F297084

General Info

Members Datasets Scaffolds Average Seq Length
193 134 193 124

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10207925|Ga0105245_102079253
Length 146
Sequence VFKREHTCSIAQENRLKEEHPGMKGLKTLTATLSVAGLMAVLAPAYASAGAYSHYVACGVSQNAKPAHVCQKARKKGAFFKSNQGTVTYTVCVRFPTGKSLCAPPEEAQQGTLYVNKITSNIPGKHRVSWFVEGKKVGSFVFRVPR

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 9.84
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1027697 3300000546 Unclassified 607
2 Ga0070683_100052375 3300005329 Bacteria 3781
3 Ga0070683_100172659 3300005329 Bacteria 2052
4 Ga0070670_101483571 3300005331 Unclassified 622
5 Ga0070677_10000037 3300005333 Bacteria 40212
6 Ga0068869_101480607 3300005334 Unclassified 602
7 Ga0070680_100177949 3300005336 Bacteria 1791
8 Ga0070691_10000908 3300005341 Bacteria 12026
9 Ga0070691_10464391 3300005341 Unclassified 725
10 Ga0070674_100192074 3300005356 Bacteria 1571
11 Ga0070711_100001735 3300005439 Bacteria 12093
12 Ga0070700_100068765 3300005441 Bacteria 2253
13 Ga0070700_100094352 3300005441 Bacteria 1959
14 Ga0070663_100303359 3300005455 Bacteria 1279
15 Ga0070681_10048239 3300005458 Bacteria 4256
16 Ga0070681_11159005 3300005458 Unclassified 694
17 Ga0070679_100000181 3300005530 Bacteria 50834
18 Ga0070684_100027070 3300005535 Bacteria 4835
19 Ga0070684_100133202 3300005535 Bacteria 2243
20 Ga0070684_100206548 3300005535 Unclassified 1790
21 Ga0070704_101316881 3300005549 Unclassified 661
22 Ga0070664_100189530 3300005564 Bacteria 1832
23 Ga0068857_100345023 3300005577 Bacteria 1378
24 Ga0068854_100023409 3300005578 Bacteria 4219
25 Ga0068856_100265813 3300005614 Bacteria 1731
26 Ga0068852_101919584 3300005616 Bacteria 614
27 Ga0068864_100000015 3300005618 Bacteria 303368
28 Ga0068866_10000003 3300005718 Bacteria 281675
29 Ga0068861_100938001 3300005719 Bacteria 822
30 Ga0068863_100001530 3300005841 Bacteria 22860
31 Ga0070715_10000001 3300006163 Bacteria 693690
32 Ga0097621_100188925 3300006237 Bacteria 1783
33 Ga0097621_100881549 3300006237 Bacteria 833
34 Ga0075433_10000002 3300006852 Bacteria 92986
35 Ga0075433_10014316 3300006852 Bacteria 6479
36 Ga0105240_10862410 3300009093 Bacteria 976
37 Ga0105245_10002179 3300009098 Bacteria 17745
38 Ga0105245_10207925 3300009098 Bacteria 1882
39 Ga0105242_10105713 3300009176 Bacteria 2391
40 Ga0105249_12266553 3300009553 Unclassified 616
41 Ga0105246_10871031 3300011119 Bacteria 805
42 Ga0157374_10335824 3300013296 Bacteria 1499
43 Ga0157378_10880211 3300013297 Bacteria 925
44 Ga0157378_11925131 3300013297 Unclassified 640
45 Ga0157372_10958330 3300013307 Bacteria 992
46 Ga0157375_11751904 3300013308 Unclassified 736
47 Ga0163163_10291739 3300014325 Bacteria 1683
48 Ga0163163_12361932 3300014325 Unclassified 590
49 Ga0157377_10428149 3300014745 Bacteria 908
50 Ga0157377_10529443 3300014745 Unclassified 829
51 Ga0157376_10908757 3300014969 Bacteria 899
