F296183

General Info

Members Datasets Scaffolds Average Seq Length
192 131 384 228

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000772|Ga0495686_0000772_33820_34506
Length 216
Sequence MNPALIALLQLADTALPIGGYAHSSGLETYVQKGLVYNVATATLFVNQMLTRNLKYTDAAMVSLAYDAVQAGDTARLIELDHLCSAIKIPSETRSASTKTGIRLMKIFEPLVKFEMMEGYHSIAFGLCGFHLNISKIDLLTAYYFNAAAGYITNCVKLVPLGQQDGQKILFNLHNLINELAMDTLNPDESLLGLCCVGFDLRCMQHERLYSRLYMS

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
119 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
120 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
128 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
129 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
130 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
131 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 0
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000772 3300047472 Bacteria 42035
2 rootH1_10021978 3300003316 Bacteria 2631
3 rootH2_10196403 3300003320 Bacteria 1922
4 rootL2_10186223 3300003322 Bacteria 1113
5 rootH1_10017533 3300003323 Bacteria 16023
6 Ga0070658_10088299 3300005327 Unclassified 2553
7 Ga0070676_10140226 3300005328 Bacteria 1538
8 Ga0070683_100068208 3300005329 Bacteria 3314
9 Ga0070683_100105989 3300005329 Bacteria 2650
10 Ga0070683_100940970 3300005329 Unclassified 829
11 Ga0070670_100045418 3300005331 Bacteria 3777
12 Ga0070670_100086266 3300005331 Bacteria 2697
13 Ga0068869_100023334 3300005334 Bacteria 4271
14 Ga0068869_100040787 3300005334 Bacteria 3321
15 Ga0070666_10000143 3300005335 Bacteria 48999
16 Ga0070682_100206217 3300005337 Bacteria 1390
17 Ga0070661_100041828 3300005344 Bacteria 3344
18 Ga0070668_100323879 3300005347 Bacteria 1298
19 Ga0070669_100206071 3300005353 Bacteria 1549
20 Ga0070675_100118392 3300005354 Bacteria 2249
21 Ga0070671_100281502 3300005355 Unclassified 1414
22 Ga0070674_100415645 3300005356 Unclassified 1102
23 Ga0070673_100159377 3300005364 Bacteria 1918
24 Ga0070659_100000092 3300005366 Bacteria 67270
25 Ga0070667_100033490 3300005367 Bacteria 4295
26 Ga0070667_100298734 3300005367 Unclassified 1450
27 Ga0070667_100794905 3300005367 Unclassified 878
28 Ga0070678_100322163 3300005456 Unclassified 1320
29 Ga0070681_10074851 3300005458 Bacteria 3347
30 Ga0068867_100037582 3300005459 Unclassified 3519
31 Ga0068867_100276725 3300005459 Bacteria 1375
32 Ga0070698_100062288 3300005471 Bacteria 3763
33 Ga0070679_100033074 3300005530 Bacteria 5118
34 Ga0070684_100041000 3300005535 Bacteria 3989
35 Ga0070684_100351164 3300005535 Bacteria 1356
36 Ga0068853_100012917 3300005539 Bacteria 6806
37 Ga0068853_100120334 3300005539 Bacteria 2341
38 Ga0070672_100085617 3300005543 Bacteria 2533
39 Ga0070665_100320113 3300005548 Bacteria 1555
40 Ga0068855_100041804 3300005563 Bacteria 5432
41 Ga0068855_100303942 3300005563 Bacteria 1766
42 Ga0070664_100003686 3300005564 Bacteria 12355
43 Ga0070664_100217606 3300005564 Bacteria 1708
44 Ga0070664_100272748 3300005564 Bacteria 1524
45 Ga0068852_100023151 3300005616 Bacteria 4994
46 Ga0068852_100024466 3300005616 Bacteria 4881
47 Ga0068852_100028248 3300005616 Bacteria 4587
48 Ga0068859_100000099 3300005617 Bacteria 80240
