F297084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 134 | 193 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10207925|Ga0105245_102079253 |
| Length | 146 |
| Sequence | VFKREHTCSIAQENRLKEEHPGMKGLKTLTATLSVAGLMAVLAPAYASAGAYSHYVACGVSQNAKPAHVCQKARKKGAFFKSNQGTVTYTVCVRFPTGKSLCAPPEEAQQGTLYVNKITSNIPGKHRVSWFVEGKKVGSFVFRVPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 64 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 65 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 66 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 67 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 68 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 69 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 70 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 71 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 115 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 116 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 117 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 119 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 120 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 121 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 122 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 123 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 0 |
| Rhizoplane | 9.84 |
| Rhizosphere | 88.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1027697 | 3300000546 | Unclassified | 607 |
| 2 | Ga0070683_100052375 | 3300005329 | Bacteria | 3781 |
| 3 | Ga0070683_100172659 | 3300005329 | Bacteria | 2052 |
| 4 | Ga0070670_101483571 | 3300005331 | Unclassified | 622 |
| 5 | Ga0070677_10000037 | 3300005333 | Bacteria | 40212 |
| 6 | Ga0068869_101480607 | 3300005334 | Unclassified | 602 |
| 7 | Ga0070680_100177949 | 3300005336 | Bacteria | 1791 |
| 8 | Ga0070691_10000908 | 3300005341 | Bacteria | 12026 |
| 9 | Ga0070691_10464391 | 3300005341 | Unclassified | 725 |
| 10 | Ga0070674_100192074 | 3300005356 | Bacteria | 1571 |
| 11 | Ga0070711_100001735 | 3300005439 | Bacteria | 12093 |
| 12 | Ga0070700_100068765 | 3300005441 | Bacteria | 2253 |
| 13 | Ga0070700_100094352 | 3300005441 | Bacteria | 1959 |
| 14 | Ga0070663_100303359 | 3300005455 | Bacteria | 1279 |
| 15 | Ga0070681_10048239 | 3300005458 | Bacteria | 4256 |
| 16 | Ga0070681_11159005 | 3300005458 | Unclassified | 694 |
| 17 | Ga0070679_100000181 | 3300005530 | Bacteria | 50834 |
| 18 | Ga0070684_100027070 | 3300005535 | Bacteria | 4835 |
| 19 | Ga0070684_100133202 | 3300005535 | Bacteria | 2243 |
| 20 | Ga0070684_100206548 | 3300005535 | Unclassified | 1790 |
| 21 | Ga0070704_101316881 | 3300005549 | Unclassified | 661 |
| 22 | Ga0070664_100189530 | 3300005564 | Bacteria | 1832 |
| 23 | Ga0068857_100345023 | 3300005577 | Bacteria | 1378 |
| 24 | Ga0068854_100023409 | 3300005578 | Bacteria | 4219 |
| 25 | Ga0068856_100265813 | 3300005614 | Bacteria | 1731 |
| 26 | Ga0068852_101919584 | 3300005616 | Bacteria | 614 |
| 27 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 28 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 29 | Ga0068861_100938001 | 3300005719 | Bacteria | 822 |
| 30 | Ga0068863_100001530 | 3300005841 | Bacteria | 22860 |
| 31 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 32 | Ga0097621_100188925 | 3300006237 | Bacteria | 1783 |
| 33 | Ga0097621_100881549 | 3300006237 | Bacteria | 833 |
| 34 | Ga0075433_10000002 | 3300006852 | Bacteria | 92986 |
| 35 | Ga0075433_10014316 | 3300006852 | Bacteria | 6479 |
| 36 | Ga0105240_10862410 | 3300009093 | Bacteria | 976 |
| 37 | Ga0105245_10002179 | 3300009098 | Bacteria | 17745 |