52 Ga0163161_10000022 3300017792 Bacteria 207890
53 Ga0207682_10000018 3300025893 Bacteria 66215
54 Ga0207642_10000002 3300025899 Bacteria 658166
55 Ga0207685_10000005 3300025905 Bacteria 289944
56 Ga0207707_10036749 3300025912 Bacteria 4282
57 Ga0207695_10294420 3300025913 Bacteria 1515
58 Ga0207660_10025221 3300025917 Bacteria 4034
59 Ga0207652_10000371 3300025921 Bacteria 46723
60 Ga0207694_10000004 3300025924 Bacteria 967075
61 Ga0207687_10001467 3300025927 Bacteria 16198
62 Ga0207706_10395294 3300025933 Bacteria 1199
63 Ga0207670_10036018 3300025936 Bacteria 3215
64 Ga0207669_10000001 3300025937 Bacteria 377747
65 Ga0207661_10033030 3300025944 Bacteria 4014
66 Ga0207661_10485478 3300025944 Bacteria 1128
67 Ga0207679_10104858 3300025945 Bacteria 2219
68 Ga0207640_10005989 3300025981 Bacteria 6645
69 Ga0207678_10322068 3300026067 Bacteria 1330
70 Ga0207708_10096886 3300026075 Bacteria 2280
71 Ga0207708_10127228 3300026075 Bacteria 1989
72 Ga0207702_10670517 3300026078 Unclassified 1021
73 Ga0207641_10000016 3300026088 Bacteria 307363
74 Ga0207675_100866182 3300026118 Bacteria 919
75 Ga0207698_11874169 3300026142 Bacteria 614
76 Ga0268266_10472697 3300028379 Bacteria 1194
77 Ga0307511_10045873 3300030521 Bacteria 3605
78 Ga0373933_1118060 3300035724 Bacteria 519
79 Ga0373937_0036567 3300036401 Bacteria 4475
80 Ga0373937_1611068 3300036401 Bacteria 596
81 Ga0373937_1671923 3300036401 Bacteria 583
82 Ga0451804_0755401 3300041463 Bacteria 562
83 Ga0451807_2590042 3300041486 Bacteria 886
84 Ga0451853_1636938 3300041512 Unclassified 1019
85 Ga0451853_2679834 3300041512 Bacteria 9437
86 Ga0466960_0822665 3300044901 Bacteria 563
87 Ga0466967_0175588 3300045976 Bacteria 2018
88 Ga0466967_1167374 3300045976 Bacteria 767
89 Ga0466967_1448276 3300045976 Unclassified 684
90 Ga0495592_0000688 3300046454 Bacteria 23534
91 Ga0495592_0250895 3300046454 Bacteria 1169
92 Ga0495603_0000033 3300046455 Bacteria 57940
93 Ga0495603_0007880 3300046455 Bacteria 6423
94 Ga0495591_051576 3300046458 Unclassified 1122
95 Ga0495629_0061189 3300046459 Bacteria 2631
96 Ga0495629_0092576 3300046459 Bacteria 2110
97 Ga0495629_0380910 3300046459 Bacteria 960
98 Ga0495641_0000014 3300046461 Bacteria 140908
99 Ga0495641_0035272 3300046461 Bacteria 2360
100 Ga0495641_0505417 3300046461 Bacteria 551
101 Ga0495651_0267574 3300046462 Bacteria 1160
102 Ga0495653_0267938 3300046463 Bacteria 1126
103 Ga0495639_0005458 3300046475 Bacteria 5474
104 Ga0495594_0182995 3300046499 Bacteria 1193
105 Ga0495608_0072886 3300046511 Bacteria 2240
106 Ga0495608_0225672 3300046511 Bacteria 1174
107 Ga0495618_0000070 3300046514 Bacteria 72312
108 Ga0495618_0586164 3300046514 Unclassified 665
109 Ga0495620_0000215 3300046515 Bacteria 43539
110 Ga0495620_0058192 3300046515 Bacteria 1619
111 Ga0495628_0055861 3300046516 Bacteria 3109
112 Ga0495628_0198521 3300046516 Bacteria 1512
113 Ga0495628_0687727 3300046516 Unclassified 723