49 Ga0068859_100040239 3300005617 Bacteria 4692
50 Ga0068859_100169759 3300005617 Bacteria 2262
51 Ga0068864_100007566 3300005618 Bacteria 8950
52 Ga0068866_10004944 3300005718 Bacteria 5483
53 Ga0068851_10005726 3300005834 Bacteria 5654
54 Ga0068863_100041413 3300005841 Bacteria 4380
55 Ga0068863_100170874 3300005841 Bacteria 2085
56 Ga0068858_100026082 3300005842 Bacteria 5433
57 Ga0068860_100001298 3300005843 Bacteria 27144
58 Ga0068860_100015212 3300005843 Bacteria 7517
59 Ga0068860_100300904 3300005843 Bacteria 1571
60 Ga0068862_100116499 3300005844 Bacteria 2350
61 Ga0097621_100057843 3300006237 Bacteria 3172
62 Ga0068865_100201541 3300006881 Bacteria 1545
63 Ga0097620_100000099 3300006931 Bacteria 80240
64 Ga0097620_100040237 3300006931 Bacteria 4692
65 Ga0097620_100169758 3300006931 Bacteria 2262
66 Ga0105240_10160416 3300009093 Bacteria 2671
67 Ga0105240_10234184 3300009093 Bacteria 2132
68 Ga0105240_10279448 3300009093 Bacteria 1919
69 Ga0105247_10013926 3300009101 Bacteria 4823
70 Ga0114129_10001547 3300009147 Bacteria 31199
71 Ga0105241_10000397 3300009174 Bacteria 32881
72 Ga0105241_10071428 3300009174 Bacteria 2695
73 Ga0105242_10107694 3300009176 Bacteria 2371
74 Ga0105242_10191484 3300009176 Unclassified 1811
75 Ga0105248_11028766 3300009177 Bacteria 931
76 Ga0105237_10018207 3300009545 Bacteria 7270
77 Ga0105237_10069600 3300009545 Bacteria 3514
78 Ga0105237_10146809 3300009545 Bacteria 2353
79 Ga0105249_10320427 3300009553 Unclassified 1561
80 Ga0105249_10432792 3300009553 Bacteria 1352
81 Ga0105239_10000512 3300010375 Bacteria 56021
82 Ga0105239_10029751 3300010375 Bacteria 6005
83 Ga0105246_10355400 3300011119 Bacteria 1202
84 Ga0157373_10250881 3300013100 Bacteria 1252
85 Ga0157370_10839127 3300013104 Bacteria 835
86 Ga0157369_10019928 3300013105 Bacteria 7500
87 Ga0157369_10686974 3300013105 Bacteria 1054
88 Ga0157374_10054844 3300013296 Bacteria 3719
89 Ga0157374_10420336 3300013296 Unclassified 1335
90 Ga0157374_10589489 3300013296 Bacteria 1121
91 Ga0163162_10102334 3300013306 Bacteria 2957
92 Ga0163162_10282273 3300013306 Bacteria 1792
93 Ga0157372_10138133 3300013307 Bacteria 2807
94 Ga0157372_10459054 3300013307 Bacteria 1485
95 Ga0157372_11043936 3300013307 Bacteria 946
96 Ga0157372_11447747 3300013307 Unclassified 792
97 Ga0157375_10037242 3300013308 Bacteria 4659
98 Ga0157375_10054960 3300013308 Unclassified 3923
99 Ga0157375_10281478 3300013308 Bacteria 1826
100 Ga0163163_10007941 3300014325 Bacteria 9383
101 Ga0163163_10294060 3300014325 Bacteria 1676
102 Ga0157379_10100889 3300014968 Bacteria 2591
103 Ga0157379_10101642 3300014968 Bacteria 2580
104 Ga0209646_1001491 3300025246 Bacteria 6230
105 Ga0207642_10358152 3300025899 Unclassified 863
106 Ga0207710_10020430 3300025900 Bacteria 2831
107 Ga0207680_10000096 3300025903 Bacteria 40670
108 Ga0207705_10176746 3300025909 Bacteria 1609
109 Ga0207654_10000240 3300025911 Bacteria 33102
110 Ga0207654_10060486 3300025911 Bacteria 2213
111 Ga0207695_10012638 3300025913 Bacteria 10115
112 Ga0207671_10001586 3300025914 Bacteria 25838
113 Ga0207671_10165792 3300025914 Bacteria 1713
114 Ga0207649_10218795 3300025920 Bacteria 1355
115 Ga0207681_10529324 3300025923 Unclassified 968