| 38 | Ga0105245_10207925 | 3300009098 | Bacteria | 1882 |
| 39 | Ga0105242_10105713 | 3300009176 | Bacteria | 2391 |
| 40 | Ga0105249_12266553 | 3300009553 | Unclassified | 616 |
| 41 | Ga0105246_10871031 | 3300011119 | Bacteria | 805 |
| 42 | Ga0157374_10335824 | 3300013296 | Bacteria | 1499 |
| 43 | Ga0157378_10880211 | 3300013297 | Bacteria | 925 |
| 44 | Ga0157378_11925131 | 3300013297 | Unclassified | 640 |
| 45 | Ga0157372_10958330 | 3300013307 | Bacteria | 992 |
| 46 | Ga0157375_11751904 | 3300013308 | Unclassified | 736 |
| 47 | Ga0163163_10291739 | 3300014325 | Bacteria | 1683 |
| 48 | Ga0163163_12361932 | 3300014325 | Unclassified | 590 |
| 49 | Ga0157377_10428149 | 3300014745 | Bacteria | 908 |
| 50 | Ga0157377_10529443 | 3300014745 | Unclassified | 829 |
| 51 | Ga0157376_10908757 | 3300014969 | Bacteria | 899 |
| 52 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 53 | Ga0207682_10000018 | 3300025893 | Bacteria | 66215 |
| 54 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 55 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 56 | Ga0207707_10036749 | 3300025912 | Bacteria | 4282 |
| 57 | Ga0207695_10294420 | 3300025913 | Bacteria | 1515 |
| 58 | Ga0207660_10025221 | 3300025917 | Bacteria | 4034 |
| 59 | Ga0207652_10000371 | 3300025921 | Bacteria | 46723 |
| 60 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 61 | Ga0207687_10001467 | 3300025927 | Bacteria | 16198 |
| 62 | Ga0207706_10395294 | 3300025933 | Bacteria | 1199 |
| 63 | Ga0207670_10036018 | 3300025936 | Bacteria | 3215 |
| 64 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 65 | Ga0207661_10033030 | 3300025944 | Bacteria | 4014 |
| 66 | Ga0207661_10485478 | 3300025944 | Bacteria | 1128 |
| 67 | Ga0207679_10104858 | 3300025945 | Bacteria | 2219 |
| 68 | Ga0207640_10005989 | 3300025981 | Bacteria | 6645 |
| 69 | Ga0207678_10322068 | 3300026067 | Bacteria | 1330 |
| 70 | Ga0207708_10096886 | 3300026075 | Bacteria | 2280 |
| 71 | Ga0207708_10127228 | 3300026075 | Bacteria | 1989 |
| 72 | Ga0207702_10670517 | 3300026078 | Unclassified | 1021 |
| 73 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 74 | Ga0207675_100866182 | 3300026118 | Bacteria | 919 |
| 75 | Ga0207698_11874169 | 3300026142 | Bacteria | 614 |
| 76 | Ga0268266_10472697 | 3300028379 | Bacteria | 1194 |
| 77 | Ga0307511_10045873 | 3300030521 | Bacteria | 3605 |
| 78 | Ga0373933_1118060 | 3300035724 | Bacteria | 519 |
| 79 | Ga0373937_0036567 | 3300036401 | Bacteria | 4475 |
| 80 | Ga0373937_1611068 | 3300036401 | Bacteria | 596 |
| 81 | Ga0373937_1671923 | 3300036401 | Bacteria | 583 |
| 82 | Ga0451804_0755401 | 3300041463 | Bacteria | 562 |
| 83 | Ga0451807_2590042 | 3300041486 | Bacteria | 886 |
| 84 | Ga0451853_1636938 | 3300041512 | Unclassified | 1019 |
| 85 | Ga0451853_2679834 | 3300041512 | Bacteria | 9437 |
| 86 | Ga0466960_0822665 | 3300044901 | Bacteria | 563 |
| 87 | Ga0466967_0175588 | 3300045976 | Bacteria | 2018 |
| 88 | Ga0466967_1167374 | 3300045976 | Bacteria | 767 |
| 89 | Ga0466967_1448276 | 3300045976 | Unclassified | 684 |
| 90 | Ga0495592_0000688 | 3300046454 | Bacteria | 23534 |
| 91 | Ga0495592_0250895 | 3300046454 | Bacteria | 1169 |
| 92 | Ga0495603_0000033 | 3300046455 | Bacteria | 57940 |
| 93 | Ga0495603_0007880 | 3300046455 | Bacteria | 6423 |
| 94 | Ga0495591_051576 | 3300046458 | Unclassified | 1122 |
| 95 | Ga0495629_0061189 | 3300046459 | Bacteria | 2631 |
| 96 | Ga0495629_0092576 | 3300046459 | Bacteria | 2110 |
| 97 | Ga0495629_0380910 | 3300046459 | Bacteria | 960 |
| 98 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 99 | Ga0495641_0035272 | 3300046461 | Bacteria | 2360 |