114 Ga0495630_0103698 3300046517 Bacteria 2152
115 Ga0495630_0242740 3300046517 Bacteria 1376
116 Ga0495652_0000010 3300046529 Bacteria 261584
117 Ga0495652_0007462 3300046529 Bacteria 10079
118 Ga0495586_0006455 3300046535 Bacteria 6264
119 Ga0495586_0112977 3300046535 Bacteria 1513
120 Ga0495587_0417747 3300046536 Bacteria 745
121 Ga0495587_0504655 3300046536 Bacteria 669
122 Ga0495598_0004462 3300046537 Bacteria 3031
123 Ga0495621_0002501 3300046539 Bacteria 4954
124 Ga0495645_0006133 3300046543 Bacteria 8318
125 Ga0495645_0045277 3300046543 Bacteria 3210
126 Ga0495645_0180770 3300046543 Bacteria 1445
127 Ga0495667_0699104 3300046559 Unclassified 628
128 Ga0495656_0001136 3300046615 Bacteria 8648
129 Ga0495668_0024540 3300046616 Bacteria 3429
130 Ga0495634_0001402 3300046642 Bacteria 21621
131 Ga0495634_0028701 3300046642 Bacteria 3860
132 Ga0495634_0196339 3300046642 Bacteria 1256
133 Ga0495635_0000074 3300046663 Bacteria 62264
134 Ga0495657_0004097 3300046675 Bacteria 11689
135 Ga0495599_0133562 3300046678 Bacteria 1541
136 Ga0495599_0531028 3300046678 Unclassified 690
137 Ga0495623_0137565 3300046679 Bacteria 1456
138 Ga0495623_0539630 3300046679 Bacteria 612
139 Ga0495646_0303540 3300046680 Bacteria 844
140 Ga0495646_0409486 3300046680 Unclassified 704
141 Ga0495647_0000023 3300046681 Bacteria 67025
142 Ga0495658_0338722 3300046683 Unclassified 955
143 Ga0495669_0116660 3300046684 Bacteria 1249
144 Ga0495613_0000220 3300046689 Bacteria 55692
145 Ga0495624_0000071 3300046690 Bacteria 65995
146 Ga0495600_0069424 3300046809 Bacteria 2303
147 Ga0495600_0157085 3300046809 Bacteria 1471
148 Ga0495604_0000095 3300047317 Bacteria 75922
149 Ga0495604_0073094 3300047317 Bacteria 2589
150 Ga0495604_0127451 3300047317 Bacteria 1833
151 Ga0495674_1421600 3300047319 Bacteria 516
152 Ga0495676_0000136 3300047321 Bacteria 55706
153 Ga0495680_0000472 3300047322 Bacteria 45335
154 Ga0495680_0000486 3300047322 Bacteria 44707
155 Ga0495679_019804 3300047446 Bacteria 2356
156 Ga0495685_004050 3300047447 Bacteria 4714
157 Ga0495593_0537049 3300047673 Unclassified 586
158 Ga0496100_0452244 3300048903 Bacteria 985
159 Ga0496102_0724972 3300048905 Bacteria 917
160 Ga0496106_0000795 3300048909 Bacteria 22795
161 Ga0496107_0012674 3300048910 Bacteria 5887
162 Ga0496108_1189767 3300048911 Bacteria 645
163 Ga0496110_0372979 3300048913 Bacteria 1300
164 Ga0496110_0446674 3300048913 Unclassified 1178
165 Ga0496110_1328756 3300048913 Unclassified 628
166 Ga0496111_0050802 3300048914 Bacteria 2992
167 Ga0496111_0942061 3300048914 Unclassified 621
168 Ga0496112_0000006 3300048915 Bacteria 365227
169 Ga0496112_0627936 3300048915 Bacteria 1005
170 Ga0496112_1788059 3300048915 Unclassified 526
171 Ga0496113_0003344 3300048916 Bacteria 9576
172 Ga0496113_0060661 3300048916 Bacteria 2852
173 Ga0496113_0435636 3300048916 Unclassified 1053
174 Ga0496114_0012163 3300048917 Bacteria 6887