116 Ga0207650_10016070 3300025925 Bacteria 5224
117 Ga0207659_10455250 3300025926 Bacteria 1078
118 Ga0207644_10446379 3300025931 Unclassified 1062
119 Ga0207690_10000309 3300025932 Bacteria 33416
120 Ga0207709_10593448 3300025935 Bacteria 876
121 Ga0207669_10173269 3300025937 Unclassified 1538
122 Ga0207691_10103320 3300025940 Bacteria 2541
123 Ga0207711_10840119 3300025941 Unclassified 855
124 Ga0207689_10001706 3300025942 Bacteria 20803
125 Ga0207689_10052978 3300025942 Bacteria 3342
126 Ga0207661_10374286 3300025944 Unclassified 1288
127 Ga0207679_10005034 3300025945 Bacteria 8258
128 Ga0207679_10183314 3300025945 Bacteria 1734
129 Ga0207667_10064210 3300025949 Bacteria 3834
130 Ga0207667_10084278 3300025949 Bacteria 3290
131 Ga0207667_10281932 3300025949 Bacteria 1698
132 Ga0207640_10790188 3300025981 Bacteria 821
133 Ga0207658_10117691 3300025986 Bacteria 2112
134 Ga0207658_10120990 3300025986 Bacteria 2087
135 Ga0207677_10155727 3300026023 Unclassified 1769
136 Ga0207703_10003309 3300026035 Bacteria 13527
137 Ga0207639_10187291 3300026041 Bacteria 1765
138 Ga0207639_10399092 3300026041 Unclassified 1239
139 Ga0207702_10032527 3300026078 Bacteria 4353
140 Ga0207641_10000998 3300026088 Bacteria 28957
141 Ga0207641_10036838 3300026088 Bacteria 4083
142 Ga0207641_10776761 3300026088 Unclassified 947
143 Ga0207648_10000937 3300026089 Bacteria 32934
144 Ga0207648_10104985 3300026089 Bacteria 2478
145 Ga0207648_10169709 3300026089 Bacteria 1928
146 Ga0207674_10013652 3300026116 Bacteria 8996
147 Ga0207674_10177173 3300026116 Bacteria 2084
148 Ga0207675_100532874 3300026118 Unclassified 1172
149 Ga0207698_10009912 3300026142 Bacteria 6094
150 Ga0268265_10095203 3300028380 Bacteria 2390
151 Ga0268265_10313425 3300028380 Unclassified 1418
152 Ga0268264_10001066 3300028381 Bacteria 27233
153 Ga0268264_10108071 3300028381 Bacteria 2431
154 Ga0268264_10221978 3300028381 Unclassified 1740
155 Ga0307515_10000024 3300028794 Bacteria 393119
156 Ga0307513_10248541 3300031456 Bacteria 1577
157 Ga0307509_10006991 3300031507 Bacteria 14957
158 Ga0307509_10082614 3300031507 Bacteria 3314
159 Ga0395900_0629968 3300037418 Bacteria 1011
160 Ga0439436_0031654 3300041404 Bacteria 1535
161 Ga0451851_0767755 3300041507 Bacteria 901
162 Ga0451843_1027650 3300041509 Bacteria 1179
163 Ga0451853_1230971 3300041512 Bacteria 1101
164 Ga0439457_001884 3300042014 Bacteria 6185
165 Ga0439462_0011768 3300042015 Bacteria 2230
166 Ga0466972_0000039 3300044658 Bacteria 135618
167 Ga0466957_0000530 3300044842 Bacteria 19237
168 Ga0466957_0002264 3300044842 Bacteria 10313
169 Ga0466960_0318457 3300044901 Unclassified 880
170 Ga0495606_0019464 3300046507 Bacteria 5051
171 Ga0495628_0639630 3300046516 Unclassified 756
172 Ga0495632_0154661 3300046519 Bacteria 1059
173 Ga0495668_0002991 3300046616 Bacteria 13196
174 Ga0495611_0035111 3300046648 Bacteria 2220
175 Ga0495672_0045747 3300047320 Unclassified 2616
176 Ga0495686_0022375 3300047472 Bacteria 4184
177 Ga0501243_010342 3300049675 Bacteria 1456
178 Ga0501251_015900 3300049681 Bacteria 951
179 Ga0501225_0000064 3300049705 Bacteria 34604
180 nmdc:mga05p37_5921_c1 3300050507 Bacteria 14385
181 Ga0500578_0000034 3300053086 Bacteria 136582