| 100 | Ga0495641_0505417 | 3300046461 | Bacteria | 551 |
| 101 | Ga0495651_0267574 | 3300046462 | Bacteria | 1160 |
| 102 | Ga0495653_0267938 | 3300046463 | Bacteria | 1126 |
| 103 | Ga0495639_0005458 | 3300046475 | Bacteria | 5474 |
| 104 | Ga0495594_0182995 | 3300046499 | Bacteria | 1193 |
| 105 | Ga0495608_0072886 | 3300046511 | Bacteria | 2240 |
| 106 | Ga0495608_0225672 | 3300046511 | Bacteria | 1174 |
| 107 | Ga0495618_0000070 | 3300046514 | Bacteria | 72312 |
| 108 | Ga0495618_0586164 | 3300046514 | Unclassified | 665 |
| 109 | Ga0495620_0000215 | 3300046515 | Bacteria | 43539 |
| 110 | Ga0495620_0058192 | 3300046515 | Bacteria | 1619 |
| 111 | Ga0495628_0055861 | 3300046516 | Bacteria | 3109 |
| 112 | Ga0495628_0198521 | 3300046516 | Bacteria | 1512 |
| 113 | Ga0495628_0687727 | 3300046516 | Unclassified | 723 |
| 114 | Ga0495630_0103698 | 3300046517 | Bacteria | 2152 |
| 115 | Ga0495630_0242740 | 3300046517 | Bacteria | 1376 |
| 116 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 117 | Ga0495652_0007462 | 3300046529 | Bacteria | 10079 |
| 118 | Ga0495586_0006455 | 3300046535 | Bacteria | 6264 |
| 119 | Ga0495586_0112977 | 3300046535 | Bacteria | 1513 |
| 120 | Ga0495587_0417747 | 3300046536 | Bacteria | 745 |
| 121 | Ga0495587_0504655 | 3300046536 | Bacteria | 669 |
| 122 | Ga0495598_0004462 | 3300046537 | Bacteria | 3031 |
| 123 | Ga0495621_0002501 | 3300046539 | Bacteria | 4954 |
| 124 | Ga0495645_0006133 | 3300046543 | Bacteria | 8318 |
| 125 | Ga0495645_0045277 | 3300046543 | Bacteria | 3210 |
| 126 | Ga0495645_0180770 | 3300046543 | Bacteria | 1445 |
| 127 | Ga0495667_0699104 | 3300046559 | Unclassified | 628 |
| 128 | Ga0495656_0001136 | 3300046615 | Bacteria | 8648 |
| 129 | Ga0495668_0024540 | 3300046616 | Bacteria | 3429 |
| 130 | Ga0495634_0001402 | 3300046642 | Bacteria | 21621 |
| 131 | Ga0495634_0028701 | 3300046642 | Bacteria | 3860 |
| 132 | Ga0495634_0196339 | 3300046642 | Bacteria | 1256 |
| 133 | Ga0495635_0000074 | 3300046663 | Bacteria | 62264 |
| 134 | Ga0495657_0004097 | 3300046675 | Bacteria | 11689 |
| 135 | Ga0495599_0133562 | 3300046678 | Bacteria | 1541 |
| 136 | Ga0495599_0531028 | 3300046678 | Unclassified | 690 |
| 137 | Ga0495623_0137565 | 3300046679 | Bacteria | 1456 |
| 138 | Ga0495623_0539630 | 3300046679 | Bacteria | 612 |
| 139 | Ga0495646_0303540 | 3300046680 | Bacteria | 844 |
| 140 | Ga0495646_0409486 | 3300046680 | Unclassified | 704 |
| 141 | Ga0495647_0000023 | 3300046681 | Bacteria | 67025 |
| 142 | Ga0495658_0338722 | 3300046683 | Unclassified | 955 |
| 143 | Ga0495669_0116660 | 3300046684 | Bacteria | 1249 |
| 144 | Ga0495613_0000220 | 3300046689 | Bacteria | 55692 |
| 145 | Ga0495624_0000071 | 3300046690 | Bacteria | 65995 |
| 146 | Ga0495600_0069424 | 3300046809 | Bacteria | 2303 |
| 147 | Ga0495600_0157085 | 3300046809 | Bacteria | 1471 |
| 148 | Ga0495604_0000095 | 3300047317 | Bacteria | 75922 |
| 149 | Ga0495604_0073094 | 3300047317 | Bacteria | 2589 |
| 150 | Ga0495604_0127451 | 3300047317 | Bacteria | 1833 |
| 151 | Ga0495674_1421600 | 3300047319 | Bacteria | 516 |
| 152 | Ga0495676_0000136 | 3300047321 | Bacteria | 55706 |
| 153 | Ga0495680_0000472 | 3300047322 | Bacteria | 45335 |
| 154 | Ga0495680_0000486 | 3300047322 | Bacteria | 44707 |
| 155 | Ga0495679_019804 | 3300047446 | Bacteria | 2356 |
| 156 | Ga0495685_004050 | 3300047447 | Bacteria | 4714 |
| 157 | Ga0495593_0537049 | 3300047673 | Unclassified | 586 |
| 158 | Ga0496100_0452244 | 3300048903 | Bacteria | 985 |
| 159 | Ga0496102_0724972 | 3300048905 | Bacteria | 917 |
| 160 | Ga0496106_0000795 | 3300048909 | Bacteria | 22795 |