175 Ga0501038_0260192 3300049574 Bacteria 1372
176 Ga0501039_1316735 3300049575 Unclassified 557
177 Ga0501040_1007063 3300049576 Unclassified 604
178 Ga0501072_0022645 3300049588 Bacteria 4874
179 Ga0501081_0831157 3300049743 Bacteria 696
180 Ga0501045_0675633 3300049824 Unclassified 763
181 Ga0501045_1301821 3300049824 Unclassified 529
182 nmdc:mga0a205_13_c1 3300050515 Bacteria 111131
183 nmdc:mga0a205_337_c1 3300050515 Bacteria 35228
184 Ga0495601_0064383 3300053077 Bacteria 2331
185 Ga0495601_0289919 3300053077 Bacteria 1067
186 Ga0495601_0294604 3300053077 Bacteria 1057
187 Ga0495612_0014700 3300053078 Bacteria 3144
188 Ga0495595_0001245 3300053084 Bacteria 9923
189 Ga0495595_0305177 3300053084 Unclassified 801
190 Ga0495619_0001158 3300053085 Bacteria 17318
191 Ga0495619_0008332 3300053085 Bacteria 6553
192 Ga0495619_0029041 3300053085 Bacteria 3571
193 Ga0500614_000077 3300053123 Bacteria 21548

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100001735 Ga0070711_1000017356 98
2 3300046517 Ga0495630_0242740 Ga0495630_0242740_754_1200 103
3 3300035724 Ga0373933_1118060 Ga0373933_1118060_188_508 105
4 3300036401 Ga0373937_1611068 Ga0373937_1611068_264_584 105
5 3300048915 Ga0496112_0000006 Ga0496112_0000006_100795_101202 107
6 3300046458 Ga0495591_051576 Ga0495591_051576_115_489 118
7 3300013307 Ga0157372_10958330 Ga0157372_109583302 119
8 3300005329 Ga0070683_100052375 Ga0070683_1000523753 122
9 3300005535 Ga0070684_100027070 Ga0070684_1000270706 122
10 3300025944 Ga0207661_10033030 Ga0207661_100330303 122
11 3300044901 Ga0466960_0822665 Ga0466960_0822665_14_385 122
12 3300046539 Ga0495621_0002501 Ga0495621_0002501_2836_3234 122
13 3300048916 Ga0496113_0003344 Ga0496113_0003344_4366_4764 122
14 3300013297 Ga0157378_11925131 Ga0157378_119251311 123
15 3300000546 LJNas_1027697 LJNas_10276972 124
16 3300005329 Ga0070683_100172659 Ga0070683_1001726591 124
17 3300005331 Ga0070670_101483571 Ga0070670_1014835711 124
18 3300005333 Ga0070677_10000037 Ga0070677_1000003734 124
19 3300005334 Ga0068869_101480607 Ga0068869_1014806071 124
20 3300005336 Ga0070680_100177949 Ga0070680_1001779492 124
21 3300005341 Ga0070691_10000908 Ga0070691_1000090812 124
22 3300005341 Ga0070691_10464391 Ga0070691_104643912 124
23 3300005356 Ga0070674_100192074 Ga0070674_1001920741 124
24 3300005441 Ga0070700_100068765 Ga0070700_1000687653 124
25 3300005441 Ga0070700_100094352 Ga0070700_1000943524 124
26 3300005455 Ga0070663_100303359 Ga0070663_1003033592 124
27 3300005458 Ga0070681_10048239 Ga0070681_100482394 124
28 3300005458 Ga0070681_11159005 Ga0070681_111590051 124
29 3300005530 Ga0070679_100000181 Ga0070679_10000018119 124
30 3300005535 Ga0070684_100133202 Ga0070684_1001332023 124
31 3300005535 Ga0070684_100206548 Ga0070684_1002065483 124
32 3300005549 Ga0070704_101316881 Ga0070704_1013168811 124
33 3300005564 Ga0070664_100189530 Ga0070664_1001895303 124
