F294967

General Info

Members Datasets Scaffolds Average Seq Length
192 145 385 260

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10046884|rootL2_100468843
Length 251
Sequence MDSGIGLLAAAAAVRRLRPDADLVLSFDPEGMPWGPRTPEDLTARALDVAEAAAKHTPDALIVGCNTATVHALPALRARLEPGIPVIGTVPAIKPAPLAIWATPATTGSPYQRGLIRDFADGVDVAEVPCWGLAEAVEHADEPAIAAAITAAAALTPDDVTAVVLGCTHYEFLAERIRTALQRPGRPPLVLHASADAVAAQALRRIGAAPAPDAPATGGLTVLLNGREGVLPDAAFAYAEGRALPVPTPAS

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
7 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
8 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
9 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
10 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
11 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
12 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
13 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
14 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
15 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
16 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
17 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
18 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
19 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
20 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
21 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
22 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
23 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
24 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
25 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
26 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
27 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
28 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
29 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
30 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
31 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
32 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
33 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
34 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
35 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
36 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
37 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
38 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
39 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
40 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
41 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
42 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
43 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
44 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
45 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
46 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
47 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
48 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
49 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
50 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
51 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
52 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
53 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
54 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
55 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
56 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
57 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
58 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
59 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
60 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
61 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
62 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
78 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
79 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
80 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
81 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
82 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
83 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
84 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
85 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
86 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
91 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
92 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