| 161 | Ga0496107_0012674 | 3300048910 | Bacteria | 5887 |
| 162 | Ga0496108_1189767 | 3300048911 | Bacteria | 645 |
| 163 | Ga0496110_0372979 | 3300048913 | Bacteria | 1300 |
| 164 | Ga0496110_0446674 | 3300048913 | Unclassified | 1178 |
| 165 | Ga0496110_1328756 | 3300048913 | Unclassified | 628 |
| 166 | Ga0496111_0050802 | 3300048914 | Bacteria | 2992 |
| 167 | Ga0496111_0942061 | 3300048914 | Unclassified | 621 |
| 168 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 169 | Ga0496112_0627936 | 3300048915 | Bacteria | 1005 |
| 170 | Ga0496112_1788059 | 3300048915 | Unclassified | 526 |
| 171 | Ga0496113_0003344 | 3300048916 | Bacteria | 9576 |
| 172 | Ga0496113_0060661 | 3300048916 | Bacteria | 2852 |
| 173 | Ga0496113_0435636 | 3300048916 | Unclassified | 1053 |
| 174 | Ga0496114_0012163 | 3300048917 | Bacteria | 6887 |
| 175 | Ga0501038_0260192 | 3300049574 | Bacteria | 1372 |
| 176 | Ga0501039_1316735 | 3300049575 | Unclassified | 557 |
| 177 | Ga0501040_1007063 | 3300049576 | Unclassified | 604 |
| 178 | Ga0501072_0022645 | 3300049588 | Bacteria | 4874 |
| 179 | Ga0501081_0831157 | 3300049743 | Bacteria | 696 |
| 180 | Ga0501045_0675633 | 3300049824 | Unclassified | 763 |
| 181 | Ga0501045_1301821 | 3300049824 | Unclassified | 529 |
| 182 | nmdc:mga0a205_13_c1 | 3300050515 | Bacteria | 111131 |
| 183 | nmdc:mga0a205_337_c1 | 3300050515 | Bacteria | 35228 |
| 184 | Ga0495601_0064383 | 3300053077 | Bacteria | 2331 |
| 185 | Ga0495601_0289919 | 3300053077 | Bacteria | 1067 |
| 186 | Ga0495601_0294604 | 3300053077 | Bacteria | 1057 |
| 187 | Ga0495612_0014700 | 3300053078 | Bacteria | 3144 |
| 188 | Ga0495595_0001245 | 3300053084 | Bacteria | 9923 |
| 189 | Ga0495595_0305177 | 3300053084 | Unclassified | 801 |
| 190 | Ga0495619_0001158 | 3300053085 | Bacteria | 17318 |
| 191 | Ga0495619_0008332 | 3300053085 | Bacteria | 6553 |
| 192 | Ga0495619_0029041 | 3300053085 | Bacteria | 3571 |
| 193 | Ga0500614_000077 | 3300053123 | Bacteria | 21548 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100001735 | Ga0070711_1000017356 | 98 |
| 2 | 3300046517 | Ga0495630_0242740 | Ga0495630_0242740_754_1200 | 103 |
| 3 | 3300035724 | Ga0373933_1118060 | Ga0373933_1118060_188_508 | 105 |
| 4 | 3300036401 | Ga0373937_1611068 | Ga0373937_1611068_264_584 | 105 |
| 5 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_100795_101202 | 107 |
| 6 | 3300046458 | Ga0495591_051576 | Ga0495591_051576_115_489 | 118 |
| 7 | 3300013307 | Ga0157372_10958330 | Ga0157372_109583302 | 119 |
| 8 | 3300005329 | Ga0070683_100052375 | Ga0070683_1000523753 | 122 |
| 9 | 3300005535 | Ga0070684_100027070 | Ga0070684_1000270706 | 122 |
| 10 | 3300025944 | Ga0207661_10033030 | Ga0207661_100330303 | 122 |
| 11 | 3300044901 | Ga0466960_0822665 | Ga0466960_0822665_14_385 | 122 |
| 12 | 3300046539 | Ga0495621_0002501 | Ga0495621_0002501_2836_3234 | 122 |
| 13 | 3300048916 | Ga0496113_0003344 | Ga0496113_0003344_4366_4764 | 122 |
| 14 | 3300013297 | Ga0157378_11925131 | Ga0157378_119251311 | 123 |
| 15 | 3300000546 | LJNas_1027697 | LJNas_10276972 | 124 |
| 16 | 3300005329 | Ga0070683_100172659 | Ga0070683_1001726591 | 124 |
| 17 | 3300005331 | Ga0070670_101483571 | Ga0070670_1014835711 | 124 |
| 18 | 3300005333 | Ga0070677_10000037 | Ga0070677_1000003734 | 124 |
| 19 | 3300005334 | Ga0068869_101480607 | Ga0068869_1014806071 | 124 |
| 20 | 3300005336 | Ga0070680_100177949 | Ga0070680_1001779492 | 124 |
| 21 | 3300005341 | Ga0070691_10000908 | Ga0070691_1000090812 | 124 |
| 22 | 3300005341 | Ga0070691_10464391 | Ga0070691_104643912 | 124 |