34 3300005577 Ga0068857_100345023 Ga0068857_1003450233 124
35 3300005578 Ga0068854_100023409 Ga0068854_1000234094 124
36 3300005614 Ga0068856_100265813 Ga0068856_1002658133 124
37 3300005616 Ga0068852_101919584 Ga0068852_1019195841 124
38 3300005618 Ga0068864_100000015 Ga0068864_10000001567 124
39 3300005718 Ga0068866_10000003 Ga0068866_10000003156 124
40 3300005719 Ga0068861_100938001 Ga0068861_1009380012 124
41 3300005841 Ga0068863_100001530 Ga0068863_10000153017 124
42 3300006163 Ga0070715_10000001 Ga0070715_10000001700 124
43 3300006237 Ga0097621_100188925 Ga0097621_1001889252 124
44 3300006237 Ga0097621_100881549 Ga0097621_1008815492 124
45 3300006852 Ga0075433_10000002 Ga0075433_1000000290 124
46 3300006852 Ga0075433_10014316 Ga0075433_100143168 124
47 3300009093 Ga0105240_10862410 Ga0105240_108624102 124
48 3300009098 Ga0105245_10002179 Ga0105245_1000217913 124
49 3300009098 Ga0105245_10207925 Ga0105245_102079253 124
50 3300009176 Ga0105242_10105713 Ga0105242_101057131 124
51 3300009553 Ga0105249_12266553 Ga0105249_122665532 124
52 3300011119 Ga0105246_10871031 Ga0105246_108710312 124
53 3300013296 Ga0157374_10335824 Ga0157374_103358242 124
54 3300013297 Ga0157378_10880211 Ga0157378_108802112 124
55 3300013308 Ga0157375_11751904 Ga0157375_117519041 124
56 3300014325 Ga0163163_10291739 Ga0163163_102917393 124
57 3300014325 Ga0163163_12361932 Ga0163163_123619321 124
58 3300014745 Ga0157377_10428149 Ga0157377_104281492 124
59 3300014745 Ga0157377_10529443 Ga0157377_105294432 124
60 3300014969 Ga0157376_10908757 Ga0157376_109087572 124
61 3300017792 Ga0163161_10000022 Ga0163161_10000022117 124
62 3300025893 Ga0207682_10000018 Ga0207682_1000001863 124
63 3300025899 Ga0207642_10000002 Ga0207642_10000002408 124
64 3300025905 Ga0207685_10000005 Ga0207685_1000000531 124
65 3300025912 Ga0207707_10036749 Ga0207707_100367494 124
66 3300025913 Ga0207695_10294420 Ga0207695_102944203 124
67 3300025917 Ga0207660_10025221 Ga0207660_100252212 124
68 3300025921 Ga0207652_10000371 Ga0207652_1000037128 124
69 3300025924 Ga0207694_10000004 Ga0207694_10000004110 124
70 3300025927 Ga0207687_10001467 Ga0207687_1000146710 124
71 3300025933 Ga0207706_10395294 Ga0207706_103952942 124
72 3300025936 Ga0207670_10036018 Ga0207670_100360186 124
73 3300025937 Ga0207669_10000001 Ga0207669_10000001134 124
74 3300025944 Ga0207661_10485478 Ga0207661_104854782 124
75 3300025945 Ga0207679_10104858 Ga0207679_101048583 124
76 3300025981 Ga0207640_10005989 Ga0207640_100059894 124
77 3300026067 Ga0207678_10322068 Ga0207678_103220682 124
78 3300026075 Ga0207708_10096886 Ga0207708_100968863 124
79 3300026075 Ga0207708_10127228 Ga0207708_101272284 124
80 3300026078 Ga0207702_10670517 Ga0207702_106705172 124
81 3300026088 Ga0207641_10000016 Ga0207641_1000001626 124
82 3300026118 Ga0207675_100866182 Ga0207675_1008661822 124
83 3300026142 Ga0207698_11874169 Ga0207698_118741691 124
84 3300028379 Ga0268266_10472697 Ga0268266_104726972 124