182 Ga0500578_0014371 3300053086 Bacteria 5092
183 Ga0500644_0065792 3300053088 Bacteria 1292
184 Ga0500646_0018150 3300053090 Bacteria 1851
185 Ga0500583_0000063 3300053092 Bacteria 66256
186 Ga0500583_0018858 3300053092 Bacteria 2814
187 Ga0500604_0011858 3300053151 Bacteria 2347
188 Ga0500616_0007156 3300053153 Bacteria 7137
189 Ga0500622_0066134 3300053156 Bacteria 1836
190 Ga0500636_0203595 3300053177 Bacteria 1045
191 Ga0500611_000013 3300053727 Bacteria 135447
192 2738727166 2738541278 Bacteria 9755573
193 Ga0495686_0000772
194 rootH1_10021978
195 rootH2_10196403
196 rootL2_10186223
197 rootH1_10017533
198 Ga0070658_10088299
199 Ga0070676_10140226
200 Ga0070683_100068208
201 Ga0070683_100105989
202 Ga0070683_100940970
203 Ga0070670_100045418
204 Ga0070670_100086266
205 Ga0068869_100023334
206 Ga0068869_100040787
207 Ga0070666_10000143
208 Ga0070682_100206217
209 Ga0070661_100041828
210 Ga0070668_100323879
211 Ga0070669_100206071
212 Ga0070675_100118392
213 Ga0070671_100281502
214 Ga0070674_100415645
215 Ga0070673_100159377
216 Ga0070659_100000092
217 Ga0070667_100033490
218 Ga0070667_100298734
219 Ga0070667_100794905
220 Ga0070678_100322163
221 Ga0070681_10074851
222 Ga0068867_100037582
223 Ga0068867_100276725
224 Ga0070698_100062288
225 Ga0070679_100033074
226 Ga0070684_100041000
227 Ga0070684_100351164
228 Ga0068853_100012917
229 Ga0068853_100120334
230 Ga0070672_100085617
231 Ga0070665_100320113
232 Ga0068855_100041804
233 Ga0068855_100303942
234 Ga0070664_100003686
235 Ga0070664_100217606
236 Ga0070664_100272748
237 Ga0068852_100023151
238 Ga0068852_100024466
239 Ga0068852_100028248
240 Ga0068859_100000099
241 Ga0068859_100040239
242 Ga0068859_100169759
243 Ga0068864_100007566
244 Ga0068866_10004944
245 Ga0068851_10005726
246 Ga0068863_100041413
247 Ga0068863_100170874
248 Ga0068858_100026082
249 Ga0068860_100001298
250 Ga0068860_100015212
251 Ga0068860_100300904
252 Ga0068862_100116499
253 Ga0097621_100057843
254 Ga0068865_100201541
255 Ga0097620_100000099
256 Ga0097620_100040237
257 Ga0097620_100169758
258 Ga0105240_10160416
259 Ga0105240_10234184
260 Ga0105240_10279448
261 Ga0105247_10013926
262 Ga0114129_10001547
263 Ga0105241_10000397
264 Ga0105241_10071428
265 Ga0105242_10107694
266 Ga0105242_10191484
267 Ga0105248_11028766
268 Ga0105237_10018207
269 Ga0105237_10069600
270 Ga0105237_10146809
271 Ga0105249_10320427
272 Ga0105249_10432792
273 Ga0105239_10000512
274 Ga0105239_10029751
275 Ga0105246_10355400
276 Ga0157373_10250881
277 Ga0157370_10839127
278 Ga0157369_10019928
279 Ga0157369_10686974
280 Ga0157374_10054844
281 Ga0157374_10420336
282 Ga0157374_10589489
283 Ga0163162_10102334
284 Ga0163162_10282273
285 Ga0157372_10138133
286 Ga0157372_10459054
287 Ga0157372_11043936
288 Ga0157372_11447747
289 Ga0157375_10037242
290 Ga0157375_10054960
291 Ga0157375_10281478
292 Ga0163163_10007941
293 Ga0163163_10294060
294 Ga0157379_10100889
295 Ga0157379_10101642
296 Ga0209646_1001491
297 Ga0207642_10358152
298 Ga0207710_10020430
299 Ga0207680_10000096
300 Ga0207705_10176746
301 Ga0207654_10000240
302 Ga0207654_10060486
303 Ga0207695_10012638
304 Ga0207671_10001586
305 Ga0207671_10165792