| 23 | 3300005356 | Ga0070674_100192074 | Ga0070674_1001920741 | 124 |
| 24 | 3300005441 | Ga0070700_100068765 | Ga0070700_1000687653 | 124 |
| 25 | 3300005441 | Ga0070700_100094352 | Ga0070700_1000943524 | 124 |
| 26 | 3300005455 | Ga0070663_100303359 | Ga0070663_1003033592 | 124 |
| 27 | 3300005458 | Ga0070681_10048239 | Ga0070681_100482394 | 124 |
| 28 | 3300005458 | Ga0070681_11159005 | Ga0070681_111590051 | 124 |
| 29 | 3300005530 | Ga0070679_100000181 | Ga0070679_10000018119 | 124 |
| 30 | 3300005535 | Ga0070684_100133202 | Ga0070684_1001332023 | 124 |
| 31 | 3300005535 | Ga0070684_100206548 | Ga0070684_1002065483 | 124 |
| 32 | 3300005549 | Ga0070704_101316881 | Ga0070704_1013168811 | 124 |
| 33 | 3300005564 | Ga0070664_100189530 | Ga0070664_1001895303 | 124 |
| 34 | 3300005577 | Ga0068857_100345023 | Ga0068857_1003450233 | 124 |
| 35 | 3300005578 | Ga0068854_100023409 | Ga0068854_1000234094 | 124 |
| 36 | 3300005614 | Ga0068856_100265813 | Ga0068856_1002658133 | 124 |
| 37 | 3300005616 | Ga0068852_101919584 | Ga0068852_1019195841 | 124 |
| 38 | 3300005618 | Ga0068864_100000015 | Ga0068864_10000001567 | 124 |
| 39 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003156 | 124 |
| 40 | 3300005719 | Ga0068861_100938001 | Ga0068861_1009380012 | 124 |
| 41 | 3300005841 | Ga0068863_100001530 | Ga0068863_10000153017 | 124 |
| 42 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001700 | 124 |
| 43 | 3300006237 | Ga0097621_100188925 | Ga0097621_1001889252 | 124 |
| 44 | 3300006237 | Ga0097621_100881549 | Ga0097621_1008815492 | 124 |
| 45 | 3300006852 | Ga0075433_10000002 | Ga0075433_1000000290 | 124 |
| 46 | 3300006852 | Ga0075433_10014316 | Ga0075433_100143168 | 124 |
| 47 | 3300009093 | Ga0105240_10862410 | Ga0105240_108624102 | 124 |
| 48 | 3300009098 | Ga0105245_10002179 | Ga0105245_1000217913 | 124 |
| 49 | 3300009098 | Ga0105245_10207925 | Ga0105245_102079253 | 124 |
| 50 | 3300009176 | Ga0105242_10105713 | Ga0105242_101057131 | 124 |
| 51 | 3300009553 | Ga0105249_12266553 | Ga0105249_122665532 | 124 |
| 52 | 3300011119 | Ga0105246_10871031 | Ga0105246_108710312 | 124 |
| 53 | 3300013296 | Ga0157374_10335824 | Ga0157374_103358242 | 124 |
| 54 | 3300013297 | Ga0157378_10880211 | Ga0157378_108802112 | 124 |
| 55 | 3300013308 | Ga0157375_11751904 | Ga0157375_117519041 | 124 |
| 56 | 3300014325 | Ga0163163_10291739 | Ga0163163_102917393 | 124 |
| 57 | 3300014325 | Ga0163163_12361932 | Ga0163163_123619321 | 124 |
| 58 | 3300014745 | Ga0157377_10428149 | Ga0157377_104281492 | 124 |
| 59 | 3300014745 | Ga0157377_10529443 | Ga0157377_105294432 | 124 |
| 60 | 3300014969 | Ga0157376_10908757 | Ga0157376_109087572 | 124 |
| 61 | 3300017792 | Ga0163161_10000022 | Ga0163161_10000022117 | 124 |
| 62 | 3300025893 | Ga0207682_10000018 | Ga0207682_1000001863 | 124 |
| 63 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002408 | 124 |
| 64 | 3300025905 | Ga0207685_10000005 | Ga0207685_1000000531 | 124 |
| 65 | 3300025912 | Ga0207707_10036749 | Ga0207707_100367494 | 124 |
| 66 | 3300025913 | Ga0207695_10294420 | Ga0207695_102944203 | 124 |
| 67 | 3300025917 | Ga0207660_10025221 | Ga0207660_100252212 | 124 |
| 68 | 3300025921 | Ga0207652_10000371 | Ga0207652_1000037128 | 124 |
| 69 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004110 | 124 |
| 70 | 3300025927 | Ga0207687_10001467 | Ga0207687_1000146710 | 124 |
| 71 | 3300025933 | Ga0207706_10395294 | Ga0207706_103952942 | 124 |
| 72 | 3300025936 | Ga0207670_10036018 | Ga0207670_100360186 | 124 |
| 73 | 3300025937 | Ga0207669_10000001 | Ga0207669_10000001134 | 124 |
| 74 | 3300025944 | Ga0207661_10485478 | Ga0207661_104854782 | 124 |