93 2643221548 Streptomyces sp. Root55 Isolate Unclassified
94 2643221578 Streptomyces sp. Root63 Isolate Unclassified
95 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
96 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
97 2643221670 Streptomyces sp. Root431 Isolate Unclassified
98 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
99 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
100 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
101 2643221714 Streptomyces sp. Root264 Isolate Unclassified
102 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
103 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
104 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
105 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
106 2808606448 Streptomyces sp. 193411 Isolate Unclassified
107 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
108 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
109 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
110 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
111 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
112 2862574272 Streptomyces sp. AcE210 Isolate Nodule
113 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
114 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
115 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
116 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
117 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
118 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
119 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
120 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
121 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
122 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
123 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
124 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
125 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
126 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
127 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
128 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
129 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
130 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
131 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
132 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
133 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
134 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
135 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
136 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
137 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
138 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
139 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
140 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
141 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
142 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
143 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
144 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
145 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.83
Metatranscriptomes 0
Isolates 29.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 1.56
Rhizoplane 1.04
Rhizosphere 67.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10046884 3300003322 Bacteria 2170
2 rootH1_10005316 3300003316 Bacteria 26575
3 rootH1_10050119 3300003316 Bacteria 1503
4 rootH1_10050119 3300003323 Bacteria 1217
5 rootH2_10082400 3300003320 Bacteria 4356
6 rootH1_10022283 3300003323 Bacteria 2339
7 Ga0070670_100432677 3300005331 Bacteria 1164
8 Ga0183367_1003 3300015688 Bacteria 814276
9 Ga0207426_1001919 3300025302 Bacteria 15001
10 Ga0207426_1007475 3300025302 Bacteria 4570
11 Ga0207426_1007775 3300025302 Bacteria 4440
12 Ga0207426_1013522 3300025302 Bacteria 3021
13 Ga0207667_10143734 3300025949 Bacteria 2456
14 Ga0307515_10000189 3300028794 Bacteria 150703
15 Ga0307511_10025087 3300030521 Bacteria 5504
16 Ga0307512_10002811 3300030522 Bacteria 21215
17 Ga0307512_10034566 3300030522 Bacteria 4322
18 Ga0307509_10031328 3300031507 Bacteria 5872
19 Ga0307509_10117747 3300031507 Bacteria 2642
20 Ga0307508_10029735 3300031616 Bacteria 4937
21 Ga0307508_10034103 3300031616 Bacteria 4590
22 Ga0307508_10208670 3300031616 Bacteria 1554
23 Ga0307514_10016289 3300031649 Bacteria 6123
24 Ga0307514_10042971 3300031649 Bacteria 3551