85 3300030521 Ga0307511_10045873 Ga0307511_100458733 124
86 3300036401 Ga0373937_0036567 Ga0373937_0036567_3814_4188 124
87 3300036401 Ga0373937_1671923 Ga0373937_1671923_83_457 124
88 3300041463 Ga0451804_0755401 Ga0451804_0755401_124_498 124
89 3300041486 Ga0451807_2590042 Ga0451807_2590042_111_485 124
90 3300041512 Ga0451853_1636938 Ga0451853_1636938_66_440 124
91 3300041512 Ga0451853_2679834 Ga0451853_2679834_4824_5198 124
92 3300045976 Ga0466967_0175588 Ga0466967_0175588_1249_1623 124
93 3300045976 Ga0466967_1167374 Ga0466967_1167374_230_604 124
94 3300045976 Ga0466967_1448276 Ga0466967_1448276_144_521 124
95 3300046454 Ga0495592_0000688 Ga0495592_0000688_6686_7060 124
96 3300046454 Ga0495592_0250895 Ga0495592_0250895_158_535 124
97 3300046455 Ga0495603_0000033 Ga0495603_0000033_12002_12382 124
98 3300046455 Ga0495603_0007880 Ga0495603_0007880_454_828 124
99 3300046459 Ga0495629_0061189 Ga0495629_0061189_1150_1524 124
100 3300046459 Ga0495629_0092576 Ga0495629_0092576_381_758 124
101 3300046459 Ga0495629_0380910 Ga0495629_0380910_348_722 124
102 3300046461 Ga0495641_0000014 Ga0495641_0000014_52549_52923 124
103 3300046461 Ga0495641_0035272 Ga0495641_0035272_1788_2165 124
104 3300046461 Ga0495641_0505417 Ga0495641_0505417_141_515 124
105 3300046462 Ga0495651_0267574 Ga0495651_0267574_195_599 124
106 3300046463 Ga0495653_0267938 Ga0495653_0267938_312_686 124
107 3300046475 Ga0495639_0005458 Ga0495639_0005458_602_976 124
108 3300046499 Ga0495594_0182995 Ga0495594_0182995_809_1183 124
109 3300046511 Ga0495608_0072886 Ga0495608_0072886_768_1142 124
110 3300046511 Ga0495608_0225672 Ga0495608_0225672_397_771 124
111 3300046514 Ga0495618_0000070 Ga0495618_0000070_55950_56324 124
112 3300046514 Ga0495618_0586164 Ga0495618_0586164_173_547 124
113 3300046515 Ga0495620_0000215 Ga0495620_0000215_8499_8873 124
114 3300046515 Ga0495620_0058192 Ga0495620_0058192_1179_1553 124
115 3300046516 Ga0495628_0055861 Ga0495628_0055861_140_514 124
116 3300046516 Ga0495628_0198521 Ga0495628_0198521_751_1125 124
117 3300046516 Ga0495628_0687727 Ga0495628_0687727_86_463 124
118 3300046517 Ga0495630_0103698 Ga0495630_0103698_1165_1539 124
119 3300046529 Ga0495652_0000010 Ga0495652_0000010_92814_93188 124
120 3300046529 Ga0495652_0007462 Ga0495652_0007462_3882_4259 124
121 3300046535 Ga0495586_0006455 Ga0495586_0006455_5687_6061 124
122 3300046535 Ga0495586_0112977 Ga0495586_0112977_122_496 124
123 3300046536 Ga0495587_0417747 Ga0495587_0417747_309_683 124
124 3300046536 Ga0495587_0504655 Ga0495587_0504655_98_472 124
125 3300046537 Ga0495598_0004462 Ga0495598_0004462_1865_2239 124
126 3300046543 Ga0495645_0006133 Ga0495645_0006133_3069_3443 124
127 3300046543 Ga0495645_0045277 Ga0495645_0045277_1635_2009 124
128 3300046543 Ga0495645_0180770 Ga0495645_0180770_784_1161 124
129 3300046559 Ga0495667_0699104 Ga0495667_0699104_180_554 124
130 3300046615 Ga0495656_0001136 Ga0495656_0001136_2097_2474 124