| 75 | 3300025945 | Ga0207679_10104858 | Ga0207679_101048583 | 124 |
| 76 | 3300025981 | Ga0207640_10005989 | Ga0207640_100059894 | 124 |
| 77 | 3300026067 | Ga0207678_10322068 | Ga0207678_103220682 | 124 |
| 78 | 3300026075 | Ga0207708_10096886 | Ga0207708_100968863 | 124 |
| 79 | 3300026075 | Ga0207708_10127228 | Ga0207708_101272284 | 124 |
| 80 | 3300026078 | Ga0207702_10670517 | Ga0207702_106705172 | 124 |
| 81 | 3300026088 | Ga0207641_10000016 | Ga0207641_1000001626 | 124 |
| 82 | 3300026118 | Ga0207675_100866182 | Ga0207675_1008661822 | 124 |
| 83 | 3300026142 | Ga0207698_11874169 | Ga0207698_118741691 | 124 |
| 84 | 3300028379 | Ga0268266_10472697 | Ga0268266_104726972 | 124 |
| 85 | 3300030521 | Ga0307511_10045873 | Ga0307511_100458733 | 124 |
| 86 | 3300036401 | Ga0373937_0036567 | Ga0373937_0036567_3814_4188 | 124 |
| 87 | 3300036401 | Ga0373937_1671923 | Ga0373937_1671923_83_457 | 124 |
| 88 | 3300041463 | Ga0451804_0755401 | Ga0451804_0755401_124_498 | 124 |
| 89 | 3300041486 | Ga0451807_2590042 | Ga0451807_2590042_111_485 | 124 |
| 90 | 3300041512 | Ga0451853_1636938 | Ga0451853_1636938_66_440 | 124 |
| 91 | 3300041512 | Ga0451853_2679834 | Ga0451853_2679834_4824_5198 | 124 |
| 92 | 3300045976 | Ga0466967_0175588 | Ga0466967_0175588_1249_1623 | 124 |
| 93 | 3300045976 | Ga0466967_1167374 | Ga0466967_1167374_230_604 | 124 |
| 94 | 3300045976 | Ga0466967_1448276 | Ga0466967_1448276_144_521 | 124 |
| 95 | 3300046454 | Ga0495592_0000688 | Ga0495592_0000688_6686_7060 | 124 |
| 96 | 3300046454 | Ga0495592_0250895 | Ga0495592_0250895_158_535 | 124 |
| 97 | 3300046455 | Ga0495603_0000033 | Ga0495603_0000033_12002_12382 | 124 |
| 98 | 3300046455 | Ga0495603_0007880 | Ga0495603_0007880_454_828 | 124 |
| 99 | 3300046459 | Ga0495629_0061189 | Ga0495629_0061189_1150_1524 | 124 |
| 100 | 3300046459 | Ga0495629_0092576 | Ga0495629_0092576_381_758 | 124 |
| 101 | 3300046459 | Ga0495629_0380910 | Ga0495629_0380910_348_722 | 124 |
| 102 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_52549_52923 | 124 |
| 103 | 3300046461 | Ga0495641_0035272 | Ga0495641_0035272_1788_2165 | 124 |
| 104 | 3300046461 | Ga0495641_0505417 | Ga0495641_0505417_141_515 | 124 |
| 105 | 3300046462 | Ga0495651_0267574 | Ga0495651_0267574_195_599 | 124 |
| 106 | 3300046463 | Ga0495653_0267938 | Ga0495653_0267938_312_686 | 124 |
| 107 | 3300046475 | Ga0495639_0005458 | Ga0495639_0005458_602_976 | 124 |
| 108 | 3300046499 | Ga0495594_0182995 | Ga0495594_0182995_809_1183 | 124 |
| 109 | 3300046511 | Ga0495608_0072886 | Ga0495608_0072886_768_1142 | 124 |
| 110 | 3300046511 | Ga0495608_0225672 | Ga0495608_0225672_397_771 | 124 |
| 111 | 3300046514 | Ga0495618_0000070 | Ga0495618_0000070_55950_56324 | 124 |
| 112 | 3300046514 | Ga0495618_0586164 | Ga0495618_0586164_173_547 | 124 |
| 113 | 3300046515 | Ga0495620_0000215 | Ga0495620_0000215_8499_8873 | 124 |
| 114 | 3300046515 | Ga0495620_0058192 | Ga0495620_0058192_1179_1553 | 124 |
| 115 | 3300046516 | Ga0495628_0055861 | Ga0495628_0055861_140_514 | 124 |
| 116 | 3300046516 | Ga0495628_0198521 | Ga0495628_0198521_751_1125 | 124 |
| 117 | 3300046516 | Ga0495628_0687727 | Ga0495628_0687727_86_463 | 124 |
| 118 | 3300046517 | Ga0495630_0103698 | Ga0495630_0103698_1165_1539 | 124 |
| 119 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_92814_93188 | 124 |
| 120 | 3300046529 | Ga0495652_0007462 | Ga0495652_0007462_3882_4259 | 124 |
| 121 | 3300046535 | Ga0495586_0006455 | Ga0495586_0006455_5687_6061 | 124 |
| 122 | 3300046535 | Ga0495586_0112977 | Ga0495586_0112977_122_496 | 124 |
| 123 | 3300046536 | Ga0495587_0417747 | Ga0495587_0417747_309_683 | 124 |