25 Ga0307409_100523412 3300031995 Bacteria 1159
26 Ga0307507_10022648 3300033179 Bacteria 6929
27 Ga0307507_10096729 3300033179 Bacteria 2495
28 Ga0307510_10001095 3300033180 Bacteria 28880
29 Ga0439449_0004254 3300042007 Bacteria 5535
30 Ga0450894_000068 3300042131 Bacteria 16322
31 Ga0450903_011328 3300042138 Bacteria 1438
32 Ga0466966_0020185 3300044684 Bacteria 4386
33 Ga0466966_0162556 3300044684 Bacteria 1359
34 Ga0466963_0001091 3300044694 Bacteria 14154
35 Ga0466957_0159026 3300044842 Bacteria 1466
36 Ga0466959_0053524 3300045049 Bacteria 2950
37 Ga0466967_0128077 3300045976 Bacteria 2353
38 Ga0466967_0202287 3300045976 Bacteria 1881
39 Ga0495627_052884 3300046453 Bacteria 1217
40 Ga0495603_0008045 3300046455 Bacteria 6369
41 Ga0495603_0028907 3300046455 Bacteria 3344
42 Ga0495629_0000788 3300046459 Bacteria 25587
43 Ga0495629_0001398 3300046459 Bacteria 19013
44 Ga0495629_0116859 3300046459 Bacteria 1859
45 Ga0495629_0244010 3300046459 Bacteria 1236
46 Ga0495662_0000581 3300046476 Bacteria 16842
47 Ga0495664_0000181 3300046477 Bacteria 31122
48 Ga0495585_0167140 3300046492 Bacteria 1138
49 Ga0495594_0002184 3300046499 Bacteria 10171
50 Ga0495594_0036320 3300046499 Bacteria 2687
51 Ga0495594_0151578 3300046499 Bacteria 1316
52 Ga0495618_0035641 3300046514 Bacteria 3123
53 Ga0495631_0073899 3300046518 Bacteria 1472
54 Ga0495652_0086715 3300046529 Bacteria 2569
55 Ga0495640_0023753 3300046533 Bacteria 4460
56 Ga0495640_0025672 3300046533 Bacteria 4269
57 Ga0495586_0079063 3300046535 Bacteria 1805
58 Ga0495587_0002714 3300046536 Bacteria 11811
59 Ga0495645_0074504 3300046543 Bacteria 2444
60 Ga0495622_0062738 3300046557 Bacteria 1720
61 Ga0495622_0103412 3300046557 Bacteria 1305
62 Ga0495634_0002655 3300046642 Bacteria 14694
63 Ga0495625_0016852 3300046660 Bacteria 5737
64 Ga0495635_0000197 3300046663 Bacteria 38170
65 Ga0495657_0013384 3300046675 Bacteria 6056
66 Ga0495646_0022167 3300046680 Bacteria 4007
67 Ga0495658_0009851 3300046683 Bacteria 4767
68 Ga0495613_0038191 3300046689 Bacteria 3559
69 Ga0495613_0134723 3300046689 Bacteria 1767
70 Ga0495613_0314104 3300046689 Bacteria 1082
71 Ga0495624_0059125 3300046690 Bacteria 2406
72 Ga0495671_0010225 3300046692 Bacteria 5209
73 Ga0495589_0027585 3300046794 Bacteria 2871
74 Ga0495589_0033833 3300046794 Bacteria 2565
75 Ga0495600_0002536 3300046809 Bacteria 10510
76 Ga0495581_0041500 3300047315 Bacteria 2662
77 Ga0495604_0000428 3300047317 Bacteria 37860
78 Ga0495676_0001846 3300047321 Bacteria 18590
79 Ga0495676_0002131 3300047321 Bacteria 17475
80 Ga0495676_0017143 3300047321 Bacteria 6409
81 Ga0495687_001247 3300047443 Bacteria 24230
82 Ga0495687_091291 3300047443 Bacteria 1165
83 Ga0495685_000173 3300047447 Bacteria 21718
84 Ga0495685_001762 3300047447 Bacteria 6678
85 Ga0495685_012471 3300047447 Bacteria 2880
86 Ga0495681_0001705 3300047470 Bacteria 16276
87 Ga0495686_0145168 3300047472 Bacteria 1397
88 Ga0495686_0187833 3300047472 Bacteria 1193
89 Ga0495593_0008186 3300047673 Bacteria 6083
90 Ga0495602_0022182 3300048088 Bacteria 6223
91 Ga0495614_0001142 3300048089 Bacteria 11399
92 Ga0495614_0006057 3300048089 Bacteria 5436
93 Ga0496108_0397093 3300048911 Bacteria 1204
94 Ga0501032_0020152 3300049569 Bacteria 4649
95 Ga0501032_0087475 3300049569 Bacteria 2069
96 Ga0501033_0001513 3300049570 Bacteria 20575
97 Ga0501033_0036183 3300049570 Bacteria 3701
98 Ga0501033_0059220 3300049570 Bacteria 2828
99 Ga0501034_0036174 3300049571 Bacteria 5003
100 Ga0501034_0046027 3300049571 Bacteria 4408
101 Ga0501036_0000960 3300049572 Bacteria 21733
102 Ga0501036_0319450 3300049572 Bacteria 1297
103 Ga0501038_0003408 3300049574 Bacteria 14821
104 Ga0501038_0015256 3300049574 Bacteria 6984
105 Ga0501038_0018756 3300049574 Bacteria 6246
106 Ga0501039_0002407 3300049575 Bacteria 13911
107 Ga0501039_0100814 3300049575 Bacteria 2254
108 Ga0501039_0302755 3300049575 Bacteria 1257
109 Ga0501042_0071645 3300049578 Bacteria 2479
110 Ga0501043_0002503 3300049579 Bacteria 15533
111 Ga0501043_0002899 3300049579 Bacteria 14323
112 Ga0501043_0008828 3300049579 Bacteria 7934
113 Ga0501043_0043125 3300049579 Bacteria 3546
114 Ga0501047_0011990 3300049581 Bacteria 8201
115 Ga0501047_0045469 3300049581 Bacteria 4246
116 Ga0501047_0092121 3300049581 Bacteria 2909
117 Ga0501047_0092370 3300049581 Bacteria 2905
118 Ga0501069_0117411 3300049585 Bacteria 1518