306 Ga0207649_10218795
307 Ga0207681_10529324
308 Ga0207650_10016070
309 Ga0207659_10455250
310 Ga0207644_10446379
311 Ga0207690_10000309
312 Ga0207709_10593448
313 Ga0207669_10173269
314 Ga0207691_10103320
315 Ga0207711_10840119
316 Ga0207689_10001706
317 Ga0207689_10052978
318 Ga0207661_10374286
319 Ga0207679_10005034
320 Ga0207679_10183314
321 Ga0207667_10064210
322 Ga0207667_10084278
323 Ga0207667_10281932
324 Ga0207640_10790188
325 Ga0207658_10117691
326 Ga0207658_10120990
327 Ga0207677_10155727
328 Ga0207703_10003309
329 Ga0207639_10187291
330 Ga0207639_10399092
331 Ga0207702_10032527
332 Ga0207641_10000998
333 Ga0207641_10036838
334 Ga0207641_10776761
335 Ga0207648_10000937
336 Ga0207648_10104985
337 Ga0207648_10169709
338 Ga0207674_10013652
339 Ga0207674_10177173
340 Ga0207675_100532874
341 Ga0207698_10009912
342 Ga0268265_10095203
343 Ga0268265_10313425
344 Ga0268264_10001066
345 Ga0268264_10108071
346 Ga0268264_10221978
347 Ga0307515_10000024
348 Ga0307513_10248541
349 Ga0307509_10006991
350 Ga0307509_10082614
351 Ga0395900_0629968
352 Ga0439436_0031654
353 Ga0451851_0767755
354 Ga0451843_1027650
355 Ga0451853_1230971
356 Ga0439457_001884
357 Ga0439462_0011768
358 Ga0466972_0000039
359 Ga0466957_0000530
360 Ga0466957_0002264
361 Ga0466960_0318457
362 Ga0495606_0019464
363 Ga0495628_0639630
364 Ga0495632_0154661
365 Ga0495668_0002991
366 Ga0495611_0035111
367 Ga0495672_0045747
368 Ga0495686_0022375
369 Ga0501243_010342
370 Ga0501251_015900
371 Ga0501225_0000064
372 nmdc:mga05p37_5921_c1
373 Ga0500578_0000034
374 Ga0500578_0014371
375 Ga0500644_0065792
376 Ga0500646_0018150
377 Ga0500583_0000063
378 Ga0500583_0018858
379 Ga0500604_0011858
380 Ga0500616_0007156
381 Ga0500622_0066134
382 Ga0500636_0203595
383 Ga0500611_000013
384 2738727166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

36

174

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o1q-assembly1.cif.gz_A native crystal structure of helicobacter pylori urease accessory protein uref 0.9002 6 205
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.8977 6 205
3o1q-assembly2.cif.gz_B native crystal structure of helicobacter pylori urease accessory protein uref 0.8944 6 205
8hc1-assembly1.cif.gz_H cryoem structure of helicobacter pylori urefd/urease complex 0.8912 6 228
4hi0-assembly1.cif.gz_C crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.881 6 228
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9399 4 205 1.10.4190.10
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9224 4 205 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8915 6 205 1.10.4190.10
3sf5C00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8834 6 228 1.10.4190.10
3sf5C00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.858 6 228 1.10.4190.10
ID Description Score Start End GO Terms
AF-A0A382B8F3-F1-model_v4 Uncharacterized protein 0.9581 27 170 GO:0016151
AF-A0A2V6SR27-F1-model_v4 Uncharacterized protein 0.9458 27 194 GO:0016151
AF-B3TCF4-F1-model_v4 Putative UreF 0.9427 24 226 GO:0016020
GO:0016151
AF-A0A7T2CWI1-F1-model_v4 deleted 0.9417 28 228
AF-F4PG09-F1-model_v4 Urease accessory protein UreE 0.9412 16 194 GO:0005737
GO:0006457
GO:0016151
GO:0019627
GO:0065003

Map