131 3300046616 Ga0495668_0024540 Ga0495668_0024540_2253_2627 124
132 3300046642 Ga0495634_0001402 Ga0495634_0001402_19523_19897 124
133 3300046642 Ga0495634_0028701 Ga0495634_0028701_3081_3455 124
134 3300046642 Ga0495634_0196339 Ga0495634_0196339_347_721 124
135 3300046663 Ga0495635_0000074 Ga0495635_0000074_39852_40226 124
136 3300046675 Ga0495657_0004097 Ga0495657_0004097_8432_8806 124
137 3300046678 Ga0495599_0133562 Ga0495599_0133562_322_699 124
138 3300046678 Ga0495599_0531028 Ga0495599_0531028_142_516 124
139 3300046679 Ga0495623_0137565 Ga0495623_0137565_211_588 124
140 3300046679 Ga0495623_0539630 Ga0495623_0539630_32_409 124
141 3300046680 Ga0495646_0303540 Ga0495646_0303540_177_554 124
142 3300046680 Ga0495646_0409486 Ga0495646_0409486_43_417 124
143 3300046681 Ga0495647_0000023 Ga0495647_0000023_6131_6505 124
144 3300046683 Ga0495658_0338722 Ga0495658_0338722_159_533 124
145 3300046684 Ga0495669_0116660 Ga0495669_0116660_273_647 124
146 3300046689 Ga0495613_0000220 Ga0495613_0000220_38819_39193 124
147 3300046690 Ga0495624_0000071 Ga0495624_0000071_52303_52677 124
148 3300046809 Ga0495600_0069424 Ga0495600_0069424_205_579 124
149 3300046809 Ga0495600_0157085 Ga0495600_0157085_468_842 124
150 3300047317 Ga0495604_0000095 Ga0495604_0000095_50231_50605 124
151 3300047317 Ga0495604_0073094 Ga0495604_0073094_1404_1793 124
152 3300047317 Ga0495604_0127451 Ga0495604_0127451_883_1257 124
153 3300047319 Ga0495674_1421600 Ga0495674_1421600_94_468 124
154 3300047321 Ga0495676_0000136 Ga0495676_0000136_13734_14108 124
155 3300047322 Ga0495680_0000472 Ga0495680_0000472_40520_40924 124
156 3300047322 Ga0495680_0000486 Ga0495680_0000486_29714_30088 124
157 3300047446 Ga0495679_019804 Ga0495679_019804_1466_1840 124
158 3300047447 Ga0495685_004050 Ga0495685_004050_2801_3175 124
159 3300047673 Ga0495593_0537049 Ga0495593_0537049_118_492 124
160 3300048903 Ga0496100_0452244 Ga0496100_0452244_310_684 124
161 3300048905 Ga0496102_0724972 Ga0496102_0724972_233_610 124
162 3300048909 Ga0496106_0000795 Ga0496106_0000795_6600_6974 124
163 3300048910 Ga0496107_0012674 Ga0496107_0012674_1619_1993 124
164 3300048911 Ga0496108_1189767 Ga0496108_1189767_203_577 124
165 3300048913 Ga0496110_0372979 Ga0496110_0372979_658_1032 124
166 3300048913 Ga0496110_0446674 Ga0496110_0446674_326_700 124
167 3300048913 Ga0496110_1328756 Ga0496110_1328756_146_520 124
168 3300048914 Ga0496111_0050802 Ga0496111_0050802_835_1209 124
169 3300048914 Ga0496111_0942061 Ga0496111_0942061_225_599 124
170 3300048915 Ga0496112_0627936 Ga0496112_0627936_413_787 124
171 3300048915 Ga0496112_1788059 Ga0496112_1788059_27_401 124
172 3300048916 Ga0496113_0060661 Ga0496113_0060661_473_847 124
173 3300048916 Ga0496113_0435636 Ga0496113_0435636_599_973 124
174 3300048917 Ga0496114_0012163 Ga0496114_0012163_3520_3894 124
175 3300049574 Ga0501038_0260192 Ga0501038_0260192_128_502 124