119 Ga0501070_0127056 3300049586 Bacteria 2107
120 Ga0501035_0003105 3300049822 Bacteria 15957
121 Ga0501035_0072939 3300049822 Bacteria 3037
122 Ga0501044_0007563 3300049823 Bacteria 11945
123 Ga0501045_0364525 3300049824 Bacteria 1075
124 Ga0495655_0000854 3300053083 Bacteria 4744
125 Ga0500640_010193 3300053095 Bacteria 3789
126 Ga0500654_102218 3300053099 Bacteria 1217
127 Ga0500660_030004 3300053100 Bacteria 2842
128 Ga0500553_036075 3300053101 Bacteria 2447
129 Ga0500572_022130 3300053111 Bacteria 1692
130 Ga0500614_013957 3300053123 Bacteria 1772
131 Ga0500614_014655 3300053123 Bacteria 1740
132 Ga0500628_067720 3300053129 Bacteria 887
133 Ga0500561_0003529 3300053137 Bacteria 2748
134 Ga0500600_0018903 3300053149 Bacteria 4148
135 Ga0500616_0015152 3300053153 Bacteria 4414
136 Ga0500634_0036346 3300053161 Bacteria 2681
137 Ga0501084_0394822 3300054114 Bacteria 1169
138 2585300713 2582581312 Bacteria 7308206
139 2585315351 2582581314 Bacteria 11452267
140 2616693410 2616644814 Bacteria 11555299
141 2643764219 2643221548 Bacteria 8053412
142 2643898937 2643221578 Bacteria 9213798
143 2644015617 2643221601 Bacteria 7493239
144 2644177021 2643221631 Bacteria 8168043
145 2644386199 2643221670 Bacteria 6497041
146 2644403503 2643221673 Bacteria 9196637
147 2644441999 2643221678 Bacteria 9540101
148 2644458721 2643221682 Bacteria 6743283
149 2644631611 2643221714 Bacteria 9015452
150 2785366450 2784746768 Bacteria 10036182
151 2793976997 2791355406 Bacteria 11364898
152 2804849359 2802429296 Bacteria 7227771
153 2808847068 2808606359 Bacteria 9866990
154 2809229763 2808606448 Bacteria 8656184
155 2811846620 2808606982 Bacteria 7791042
156 2819743946 2818991472 Bacteria 10089953
157 2862181020 2862178590 Bacteria 8583590
158 2862282569 2862281513 Bacteria 9621493
159 2862392060 2862382967 Bacteria 10317375
160 2862580518 2862574272 Bacteria 10567477
161 2862708433 2862705112 Bacteria 6563286
162 2863408110 2863404153 Bacteria 9672205
163 2867346756 2867346516 Bacteria 7608576
164 2873157990 2873151551 Bacteria 8625867
165 2875392255 2875391855 Bacteria 7600475
166 2877684080 2877676314 Bacteria 9512378
167 2912723210 2912715099 Bacteria 9460473
168 2912726673 2912723979 Bacteria 8557534
169 2918502104 2918501144 Bacteria 8668083
170 2919470063 2919468124 Bacteria 9133025
171 2935391412 2935390628 Bacteria 7043367
172 2946052628 2946045630 Bacteria 8527308
173 2947232522 2947224130 Bacteria 9938529
174 2966604857 2966598605 Bacteria 7676064
175 2990045422 2990044586 Bacteria 6603797
176 2997453857 2997451912 Bacteria 8492419
177 3006490932 3006486233 Bacteria 8157040
178 3006501129 3006493962 Bacteria 8825450
179 8008486893 8008485437 Bacteria 7198341
180 8008560569 8008558824 Bacteria 10610750
181 8008581218 8008574985 Bacteria 7815457
182 8025526150 8025524527 Bacteria 7197316
183 8025536250 8025530807 Bacteria 8495698
184 8047901110 8047893842 Bacteria 11723082
185 8048133808 8048127548 Bacteria 11053136
186 8048357791 8048356638 Bacteria 11044339
187 8048378049 8048369669 Bacteria 11666822
188 8048387147 8048379754 Bacteria 11877923
189 8048407232 8048406513 Bacteria 8936924
190 8054161938 8054160619 Bacteria 7783213
191 8056451643 8056447290 Bacteria 7680491
192 8056669966 8056667051 Bacteria 6953971
193 8056832828 8056829672 Bacteria 9045328
194 rootL2_10046884
195 rootH1_10005316
196 rootH1_10050119
197 rootH2_10082400
198 rootH1_10022283
199 Ga0070670_100432677
200 Ga0183367_1003
201 Ga0207426_1001919
202 Ga0207426_1007475
203 Ga0207426_1007775
204 Ga0207426_1013522
205 Ga0207667_10143734
206 Ga0307515_10000189
207 Ga0307511_10025087
208 Ga0307512_10002811
209 Ga0307512_10034566
210 Ga0307509_10031328
211 Ga0307509_10117747
212 Ga0307508_10029735
213 Ga0307508_10034103
214 Ga0307508_10208670
215 Ga0307514_10016289
216 Ga0307514_10042971
217 Ga0307409_100523412
218 Ga0307507_10022648
219 Ga0307507_10096729
220 Ga0307510_10001095
221 Ga0439449_0004254
222 Ga0450894_000068
223 Ga0450903_011328
224 Ga0466966_0020185
225 Ga0466966_0162556
226 Ga0466963_0001091
227 Ga0466957_0159026
228 Ga0466959_0053524
229 Ga0466967_0128077
230 Ga0466967_0202287
231 Ga0495627_052884
232 Ga0495603_0008045
233 Ga0495603_0028907
234 Ga0495629_0000788
235 Ga0495629_0001398
236 Ga0495629_0116859
237 Ga0495629_0244010
238 Ga0495662_0000581