| 124 | 3300046536 | Ga0495587_0504655 | Ga0495587_0504655_98_472 | 124 |
| 125 | 3300046537 | Ga0495598_0004462 | Ga0495598_0004462_1865_2239 | 124 |
| 126 | 3300046543 | Ga0495645_0006133 | Ga0495645_0006133_3069_3443 | 124 |
| 127 | 3300046543 | Ga0495645_0045277 | Ga0495645_0045277_1635_2009 | 124 |
| 128 | 3300046543 | Ga0495645_0180770 | Ga0495645_0180770_784_1161 | 124 |
| 129 | 3300046559 | Ga0495667_0699104 | Ga0495667_0699104_180_554 | 124 |
| 130 | 3300046615 | Ga0495656_0001136 | Ga0495656_0001136_2097_2474 | 124 |
| 131 | 3300046616 | Ga0495668_0024540 | Ga0495668_0024540_2253_2627 | 124 |
| 132 | 3300046642 | Ga0495634_0001402 | Ga0495634_0001402_19523_19897 | 124 |
| 133 | 3300046642 | Ga0495634_0028701 | Ga0495634_0028701_3081_3455 | 124 |
| 134 | 3300046642 | Ga0495634_0196339 | Ga0495634_0196339_347_721 | 124 |
| 135 | 3300046663 | Ga0495635_0000074 | Ga0495635_0000074_39852_40226 | 124 |
| 136 | 3300046675 | Ga0495657_0004097 | Ga0495657_0004097_8432_8806 | 124 |
| 137 | 3300046678 | Ga0495599_0133562 | Ga0495599_0133562_322_699 | 124 |
| 138 | 3300046678 | Ga0495599_0531028 | Ga0495599_0531028_142_516 | 124 |
| 139 | 3300046679 | Ga0495623_0137565 | Ga0495623_0137565_211_588 | 124 |
| 140 | 3300046679 | Ga0495623_0539630 | Ga0495623_0539630_32_409 | 124 |
| 141 | 3300046680 | Ga0495646_0303540 | Ga0495646_0303540_177_554 | 124 |
| 142 | 3300046680 | Ga0495646_0409486 | Ga0495646_0409486_43_417 | 124 |
| 143 | 3300046681 | Ga0495647_0000023 | Ga0495647_0000023_6131_6505 | 124 |
| 144 | 3300046683 | Ga0495658_0338722 | Ga0495658_0338722_159_533 | 124 |
| 145 | 3300046684 | Ga0495669_0116660 | Ga0495669_0116660_273_647 | 124 |
| 146 | 3300046689 | Ga0495613_0000220 | Ga0495613_0000220_38819_39193 | 124 |
| 147 | 3300046690 | Ga0495624_0000071 | Ga0495624_0000071_52303_52677 | 124 |
| 148 | 3300046809 | Ga0495600_0069424 | Ga0495600_0069424_205_579 | 124 |
| 149 | 3300046809 | Ga0495600_0157085 | Ga0495600_0157085_468_842 | 124 |
| 150 | 3300047317 | Ga0495604_0000095 | Ga0495604_0000095_50231_50605 | 124 |
| 151 | 3300047317 | Ga0495604_0073094 | Ga0495604_0073094_1404_1793 | 124 |
| 152 | 3300047317 | Ga0495604_0127451 | Ga0495604_0127451_883_1257 | 124 |
| 153 | 3300047319 | Ga0495674_1421600 | Ga0495674_1421600_94_468 | 124 |
| 154 | 3300047321 | Ga0495676_0000136 | Ga0495676_0000136_13734_14108 | 124 |
| 155 | 3300047322 | Ga0495680_0000472 | Ga0495680_0000472_40520_40924 | 124 |
| 156 | 3300047322 | Ga0495680_0000486 | Ga0495680_0000486_29714_30088 | 124 |
| 157 | 3300047446 | Ga0495679_019804 | Ga0495679_019804_1466_1840 | 124 |
| 158 | 3300047447 | Ga0495685_004050 | Ga0495685_004050_2801_3175 | 124 |
| 159 | 3300047673 | Ga0495593_0537049 | Ga0495593_0537049_118_492 | 124 |
| 160 | 3300048903 | Ga0496100_0452244 | Ga0496100_0452244_310_684 | 124 |
| 161 | 3300048905 | Ga0496102_0724972 | Ga0496102_0724972_233_610 | 124 |
| 162 | 3300048909 | Ga0496106_0000795 | Ga0496106_0000795_6600_6974 | 124 |
| 163 | 3300048910 | Ga0496107_0012674 | Ga0496107_0012674_1619_1993 | 124 |
| 164 | 3300048911 | Ga0496108_1189767 | Ga0496108_1189767_203_577 | 124 |
| 165 | 3300048913 | Ga0496110_0372979 | Ga0496110_0372979_658_1032 | 124 |
| 166 | 3300048913 | Ga0496110_0446674 | Ga0496110_0446674_326_700 | 124 |
| 167 | 3300048913 | Ga0496110_1328756 | Ga0496110_1328756_146_520 | 124 |
| 168 | 3300048914 | Ga0496111_0050802 | Ga0496111_0050802_835_1209 | 124 |
| 169 | 3300048914 | Ga0496111_0942061 | Ga0496111_0942061_225_599 | 124 |
| 170 | 3300048915 | Ga0496112_0627936 | Ga0496112_0627936_413_787 | 124 |