176 3300049575 Ga0501039_1316735 Ga0501039_1316735_65_439 124
177 3300049576 Ga0501040_1007063 Ga0501040_1007063_37_411 124
178 3300049588 Ga0501072_0022645 Ga0501072_0022645_2391_2765 124
179 3300049743 Ga0501081_0831157 Ga0501081_0831157_244_618 124
180 3300049824 Ga0501045_0675633 Ga0501045_0675633_102_476 124
181 3300049824 Ga0501045_1301821 Ga0501045_1301821_127_501 124
182 3300050515 nmdc:mga0a205_13_c1 nmdc:mga0a205_13_c1_80525_80935 124
183 3300050515 nmdc:mga0a205_337_c1 nmdc:mga0a205_337_c1_14998_15372 124
184 3300053077 Ga0495601_0064383 Ga0495601_0064383_360_734 124
185 3300053077 Ga0495601_0289919 Ga0495601_0289919_201_575 124
186 3300053077 Ga0495601_0294604 Ga0495601_0294604_192_569 124
187 3300053078 Ga0495612_0014700 Ga0495612_0014700_1478_1852 124
188 3300053084 Ga0495595_0001245 Ga0495595_0001245_7355_7756 124
189 3300053084 Ga0495595_0305177 Ga0495595_0305177_250_624 124
190 3300053085 Ga0495619_0001158 Ga0495619_0001158_6317_6718 124
191 3300053085 Ga0495619_0008332 Ga0495619_0008332_1247_1621 124
192 3300053085 Ga0495619_0029041 Ga0495619_0029041_2607_2981 124
193 3300053123 Ga0500614_000077 Ga0500614_000077_17525_17899 124

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sws-assembly3.cif.gz_E-2 the dbb dimerization domain of b-cell adaptor for pi3k (bcap) is required for down regulation of inflammatory signalling through the toll-like receptor pathway 0.7289 46 122
2dmb-assembly1.cif.gz_A solution structure of the 15th filamin domain from human filamin-b 0.7271 28 123
5nok-assembly1.cif.gz_A polysaccharide lyase baccell_00875 0.7217 31 124
5nok-assembly2.cif.gz_B polysaccharide lyase baccell_00875 0.7097 30 122
6eja-assembly1.cif.gz_A human xylosyltransferase 1 in complex with peptide qeeeysgggqgg 0.7049 31 122
ID Description Score Start End Superfamily
af_U4PBJ9_364_449_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7892 45 123 2.60.40.10
2pn5A01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7483 46 124 2.60.40.2950
af_A0A2R8PZ02_60_151_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.743 53 122 2.60.40.10
af_X1WHE3_1930_2017_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7404 53 120 2.60.40.10
af_Q9VEN1_1126_1224_1.10.418.10 Mainly Alpha;Orthogonal Bundle;Actin-binding Protein, T-fimbrin; domain 1;Calponin-like domain 0.7311 31 122 1.10.418.10
ID Description Score Start End GO Terms
AF-A0A537YM86-F1-model_v4 Excalibur calcium-binding domain-containing protein 0.9683 30 123
AF-A0A822JHG9-F1-model_v4 VWFA domain-containing protein 0.8493 49 124
AF-A0A399WZA2-F1-model_v4 Serine/threonine-protein kinase 0.8433 55 121 GO:0004674
GO:0005524
AF-A0A401ZWT8-F1-model_v4 Ig-like domain-containing protein 0.8407 31 124 GO:0016020
AF-A0A5C7PMC5-F1-model_v4 Metallophosphoesterase 0.8338 29 122 GO:0005737
GO:0016787

Feature Viewer

pLDDT pTM Quality
85.37 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map