239 Ga0495664_0000181
240 Ga0495585_0167140
241 Ga0495594_0002184
242 Ga0495594_0036320
243 Ga0495594_0151578
244 Ga0495618_0035641
245 Ga0495631_0073899
246 Ga0495652_0086715
247 Ga0495640_0023753
248 Ga0495640_0025672
249 Ga0495586_0079063
250 Ga0495587_0002714
251 Ga0495645_0074504
252 Ga0495622_0062738
253 Ga0495622_0103412
254 Ga0495634_0002655
255 Ga0495625_0016852
256 Ga0495635_0000197
257 Ga0495657_0013384
258 Ga0495646_0022167
259 Ga0495658_0009851
260 Ga0495613_0038191
261 Ga0495613_0134723
262 Ga0495613_0314104
263 Ga0495624_0059125
264 Ga0495671_0010225
265 Ga0495589_0027585
266 Ga0495589_0033833
267 Ga0495600_0002536
268 Ga0495581_0041500
269 Ga0495604_0000428
270 Ga0495676_0001846
271 Ga0495676_0002131
272 Ga0495676_0017143
273 Ga0495687_001247
274 Ga0495687_091291
275 Ga0495685_000173
276 Ga0495685_001762
277 Ga0495685_012471
278 Ga0495681_0001705
279 Ga0495686_0145168
280 Ga0495686_0187833
281 Ga0495593_0008186
282 Ga0495602_0022182
283 Ga0495614_0001142
284 Ga0495614_0006057
285 Ga0496108_0397093
286 Ga0501032_0020152
287 Ga0501032_0087475
288 Ga0501033_0001513
289 Ga0501033_0036183
290 Ga0501033_0059220
291 Ga0501034_0036174
292 Ga0501034_0046027
293 Ga0501036_0000960
294 Ga0501036_0319450
295 Ga0501038_0003408
296 Ga0501038_0015256
297 Ga0501038_0018756
298 Ga0501039_0002407
299 Ga0501039_0100814
300 Ga0501039_0302755
301 Ga0501042_0071645
302 Ga0501043_0002503
303 Ga0501043_0002899
304 Ga0501043_0008828
305 Ga0501043_0043125
306 Ga0501047_0011990
307 Ga0501047_0045469
308 Ga0501047_0092121
309 Ga0501047_0092370
310 Ga0501069_0117411
311 Ga0501070_0127056
312 Ga0501035_0003105
313 Ga0501035_0072939
314 Ga0501044_0007563
315 Ga0501045_0364525
316 Ga0495655_0000854
317 Ga0500640_010193
318 Ga0500654_102218
319 Ga0500660_030004
320 Ga0500553_036075
321 Ga0500572_022130
322 Ga0500614_013957
323 Ga0500614_014655
324 Ga0500628_067720
325 Ga0500561_0003529
326 Ga0500600_0018903
327 Ga0500616_0015152
328 Ga0500634_0036346
329 Ga0501084_0394822
330 2585300713
331 2585315351
332 2616693410
333 2643764219
334 2643898937
335 2644015617
336 2644177021
337 2644386199
338 2644403503
339 2644441999
340 2644458721
341 2644631611
342 2785366450
343 2793976997
344 2804849359
345 2808847068
346 2809229763
347 2811846620
348 2819743946
349 2862181020
350 2862282569
351 2862392060
352 2862580518
353 2862708433
354 2863408110
355 2867346756
356 2873157990
357 2875392255
358 2877684080
359 2912723210
360 2912726673
361 2918502104
362 2919470063
363 2935391412
364 2946052628
365 2947232522
366 2966604857
367 2990045422
368 2997453857
369 3006490932
370 3006501129
371 8008486893
372 8008560569
373 8008581218
374 8025526150
375 8025536250
376 8047901110
377 8048133808
378 8048357791
379 8048378049
380 8048387147
381 8048407232
382 8054161938
383 8056451643
384 8056669966
385 8056832828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

7

202

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jfn-assembly1.cif.gz_A crystal structure of escherichia coli glutamate racemase in complex with l- glutamate and activator udp-murnac-ala 0.8306 2 242
2jfu-assembly1.cif.gz_A crystal structure of enterococcus faecium glutamate racemase in complex with phosphate 0.8248 2 227
8eb3-assembly1.cif.gz_A crystal structure of glutamate racemase from helicobacter pylori in complex with a fragment 0.8041 2 229
2oho-assembly1.cif.gz_A structural basis for glutamate racemase inhibitor 0.803 2 218
2ohv-assembly1.cif.gz_A-2 structural basis for glutamate racemase inhibition 0.7989 2 227
ID Description Score Start End Superfamily
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9431 2 87 3.40.50.1860
2ohoB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9386 2 88 3.40.50.1860
2vvtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9369 2 88 3.40.50.1860
5hj7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9326 2 88 3.40.50.1860
af_P9WPW9_6_95_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8741 2 87 3.40.50.1860
ID Description Score Start End GO Terms
AF-A0A7K3PQN1-F1-model_v4 Glutamate racemase 0.9968 95 185 GO:0008881
AF-A0A1C6Q6G4-F1-model_v4 Glutamate racemase 0.9891 1 249 GO:0008881
GO:0009252
AF-A0A0M8QUU8-F1-model_v4 deleted 0.9881 1 249
AF-A0A1C6LNS8-F1-model_v4 Glutamate racemase 0.988 1 249 GO:0008881
GO:0009252
AF-A0A397P8X3-F1-model_v4 deleted 0.9827 1 249

Map