| 171 | 3300048915 | Ga0496112_1788059 | Ga0496112_1788059_27_401 | 124 |
| 172 | 3300048916 | Ga0496113_0060661 | Ga0496113_0060661_473_847 | 124 |
| 173 | 3300048916 | Ga0496113_0435636 | Ga0496113_0435636_599_973 | 124 |
| 174 | 3300048917 | Ga0496114_0012163 | Ga0496114_0012163_3520_3894 | 124 |
| 175 | 3300049574 | Ga0501038_0260192 | Ga0501038_0260192_128_502 | 124 |
| 176 | 3300049575 | Ga0501039_1316735 | Ga0501039_1316735_65_439 | 124 |
| 177 | 3300049576 | Ga0501040_1007063 | Ga0501040_1007063_37_411 | 124 |
| 178 | 3300049588 | Ga0501072_0022645 | Ga0501072_0022645_2391_2765 | 124 |
| 179 | 3300049743 | Ga0501081_0831157 | Ga0501081_0831157_244_618 | 124 |
| 180 | 3300049824 | Ga0501045_0675633 | Ga0501045_0675633_102_476 | 124 |
| 181 | 3300049824 | Ga0501045_1301821 | Ga0501045_1301821_127_501 | 124 |
| 182 | 3300050515 | nmdc:mga0a205_13_c1 | nmdc:mga0a205_13_c1_80525_80935 | 124 |
| 183 | 3300050515 | nmdc:mga0a205_337_c1 | nmdc:mga0a205_337_c1_14998_15372 | 124 |
| 184 | 3300053077 | Ga0495601_0064383 | Ga0495601_0064383_360_734 | 124 |
| 185 | 3300053077 | Ga0495601_0289919 | Ga0495601_0289919_201_575 | 124 |
| 186 | 3300053077 | Ga0495601_0294604 | Ga0495601_0294604_192_569 | 124 |
| 187 | 3300053078 | Ga0495612_0014700 | Ga0495612_0014700_1478_1852 | 124 |
| 188 | 3300053084 | Ga0495595_0001245 | Ga0495595_0001245_7355_7756 | 124 |
| 189 | 3300053084 | Ga0495595_0305177 | Ga0495595_0305177_250_624 | 124 |
| 190 | 3300053085 | Ga0495619_0001158 | Ga0495619_0001158_6317_6718 | 124 |
| 191 | 3300053085 | Ga0495619_0008332 | Ga0495619_0008332_1247_1621 | 124 |
| 192 | 3300053085 | Ga0495619_0029041 | Ga0495619_0029041_2607_2981 | 124 |
| 193 | 3300053123 | Ga0500614_000077 | Ga0500614_000077_17525_17899 | 124 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6sws-assembly3.cif.gz_E-2 | the dbb dimerization domain of b-cell adaptor for pi3k (bcap) is required for down regulation of inflammatory signalling through the toll-like receptor pathway | 0.7289 | 46 | 122 |
| 2dmb-assembly1.cif.gz_A | solution structure of the 15th filamin domain from human filamin-b | 0.7271 | 28 | 123 |
| 5nok-assembly1.cif.gz_A | polysaccharide lyase baccell_00875 | 0.7217 | 31 | 124 |
| 5nok-assembly2.cif.gz_B | polysaccharide lyase baccell_00875 | 0.7097 | 30 | 122 |
| 6eja-assembly1.cif.gz_A | human xylosyltransferase 1 in complex with peptide qeeeysgggqgg | 0.7049 | 31 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_U4PBJ9_364_449_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7892 | 45 | 123 | 2.60.40.10 |
| 2pn5A01 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7483 | 46 | 124 | 2.60.40.2950 |
| af_A0A2R8PZ02_60_151_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.743 | 53 | 122 | 2.60.40.10 |
| af_X1WHE3_1930_2017_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7404 | 53 | 120 | 2.60.40.10 |
| af_Q9VEN1_1126_1224_1.10.418.10 | Mainly Alpha;Orthogonal Bundle;Actin-binding Protein, T-fimbrin; domain 1;Calponin-like domain | 0.7311 | 31 | 122 | 1.10.418.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YM86-F1-model_v4 | Excalibur calcium-binding domain-containing protein | 0.9683 | 30 | 123 |
|
| AF-A0A822JHG9-F1-model_v4 | VWFA domain-containing protein | 0.8493 | 49 | 124 |
|
| AF-A0A399WZA2-F1-model_v4 | Serine/threonine-protein kinase | 0.8433 | 55 | 121 |
GO:0004674
GO:0005524 |
| AF-A0A401ZWT8-F1-model_v4 | Ig-like domain-containing protein | 0.8407 | 31 | 124 |
GO:0016020
|
| AF-A0A5C7PMC5-F1-model_v4 | Metallophosphoesterase | 0.8338 | 29 | 122 |
GO:0005737
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar