F296351

General Info

Members Datasets Scaffolds Average Seq Length
192 146 384 166

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0010934|Ga0500616_0010934_1099_1701
Length 200
Sequence MSYYKYLIIVWNDFRNHHPDPIIHSKNDDMKRFAIKTKKHLLFLLMITGAIAASAQDTREDKNAAKKEAIKTMINTQQYVFRAQSVQPLSAATRQLTSEYDLGITKEKITSYLPYFGRAYSAPINTSQGGIQFTSTSFEYTASDRKKGGWEVLIKPKDAPEVQQLNLTISEDGYATLNVTSTNRQPISFTGVIEAPKAKK

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
108 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
112 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
113 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
114 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
115 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
116 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
117 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
118 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
119 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
120 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
121 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
122 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
123 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 2739367656 Pedobacter sp. CF523 Isolate Unclassified
138 2739367663 Pedobacter sp. YR510 Isolate Unclassified
139 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
140 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
141 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
142 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
143 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
144 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
145 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
146 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 1.56
Isolates 5.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 0
Rhizoplane 0.52
Rhizosphere 79.69
Stem 0
Stem Tuber 0
Unclassified 14.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0010934 3300053153 Bacteria 5401
2 JGI25158J39367_1015454 3300002739 Bacteria 975
3 JGI25153J46596_10012509 3300003215 Bacteria 3656
4 Ga0006777J48905_1016279 3300003308 Bacteria 608
5 rootL2_10115208 3300003322 Bacteria 3299
6 rootL2_10273644 3300003322 Bacteria 1206
7 rootH1_10073631 3300003323 Bacteria 1777
8 rootH1_10272970 3300003323 Unclassified 2027
9 JGI25160J50197_1022426 3300003354 Bacteria 1851
10 JGI25160J50197_1022688 3300003354 Bacteria 1833
11 Ga0065165_1070723 3300005262 Bacteria 928
12 Ga0065714_10095713 3300005288 Bacteria 1779
13 Ga0065714_10143524 3300005288 Bacteria 1154
14 Ga0065714_10209461 3300005288 Bacteria 871
15 Ga0065712_10035861 3300005290 Bacteria 874
16 Ga0065715_10333103 3300005293 Bacteria 980
17 Ga0070676_10172147 3300005328 Unclassified 1401
18 Ga0070683_100018684 3300005329 Bacteria 6143
19 Ga0070683_100376218 3300005329 Bacteria 1353
20 Ga0070670_100072916 3300005331 Bacteria 2949
21 Ga0070670_100387767 3300005331 Bacteria 1231
22 Ga0070670_100626942 3300005331 Bacteria 963
23 Ga0068869_100100354 3300005334 Bacteria 2189
24 Ga0068868_100834658 3300005338 Bacteria 834
25 Ga0068868_101138890 3300005338 Bacteria 719
26 Ga0070661_100068318 3300005344 Bacteria 2611
27 Ga0070675_100514479 3300005354 Bacteria 1080
28 Ga0070671_100263192 3300005355 Bacteria 1466
29 Ga0070674_100053694 3300005356 Bacteria 2783
30 Ga0070674_100113397 3300005356 Unclassified 1994
31 Ga0070673_100895361 3300005364 Unclassified 823
32 Ga0070667_100454700 3300005367 Bacteria 1170
33 Ga0068867_100059494 3300005459 Unclassified 2832
34 Ga0070684_100044249 3300005535 Bacteria 3850
35 Ga0068853_100015659 3300005539 Bacteria 6228
36 Ga0070693_100694858 3300005547 Bacteria 744
37 Ga0070664_100058824 3300005564 Bacteria 3269
38 Ga0068857_100000742 3300005577 Bacteria 24324
39 Ga0068857_100347489 3300005577 Bacteria 1373
40 Ga0068854_100022432 3300005578 Bacteria 4301
41 Ga0068856_100019005 3300005614 Bacteria 6667
42 Ga0068856_100132235 3300005614 Bacteria 2500
43 Ga0070702_100163435 3300005615 Bacteria 1441
44 Ga0070702_101205348 3300005615 Unclassified 610
45 Ga0068852_100000354 3300005616 Bacteria 30827
46 Ga0068852_100070139 3300005616 Bacteria 3074
47 Ga0068852_100102642 3300005616 Bacteria 2584
48 Ga0068859_100017565 3300005617 Bacteria 7193
49 Ga0068866_10318629 3300005718 Unclassified 977
50 Ga0068860_102434939 3300005843 Unclassified 543
51 Ga0070716_100639203 3300006173 Bacteria 805
52 Ga0097620_100017565 3300006931 Bacteria 7193
53 Ga0105240_10000384 3300009093 Bacteria 82999
54 Ga0105240_10019551 3300009093 Bacteria 9046
55 Ga0105240_10114065 3300009093 Unclassified 3265
56 Ga0111539_10156579 3300009094 Bacteria 2666
57 Ga0105241_10252026 3300009174 Bacteria 1497
58 Ga0105241_11217969 3300009174 Unclassified 714
59 Ga0105242_12253206 3300009176 Bacteria 590
60 Ga0105237_10014183 3300009545 Bacteria 8344
61 Ga0105237_11123086 3300009545 Unclassified 793
62 Ga0105238_10008419 3300009551 Bacteria 10325
63 Ga0105238_10053431 3300009551 Bacteria 4059
64 Ga0105238_10111492 3300009551 Bacteria 2716
65 Ga0105239_10153756 3300010375 Bacteria 2568
66 Ga0157371_10017918 3300013102 Bacteria 5250
67 Ga0157371_10140997 3300013102 Bacteria 1717
68 Ga0157371_10176292 3300013102 Bacteria 1528
69 Ga0157370_10011454 3300013104 Bacteria 9271
70 Ga0157370_10520059 3300013104 Bacteria 1092
71 Ga0157369_10208812 3300013105 Bacteria 2047
72 Ga0157374_10085845 3300013296 Bacteria 2994
73 Ga0157374_10119472 3300013296 Bacteria 2542
74 Ga0163162_10185152 3300013306 Bacteria 2209
75 Ga0157372_10000367 3300013307 Bacteria 50024
76 Ga0157372_10157071 3300013307 Unclassified 2627
77 Ga0157372_10215266 3300013307 Bacteria 2226
78 Ga0157372_10357515 3300013307 Bacteria 1702
79 Ga0157372_10567826 3300013307 Unclassified 1322
80 Ga0157372_10720323 3300013307 Unclassified 1160
81 Ga0163163_10005937 3300014325 Bacteria 10629
82 Ga0157377_10264207 3300014745 Bacteria 1121
83 Ga0157376_10785159 3300014969 Bacteria 964
84 Ga0182005_1000241 3300015265 Bacteria 35027
85 Ga0163161_10130770 3300017792 Bacteria 1893
86 Ga0209436_103563 3300025208 Bacteria 4088
87 Ga0209646_1000091 3300025246 Bacteria 188727
88 Ga0209026_1001535 3300025250 Bacteria 10059
89 Ga0207426_1000251 3300025302 Bacteria 117462
90 Ga0207426_1013963 3300025302 Bacteria 2958
91 Ga0207426_1091209 3300025302 Bacteria 806
92 Ga0207656_10242950 3300025321 Unclassified 880
93 Ga0207647_10006329 3300025904 Bacteria 8612
94 Ga0207695_10000027 3300025913 Bacteria 612456
95 Ga0207695_10076070 3300025913 Bacteria 3414
96 Ga0207657_10295039 3300025919 Bacteria 1285
97 Ga0207694_10083115 3300025924 Bacteria 2518
98 Ga0207694_10097655 3300025924 Bacteria 2324
99 Ga0207694_10876376 3300025924 Unclassified 759
100 Ga0207650_10007247 3300025925 Bacteria 7553
101 Ga0207650_10684440 3300025925 Bacteria 866
102 Ga0207644_10347980 3300025931 Bacteria 1203
103 Ga0207686_11396166 3300025934 Unclassified 576
104 Ga0207669_10286990 3300025937 Unclassified 1244
105 Ga0207669_10406035 3300025937 Bacteria 1068
106 Ga0207665_10942447 3300025939 Unclassified 686
107 Ga0207689_10262313 3300025942 Bacteria 1429
108 Ga0207661_10091993 3300025944 Bacteria 2528
109 Ga0207661_10139144 3300025944 Bacteria 2088
110 Ga0207679_10202076 3300025945 Bacteria 1661
111 Ga0207667_10000230 3300025949 Bacteria 77858
112 Ga0207640_10238345 3300025981 Bacteria 1404
113 Ga0207658_10012665 3300025986 Bacteria 5760
114 Ga0207658_10576062 3300025986 Bacteria 1009
115 Ga0207639_10043636 3300026041 Bacteria 3368
116 Ga0207678_11252187 3300026067 Bacteria 657
117 Ga0207702_10046676 3300026078 Bacteria 3647
118 Ga0207702_10108074 3300026078 Bacteria 2468
119 Ga0207648_10005628 3300026089 Bacteria 12591
120 Ga0207676_10413194 3300026095 Bacteria 1264
