179 nmdc:mga0sz30_114907_c1 3300050516 Bacteria 1181
180 Ga0500644_0070025 3300053088 Bacteria 1262
181 Ga0500553_203062 3300053101 Bacteria 674
182 Ga0500560_000396 3300053107 Bacteria 5875
183 Ga0500614_059701 3300053123 Bacteria 1023
184 Ga0500573_0028680 3300053140 Bacteria 3207
185 Ga0500603_024522 3300053150 Bacteria 1510
186 Ga0500636_0484709 3300053177 Bacteria 550
187 Ga0500565_063742 3300053734 Bacteria 562
188 2626634759 2626541554 Bacteria 7741902
189 2644631660 2643221714 Bacteria 9015452
190 2837268830 2837268691 Bacteria 7850704
191 2855389747 2855386786 Bacteria 4752232
192 2862580440 2862574272 Bacteria 10567477
193 2946073474 2946072368 Bacteria 8999607
194 Ga0439436_0080988
195 JGI24740J21852_10067701
196 JGI24737J22298_10005556
197 JGI24735J21928_10003787
198 JGI25153J46596_10038625
199 Ga0006562J51391_1028626
200 Ga0006562J51391_1028627
201 Ga0070658_10645890
202 Ga0070660_101174357
203 Ga0070668_100376580
204 Ga0070671_100107309
205 Ga0070673_101694075
206 Ga0070663_102083524
207 Ga0068867_100619863
208 Ga0070707_100447076
209 Ga0070698_100066368
210 Ga0070672_100094731
211 Ga0068857_100588018
212 Ga0068857_100604905
213 Ga0070702_100503953
214 Ga0068864_102123804
215 Ga0068870_10175921
216 Ga0075365_10044995
217 Ga0075365_10113240
218 Ga0075365_10143858
219 Ga0075365_10334816
220 Ga0075365_10381324
221 Ga0075365_10503114
222 Ga0075365_11125779
223 Ga0075368_10000429
224 Ga0075368_10025420
225 Ga0075363_100000066
226 Ga0075363_100003271
227 Ga0075363_100174135
228 Ga0075363_100395346
229 Ga0075367_10006200
230 Ga0075367_10008124
231 Ga0075367_10660674
232 Ga0075370_10145507
233 Ga0075370_10163107
234 Ga0075370_10198397
235 Ga0099794_10368264
236 Ga0105244_10120829
237 Ga0105245_10284227
238 Ga0105243_10807563
239 Ga0105248_10029484
240 Ga0157375_10691501
241 Ga0163163_10126539
242 Ga0163163_10159935
243 Ga0163163_11096263
244 Ga0157380_10377044
245 Ga0157376_11331160
246 Ga0206350_10738901
247 Ga0209758_1003249
248 Ga0207647_10121952
249 Ga0207643_10186499
250 Ga0207646_10903224
251 Ga0207687_10023849
252 Ga0207691_10113116
253 Ga0207679_10670708
254 Ga0207679_11463354
255 Ga0207658_10242567
256 Ga0207677_10692520
257 Ga0207639_10633242
258 Ga0207678_10456095
259 Ga0207708_10184568
260 Ga0207676_10657511
261 Ga0207675_100107221
262 Ga0207675_100905118
263 Ga0209813_10007403
264 Ga0209813_10010128
265 Ga0268264_11883813
266 Ga0307517_10019851
267 Ga0307511_10217257
268 Ga0307508_10160869
269 Ga0307514_10005798
270 Ga0307516_10004895
271 Ga0307405_11354911
272 Ga0307405_12135820
273 Ga0307413_10062078
274 Ga0307413_10627611
275 Ga0307518_10279260
276 Ga0307410_10039944
277 Ga0307410_11414152
278 Ga0307407_10036559
279 Ga0307407_10521505
280 Ga0307409_100074493
281 Ga0307409_100080404
282 Ga0307409_100253692
283 Ga0307416_100461023
284 Ga0307415_100276096
285 Ga0307510_10042130
286 Ga0373933_0208222
287 Ga0395900_0210892
288 Ga0395900_1130512
289 Ga0395898_0001876
290 Ga0395901_0050700
291 Ga0439436_0025864
292 Ga0439439_0072099
293 Ga0451800_0165305
294 Ga0451802_1449469
295 Ga0439449_0076835
296 Ga0439457_008168
297 Ga0450898_006258
298 Ga0466972_0039208
299 Ga0466961_0255597
300 Ga0466963_0304332
301 Ga0466970_0055078
302 Ga0466957_0367524
303 Ga0466960_0030391
304 Ga0466958_0753258
305 Ga0495603_0004980
306 Ga0495629_0035790
307 Ga0495638_0015474
308 Ga0495638_0031161
309 Ga0495638_0270729
310 Ga0495605_0136282
311 Ga0495594_0157520
312 Ga0495594_0402985
313 Ga0495631_0049720
314 Ga0495643_0210932
315 Ga0495644_0047220
316 Ga0495666_0091666
317 Ga0495640_0126630
318 Ga0495611_0320319
319 Ga0495635_0113652
320 Ga0495657_0059089
321 Ga0495658_0899075
322 Ga0495613_0094275
323 Ga0495624_0292478
324 Ga0495670_0096627
325 Ga0495604_0139627
326 Ga0495636_0042050
327 Ga0495676_0048794
328 Ga0495676_0074474
329 Ga0495685_005213
330 Ga0495614_0040719
331 Ga0496109_1187983
332 Ga0496122_0007675
333 Ga0496122_0090125
334 Ga0496123_0001428
335 Ga0501307_031099
336 Ga0501318_016789
337 Ga0501031_0056503
338 Ga0501032_0021759
339 Ga0501033_0077112
340 Ga0501034_0605852
341 Ga0501036_0253228
342 Ga0501037_0212932
343 Ga0501038_0351216
344 Ga0501042_0359415
345 Ga0501043_0757050
346 Ga0501046_0561154
347 Ga0501047_0001575
348 Ga0501047_0326668
349 Ga0501070_0769312
350 Ga0501070_1396664
351 Ga0501071_0325568
352 Ga0501071_0723326
353 Ga0501035_0127574
354 Ga0501044_0082850
355 nmdc:mga03n38_386608_c1
356 nmdc:mga03n38_38770_c1
357 nmdc:mga03n38_5729_c1
358 nmdc:mga00v17_516717_c1
359 nmdc:mga0yw44_1007100_c1
360 nmdc:mga0yw44_162317_c1
361 nmdc:mga0yw44_23389_c1
362 nmdc:mga0yw44_346399_c1
363 nmdc:mga0yw44_39098_c1
364 nmdc:mga0yw44_741352_c1
365 nmdc:mga06z11_25341_c1
366 nmdc:mga06z11_298112_c1
367 nmdc:mga06z11_3265_c1
368 nmdc:mga04h51_11869_c1
369 nmdc:mga07m45_165297_c1
370 nmdc:mga07m45_202715_c1
371 nmdc:mga07m45_32636_c1
372 nmdc:mga0sz30_114907_c1
373 Ga0500644_0070025
374 Ga0500553_203062
375 Ga0500560_000396
376 Ga0500614_059701
377 Ga0500573_0028680
378 Ga0500603_024522
379 Ga0500636_0484709
380 Ga0500565_063742
381 2626634759
382 2644631660
383 2837268830
384 2855389747
385 2862580440
386 2946073474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14340

DUF4395

Domain of unknown function (DUF4395)

9

142

0.99

Map