121 Ga0207674_10013343 3300026116 Bacteria 9123
122 Ga0207674_10244215 3300026116 Bacteria 1742
123 Ga0207675_100410926 3300026118 Bacteria 1335
124 Ga0207683_11050881 3300026121 Bacteria 756
125 Ga0207698_10028308 3300026142 Bacteria 3993
126 Ga0207698_10084639 3300026142 Bacteria 2572
127 Ga0207698_10797777 3300026142 Unclassified 946
128 Ga0268265_11116538 3300028380 Unclassified 783
129 Ga0268264_10005238 3300028381 Bacteria 10977
130 Ga0307511_10004266 3300030521 Bacteria 14598
131 Ga0307516_10062836 3300031730 Bacteria 3597
132 Ga0307414_10051261 3300032004 Bacteria 2864
133 Ga0395905_0119154 3300037471 Bacteria 2481
134 Ga0451804_0862716 3300041463 Unclassified 759
135 Ga0453683_0033347 3300044673 Bacteria 3247
136 Ga0466970_0087959 3300044765 Bacteria 1685
137 Ga0466957_0013674 3300044842 Bacteria 4712
138 Ga0466957_0058989 3300044842 Bacteria 2352
139 Ga0451576_0551049 3300045051 Unclassified 1211
140 Ga0495638_0517218 3300046460 Unclassified 598
141 Ga0495616_0001378 3300046513 Bacteria 16928
142 Ga0495643_0028732 3300046522 Bacteria 3115
143 Ga0495634_0145511 3300046642 Bacteria 1502
144 Ga0495611_0220136 3300046648 Bacteria 883
145 Ga0495625_0050292 3300046660 Bacteria 2991
146 Ga0495672_0071087 3300047320 Unclassified 1970
147 Ga0496121_0000011 3300048924 Bacteria 792193
148 Ga0496125_0248238 3300048928 Bacteria 1125
149 Ga0495678_109462 3300049459 Bacteria 944
150 Ga0495682_0167294 3300049460 Bacteria 783
151 Ga0501294_015364 3300049517 Bacteria 790
152 Ga0501298_022705 3300049521 Bacteria 1184
153 Ga0501043_0314314 3300049579 Bacteria 1195
154 Ga0501043_0458182 3300049579 Bacteria 957
155 Ga0501047_0012069 3300049581 Bacteria 8177
156 Ga0501201_000212 3300049651 Bacteria 5135
157 Ga0501202_011085 3300049652 Bacteria 1684
158 Ga0501209_127572 3300049656 Bacteria 758
159 Ga0501222_002521 3300049662 Bacteria 2534
160 Ga0501233_004374 3300049668 Bacteria 2588
161 Ga0501235_020494 3300049669 Bacteria 1468
162 Ga0501256_019977 3300049685 Bacteria 697
163 Ga0501261_000871 3300049690 Bacteria 3741
164 Ga0501221_060694 3300049704 Bacteria 873
165 Ga0501234_005208 3300049707 Bacteria 2035
166 Ga0501245_000477 3300049708 Bacteria 4858
167 Ga0501268_019627 3300049765 Bacteria 1146
168 Ga0501270_072489 3300049767 Bacteria 669
169 Ga0501044_0188725 3300049823 Unclassified 2025
170 Ga0501044_0746875 3300049823 Bacteria 861
171 Ga0501212_010808 3300049851 Bacteria 1307
172 Ga0500641_0059738 3300053096 Bacteria 1586
173 Ga0500562_000096 3300053108 Bacteria 33894
174 Ga0500652_157724 3300053131 Bacteria 939
175 Ga0500568_0075348 3300053139 Bacteria 1286
176 Ga0500622_0001378 3300053156 Bacteria 19589
177 Ga0500627_0237765 3300053158 Bacteria 809
178 Ga0500637_0099940 3300053178 Bacteria 1683
179 Ga0500611_000081 3300053727 Bacteria 29777
180 Ga0500645_012268 3300053730 Bacteria 2771
181 Ga0587073_0034577 3300059492 Bacteria 1066
182 Ga0587098_005906 3300059604 Unclassified 1221
183 2739614588 2739367656 Bacteria 5152243
184 2739646445 2739367663 Bacteria 5040914
185 2819576142 2818991442 Bacteria 8318214
186 2819679933 2818991460 Bacteria 7595395
187 2821142371 2821136567 Bacteria 8080116
188 2884794488 2884791551 Bacteria 8511252
189 2904470462 2904467357 Bacteria 8057758
190 2919441236 2919437846 Bacteria 6199444
191 2929926130 2929921140 Bacteria 8649150
192 8003151853 8003151029 Bacteria 8187759
193 Ga0500616_0010934
194 JGI25158J39367_1015454
195 JGI25153J46596_10012509
196 Ga0006777J48905_1016279
197 rootL2_10115208
198 rootL2_10273644
199 rootH1_10073631
200 rootH1_10272970
201 JGI25160J50197_1022426
202 JGI25160J50197_1022688
203 Ga0065165_1070723
204 Ga0065714_10095713
205 Ga0065714_10143524
206 Ga0065714_10209461
207 Ga0065712_10035861
208 Ga0065715_10333103
209 Ga0070676_10172147
210 Ga0070683_100018684
211 Ga0070683_100376218
212 Ga0070670_100072916
213 Ga0070670_100387767
214 Ga0070670_100626942
215 Ga0068869_100100354
216 Ga0068868_100834658
217 Ga0068868_101138890
218 Ga0070661_100068318
219 Ga0070675_100514479
220 Ga0070671_100263192
221 Ga0070674_100053694
222 Ga0070674_100113397
223 Ga0070673_100895361
224 Ga0070667_100454700
225 Ga0068867_100059494
226 Ga0070684_100044249
227 Ga0068853_100015659
228 Ga0070693_100694858
229 Ga0070664_100058824
230 Ga0068857_100000742
231 Ga0068857_100347489
232 Ga0068854_100022432
233 Ga0068856_100019005
234 Ga0068856_100132235
235 Ga0070702_100163435
236 Ga0070702_101205348
237 Ga0068852_100000354
238 Ga0068852_100070139
239 Ga0068852_100102642
240 Ga0068859_100017565
241 Ga0068866_10318629
242 Ga0068860_102434939
243 Ga0070716_100639203
244 Ga0097620_100017565
245 Ga0105240_10000384
246 Ga0105240_10019551
247 Ga0105240_10114065
248 Ga0111539_10156579
249 Ga0105241_10252026
250 Ga0105241_11217969
251 Ga0105242_12253206
252 Ga0105237_10014183
253 Ga0105237_11123086
254 Ga0105238_10008419
255 Ga0105238_10053431
256 Ga0105238_10111492
257 Ga0105239_10153756
258 Ga0157371_10017918
259 Ga0157371_10140997
260 Ga0157371_10176292
261 Ga0157370_10011454
262 Ga0157370_10520059
263 Ga0157369_10208812
264 Ga0157374_10085845
265 Ga0157374_10119472
266 Ga0163162_10185152
267 Ga0157372_10000367
268 Ga0157372_10157071
269 Ga0157372_10215266
270 Ga0157372_10357515
271 Ga0157372_10567826
272 Ga0157372_10720323
273 Ga0163163_10005937
274 Ga0157377_10264207
275 Ga0157376_10785159
276 Ga0182005_1000241
277 Ga0163161_10130770
278 Ga0209436_103563
279 Ga0209646_1000091
280 Ga0209026_1001535
281 Ga0207426_1000251
282 Ga0207426_1013963
283 Ga0207426_1091209
284 Ga0207656_10242950
285 Ga0207647_10006329
286 Ga0207695_10000027
287 Ga0207695_10076070
288 Ga0207657_10295039
289 Ga0207694_10083115
290 Ga0207694_10097655
291 Ga0207694_10876376
292 Ga0207650_10007247
293 Ga0207650_10684440
294 Ga0207644_10347980
295 Ga0207686_11396166
296 Ga0207669_10286990
297 Ga0207669_10406035
298 Ga0207665_10942447
299 Ga0207689_10262313
300 Ga0207661_10091993
301 Ga0207661_10139144
302 Ga0207679_10202076
303 Ga0207667_10000230
304 Ga0207640_10238345
305 Ga0207658_10012665
306 Ga0207658_10576062
307 Ga0207639_10043636
308 Ga0207678_11252187
309 Ga0207702_10046676
310 Ga0207702_10108074
311 Ga0207648_10005628
312 Ga0207676_10413194
313 Ga0207674_10013343
314 Ga0207674_10244215
315 Ga0207675_100410926
316 Ga0207683_11050881
317 Ga0207698_10028308
318 Ga0207698_10084639
319 Ga0207698_10797777
320 Ga0268265_11116538
321 Ga0268264_10005238
322 Ga0307511_10004266
323 Ga0307516_10062836
324 Ga0307414_10051261
325 Ga0395905_0119154
326 Ga0451804_0862716
327 Ga0453683_0033347
328 Ga0466970_0087959
329 Ga0466957_0013674
330 Ga0466957_0058989
331 Ga0451576_0551049
332 Ga0495638_0517218
333 Ga0495616_0001378
334 Ga0495643_0028732
335 Ga0495634_0145511
336 Ga0495611_0220136
337 Ga0495625_0050292
338 Ga0495672_0071087
339 Ga0496121_0000011
340 Ga0496125_0248238
341 Ga0495678_109462
342 Ga0495682_0167294
343 Ga0501294_015364
344 Ga0501298_022705
345 Ga0501043_0314314
346 Ga0501043_0458182
347 Ga0501047_0012069
348 Ga0501201_000212
349 Ga0501202_011085
350 Ga0501209_127572
351 Ga0501222_002521
352 Ga0501233_004374
353 Ga0501235_020494
354 Ga0501256_019977
355 Ga0501261_000871
356 Ga0501221_060694
357 Ga0501234_005208
358 Ga0501245_000477
359 Ga0501268_019627
360 Ga0501270_072489
361 Ga0501044_0188725
362 Ga0501044_0746875
363 Ga0501212_010808
364 Ga0500641_0059738
365 Ga0500562_000096
366 Ga0500652_157724
367 Ga0500568_0075348
368 Ga0500622_0001378
369 Ga0500627_0237765
370 Ga0500637_0099940
371 Ga0500611_000081
372 Ga0500645_012268
373 Ga0587073_0034577
374 Ga0587098_005906
375 2739614588
376 2739646445
377 2819576142
378 2819679933
379 2821142371
380 2884794488
381 2904470462
382 2919441236
383 2929926130
384 8003151853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14059

DUF4251

Domain of unknown function (DUF4251)

61

193

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fyf-assembly1.cif.gz_A crystal structure of uncharacterized protein bvu_3222 from bacteroides vulgatus 0.8152 18 157
3fyf-assembly1.cif.gz_B crystal structure of uncharacterized protein bvu_3222 from bacteroides vulgatus 0.7983 18 157
4gdz-assembly1.cif.gz_A-3 crystal structure of a duf4251 family protein (bacegg_02002) from bacteroides eggerthii dsm 20697 at 1.95 a resolution 0.7688 23 157
3pcr-assembly1.cif.gz_A structure of espg-arf6 complex 0.7413 104 154
3fyf-assembly1.cif.gz_A crystal structure of uncharacterized protein bvu_3222 from bacteroides vulgatus 0.7366 18 157
ID Description Score Start End Superfamily
3fyfB00 Mainly Beta;Beta Barrel;Lipocalin; 0.7983 18 157 2.40.128.410
4gdzA00 Mainly Beta;Beta Barrel;Lipocalin; 0.766 23 157 2.40.128.410
af_O06149_1_140_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7209 101 147 2.40.380.10
4gdzA00 Mainly Beta;Beta Barrel;Lipocalin; 0.6909 23 157 2.40.128.410
af_A0A1D8PU19_36_325_3.40.50.10480 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Brix domain 0.672 102 133 3.40.50.10480
ID Description Score Start End GO Terms
AF-A0A4Q3R3T4-F1-model_v4 DUF4251 domain-containing protein 0.9269 93 158
AF-A0A4Q3W214-F1-model_v4 DUF4251 domain-containing protein 0.9136 94 158
AF-A0A1G8D7P8-F1-model_v4 DUF4251 domain-containing protein 0.9111 18 164
AF-A0A179DME6-F1-model_v4 DUF4251 domain-containing protein 0.9111 18 158
AF-A0A1G9YQ82-F1-model_v4 DUF4251 domain-containing protein 0.9107 19 159

Map