F294628

General Info

Members Datasets Scaffolds Average Seq Length
191 134 382 292

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0341496|Ga0496111_0341496_46_1023
Length 325
Sequence MSLALPMQRIGRDDEPEIAASLGDYVKPGTFALAAVTILASAAXXXAQEAPAEYQQVLTALGKTGDFKDNVLKVNLPRNDVKVTIAGFDTPTPFGFGGWIAFTKASDGGQVMMGDLVLLENEVNPVMSAVLDNGFDVTALHNHFFQDEPHMFYMHVHGHGAAADLARRIKPAIDLIGKGRPAVPQTSANQLDGAKLARIVGHAGEQTGAVYKITIGRDDLKMTEMGAPINARMGLNTWAAFTGSNEKAAIAGDIAMLESEVTPVLKALRQHGLEVVAIHHHMTTERPMVIFLHYWGTGPAETLASGFTAALNELGKHGGPPTNSK

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
90 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.38
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 16.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0341496 3300048914 Unclassified 1108
2 JGI24751J29686_10002779 3300002459 Bacteria 3519
3 Ga0065712_10068953 3300005290 Bacteria 8474
4 Ga0065712_10070749 3300005290 Bacteria 5740
5 Ga0065712_10083869 3300005290 Bacteria 2804
6 Ga0065712_10143404 3300005290 Bacteria 1430
7 Ga0070683_100000853 3300005329 Bacteria 22556
8 Ga0070683_100188400 3300005329 Bacteria 1958
9 Ga0070670_100006166 3300005331 Bacteria 10133
10 Ga0070670_100048230 3300005331 Bacteria 3665
11 Ga0068869_100187291 3300005334 Bacteria 1625
12 Ga0070666_10141995 3300005335 Unclassified 1673
13 Ga0070661_100003573 3300005344 Bacteria 10701
14 Ga0070668_100089172 3300005347 Bacteria 2429
15 Ga0070675_100002768 3300005354 Bacteria 13186
16 Ga0070675_100403855 3300005354 Unclassified 1219
17 Ga0070667_100055389 3300005367 Bacteria 3349
18 Ga0070713_100011340 3300005436 Bacteria 6487
19 Ga0070705_100077924 3300005440 Unclassified 2025
20 Ga0070708_100345068 3300005445 Bacteria 1403
21 Ga0070663_100044979 3300005455 Bacteria 3117
22 Ga0070678_100132007 3300005456 Bacteria 1986
23 Ga0070678_100398409 3300005456 Bacteria 1195
24 Ga0070681_10146059 3300005458 Bacteria 2294
25 Ga0068867_100022274 3300005459 Bacteria 4529
26 Ga0070685_10124548 3300005466 Bacteria 1604
27 Ga0070707_100177596 3300005468 Bacteria 2076
28 Ga0070684_100000056 3300005535 Bacteria 74448
29 Ga0070672_100014684 3300005543 Bacteria 5556
30 Ga0070686_100098436 3300005544 Bacteria 1971
31 Ga0070693_100029285 3300005547 Bacteria 3002
32 Ga0070704_100344450 3300005549 Bacteria 1256
33 Ga0068855_100455745 3300005563 Bacteria 1395
34 Ga0068859_100024154 3300005617 Bacteria 6099
35 Ga0068864_100043102 3300005618 Bacteria 3863
36 Ga0068864_100179077 3300005618 Bacteria 1937
37 Ga0068870_10163061 3300005840 Unclassified 1324
38 Ga0068858_100599719 3300005842 Unclassified 1068
39 Ga0068860_100222840 3300005843 Unclassified 1831
40 Ga0068860_100385085 3300005843 Bacteria 1385
41 Ga0068860_100738045 3300005843 Bacteria 996
42 Ga0081455_10083147 3300005937 Bacteria 2617
43 Ga0081540_1008475 3300005983 Bacteria 7178
44 Ga0070715_10112511 3300006163 Bacteria 1286
45 Ga0097621_100067675 3300006237 Unclassified 2944
46 Ga0068871_100010826 3300006358 Bacteria 6676
47 Ga0068871_100182535 3300006358 Bacteria 1804
48 Ga0075428_100009292 3300006844 Bacteria 10901
49 Ga0075430_100060118 3300006846 Archaea 3194
50 Ga0075431_100041104 3300006847 Bacteria 4767
51 Ga0075433_10005718 3300006852 Bacteria 9780
52 Ga0075433_10031938 3300006852 Unclassified 4505
53 Ga0075433_10358950 3300006852 Bacteria 1287
54 Ga0075433_10434706 3300006852 Bacteria 1157
55 Ga0075434_100010657 3300006871 Bacteria 8629
56 Ga0075434_100048524 3300006871 Bacteria 4213
57 Ga0075429_100003025 3300006880 Bacteria 14252
58 Ga0068865_100015813 3300006881 Bacteria 4816
59 Ga0075436_100001435 3300006914 Bacteria 16212
60 Ga0097620_100024154 3300006931 Bacteria 6099
61 Ga0075435_100002270 3300007076 Bacteria 12697
62 Ga0075435_100134350 3300007076 Bacteria 2071
63 Ga0099794_10000545 3300007265 Bacteria 12656
64 Ga0105240_10107850 3300009093 Bacteria 3376
65 Ga0111539_10045353 3300009094 Bacteria 5263
66 Ga0111539_10076823 3300009094 Bacteria 3932
67 Ga0111539_10130403 3300009094 Unclassified 2944
68 Ga0105245_10027931 3300009098 Bacteria 4973
69 Ga0105247_10071322 3300009101 Bacteria 2172
70 Ga0114129_10000475 3300009147 Bacteria 48344
71 Ga0114129_10002204 3300009147 Bacteria 26849
72 Ga0114129_10096521 3300009147 Bacteria 4092
73 Ga0114129_10709068 3300009147 Bacteria 1292
74 Ga0105243_10258418 3300009148 Bacteria 1558
75 Ga0105242_10002034 3300009176 Bacteria 15919
76 Ga0105248_10025519 3300009177 Bacteria 6570
77 Ga0105248_10052360 3300009177 Unclassified 4580
78 Ga0105249_10536051 3300009553 Bacteria 1220
79 Ga0105239_10066602 3300010375 Bacteria 3956
80 Ga0105246_10082308 3300011119 Bacteria 2297
81 Ga0105246_10090258 3300011119 Bacteria 2206
82 Ga0163163_10003233 3300014325 Bacteria 13819
83 Ga0163163_10056368 3300014325 Bacteria 3884
84 Ga0157380_10054288 3300014326 Bacteria 3179
85 Ga0157377_10035202 3300014745 Bacteria 2745
86 Ga0157376_10078868 3300014969 Bacteria 2821
87 Ga0206356_11078191 3300020070 Bacteria 1276
88 Ga0207697_10038927 3300025315 Unclassified 1951
89 Ga0207682_10013521 3300025893 Bacteria 3179
90 Ga0207688_10000338 3300025901 Bacteria 21698
91 Ga0207645_10004604 3300025907 Bacteria 10164
92 Ga0207707_10146673 3300025912 Bacteria 2063
93 Ga0207707_10176026 3300025912 Bacteria 1869
94 Ga0207707_10327828 3300025912 Unclassified 1321
95 Ga0207649_10003889 3300025920 Bacteria 8147
96 Ga0207646_10182316 3300025922 Bacteria 1896
97 Ga0207650_10043174 3300025925 Bacteria 3309
98 Ga0207650_10084074 3300025925 Bacteria 2418
99 Ga0207650_10285193 3300025925 Bacteria 1345
100 Ga0207659_10179111 3300025926 Bacteria 1678
101 Ga0207659_10341846 3300025926 Unclassified 1240
102 Ga0207706_10150294 3300025933 Bacteria 2048
103 Ga0207686_10021835 3300025934 Bacteria 3680
104 Ga0207670_10138684 3300025936 Unclassified 1791
105 Ga0207711_10290578 3300025941 Bacteria 1507
106 Ga0207689_10128546 3300025942 Bacteria 2084
107 Ga0207661_10012782 3300025944 Bacteria 6117
108 Ga0207661_10288709 3300025944 Bacteria 1468
109 Ga0207679_10564204 3300025945 Unclassified 1023
110 Ga0207668_10213929 3300025972 Bacteria 1543
111 Ga0207658_10013109 3300025986 Bacteria 5662
112 Ga0207703_10579908 3300026035 Unclassified 1060
113 Ga0207678_10094253 3300026067 Bacteria 2558
114 Ga0207648_10021263 3300026089 Bacteria 5833
115 Ga0207676_10076015 3300026095 Bacteria 2712
116 Ga0207676_10102831 3300026095 Unclassified 2373
117 Ga0207683_10064541 3300026121 Bacteria 3227
118 Ga0207683_10170646 3300026121 Bacteria 1970
119 Ga0207683_10370207 3300026121 Bacteria 1316
120 Ga0207428_10114769 3300027907 Bacteria 2069
121 Ga0207428_10133089 3300027907 Bacteria 1902
122 Ga0373926_0046387 3300035083 Bacteria 1559
123 Ga0373941_0031496 3300035115 Bacteria 1581
124 Ga0373957_0135011 3300035120 Bacteria 1006
125 Ga0373927_0023762 3300035695 Plasmid 4012
126 Ga0373947_0032921 3300035725 Bacteria 3057
127 Ga0373925_0004185 3300037068 Bacteria 10952
128 Ga0373925_0004488 3300037068 Bacteria 10546
129 Ga0451577_0508441 3300042876 Bacteria 1094
130 Ga0451576_0282637 3300045051 Bacteria 1735
131 Ga0495603_0073949 3300046455 Bacteria 2002
132 Ga0495629_0021307 3300046459 Bacteria 4625
133 Ga0495580_0018438 3300046472 Bacteria 5195
134 Ga0495582_0015419 3300046473 Bacteria 4197
135 Ga0495639_0001232 3300046475 Bacteria 11546
136 Ga0495662_0012056 3300046476 Bacteria 4224
137 Ga0495594_0035309 3300046499 Bacteria 2723
138 Ga0495594_0042963 3300046499 Unclassified 2476
139 Ga0495630_0011918 3300046517 Bacteria 6304
140 Ga0495666_0062453 3300046526 Unclassified 1779
141 Ga0495665_0073965 3300046531 Bacteria 1794
142 Ga0495622_0183615 3300046557 Unclassified 937
143 Ga0495634_0186289 3300046642 Bacteria 1297
144 Ga0495647_0004182 3300046681 Unclassified 4675
145 Ga0495658_0017878 3300046683 Unclassified 3674
146 Ga0495669_0070689 3300046684 Bacteria 1590
147 Ga0495669_0146068 3300046684 Bacteria 1118
148 Ga0495669_0160182 3300046684 Bacteria 1068
149 Ga0495613_0006047 3300046689 Bacteria 9057
150 Ga0495581_0014272 3300047315 Unclassified 4607
151 Ga0495581_0162205 3300047315 Bacteria 1307
152 Ga0495674_0086264 3300047319 Unclassified 2688
153 Ga0495676_0148465 3300047321 Bacteria 1672
154 Ga0495593_0046187 3300047673 Bacteria 2322
155 Ga0495614_0042382 3300048089 Bacteria 1951
156 Ga0496104_0002582 3300048907 Bacteria 15623
157 Ga0496105_0027754 3300048908 Bacteria 4627
158 Ga0496108_0000208 3300048911 Bacteria 53896
159 Ga0496108_0010487 3300048911 Bacteria 7527
160 Ga0496109_0001332 3300048912 Bacteria 20385
161 Ga0496110_0035140 3300048913 Bacteria 4346
162 Ga0496111_0022291 3300048914 Bacteria 4432
163 Ga0496111_0044201 3300048914 Unclassified 3202
164 Ga0496112_0001262 3300048915 Bacteria 19186
165 Ga0496112_0008454 3300048915 Bacteria 9222
166 Ga0496112_0194010 3300048915 Bacteria 1992
167 Ga0496112_0313312 3300048915 Unclassified 1514
168 Ga0496112_0343422 3300048915 Bacteria 1436
169 Ga0496113_0114572 3300048916 Unclassified 2102
170 Ga0496114_0033203 3300048917 Bacteria 4251
171 nmdc:mga05p37_271435_c1 3300050507 Bacteria 2026
172 nmdc:mga05p37_27_c1 3300050507 Bacteria 115422
173 nmdc:mga05p37_364524_c1 3300050507 Unclassified 1698
174 nmdc:mga09592_5483_c1 3300050508 Bacteria 10315
175 nmdc:mga09592_82535_c1 3300050508 Bacteria 2739
176 nmdc:mga0qj67_11334_c1 3300050509 Bacteria 6677
177 nmdc:mga06r32_788_c1 3300050510 Bacteria 28049
178 nmdc:mga08y16_121847_c1 3300050511 Bacteria 2714
179 nmdc:mga08y16_201606_c1 3300050511 Bacteria 2062
180 nmdc:mga08y16_317947_c1 3300050511 Bacteria 1603
181 nmdc:mga0n895_110450_c1 3300050512 Bacteria 2766
182 nmdc:mga0n895_32082_c1 3300050512 Bacteria 5038
183 nmdc:mga0n895_36752_c1 3300050512 Unclassified 4731
184 nmdc:mga0n895_46363_c1 3300050512 Bacteria 4246
185 nmdc:mga0rr50_143679_c1 3300050513 Bacteria 1922
186 nmdc:mga0rr50_23480_c1 3300050513 Unclassified 4253
187 nmdc:mga0rr50_330_c1 3300050513 Bacteria 25823
188 nmdc:mga08x19_257_c1 3300050514 Bacteria 40329
189 nmdc:mga0a205_151_c1 3300050515 Bacteria 29511
190 nmdc:mga0a205_26125_c1 3300050515 Bacteria 5563
191 Ga0495595_0060851 3300053084 Bacteria 1768
192 Ga0496111_0341496
193 JGI24751J29686_10002779
194 Ga0065712_10068953
195 Ga0065712_10070749
196 Ga0065712_10083869
197 Ga0065712_10143404
198 Ga0070683_100000853
199 Ga0070683_100188400
200 Ga0070670_100006166
201 Ga0070670_100048230
202 Ga0068869_100187291
203 Ga0070666_10141995
204 Ga0070661_100003573
205 Ga0070668_100089172
206 Ga0070675_100002768
207 Ga0070675_100403855
208 Ga0070667_100055389
209 Ga0070713_100011340
210 Ga0070705_100077924
211 Ga0070708_100345068
212 Ga0070663_100044979
213 Ga0070678_100132007
214 Ga0070678_100398409
215 Ga0070681_10146059
216 Ga0068867_100022274
217 Ga0070685_10124548
218 Ga0070707_100177596
219 Ga0070684_100000056
220 Ga0070672_100014684
221 Ga0070686_100098436
222 Ga0070693_100029285
223 Ga0070704_100344450
224 Ga0068855_100455745
225 Ga0068859_100024154
226 Ga0068864_100043102
227 Ga0068864_100179077
228 Ga0068870_10163061
229 Ga0068858_100599719
230 Ga0068860_100222840
231 Ga0068860_100385085
232 Ga0068860_100738045
233 Ga0081455_10083147
234 Ga0081540_1008475
235 Ga0070715_10112511
236 Ga0097621_100067675
237 Ga0068871_100010826
238 Ga0068871_100182535
239 Ga0075428_100009292
240 Ga0075430_100060118
241 Ga0075431_100041104
242 Ga0075433_10005718
243 Ga0075433_10031938
244 Ga0075433_10358950
245 Ga0075433_10434706
246 Ga0075434_100010657
247 Ga0075434_100048524
248 Ga0075429_100003025
249 Ga0068865_100015813
250 Ga0075436_100001435
251 Ga0097620_100024154
252 Ga0075435_100002270
253 Ga0075435_100134350
254 Ga0099794_10000545
255 Ga0105240_10107850
256 Ga0111539_10045353
257 Ga0111539_10076823
258 Ga0111539_10130403
259 Ga0105245_10027931
260 Ga0105247_10071322
261 Ga0114129_10000475
262 Ga0114129_10002204
263 Ga0114129_10096521
264 Ga0114129_10709068
265 Ga0105243_10258418
266 Ga0105242_10002034
267 Ga0105248_10025519
268 Ga0105248_10052360
269 Ga0105249_10536051
270 Ga0105239_10066602
271 Ga0105246_10082308
272 Ga0105246_10090258
273 Ga0163163_10003233
274 Ga0163163_10056368
275 Ga0157380_10054288
276 Ga0157377_10035202
277 Ga0157376_10078868
278 Ga0206356_11078191
279 Ga0207697_10038927
280 Ga0207682_10013521
281 Ga0207688_10000338
282 Ga0207645_10004604
283 Ga0207707_10146673
284 Ga0207707_10176026
285 Ga0207707_10327828
286 Ga0207649_10003889
287 Ga0207646_10182316
288 Ga0207650_10043174
289 Ga0207650_10084074
290 Ga0207650_10285193
291 Ga0207659_10179111
292 Ga0207659_10341846
293 Ga0207706_10150294
294 Ga0207686_10021835
295 Ga0207670_10138684
296 Ga0207711_10290578
297 Ga0207689_10128546
298 Ga0207661_10012782
299 Ga0207661_10288709
300 Ga0207679_10564204
301 Ga0207668_10213929
302 Ga0207658_10013109
303 Ga0207703_10579908
304 Ga0207678_10094253
305 Ga0207648_10021263
306 Ga0207676_10076015
307 Ga0207676_10102831
308 Ga0207683_10064541
309 Ga0207683_10170646
310 Ga0207683_10370207
311 Ga0207428_10114769
312 Ga0207428_10133089
313 Ga0373926_0046387
314 Ga0373941_0031496
315 Ga0373957_0135011
316 Ga0373927_0023762
317 Ga0373947_0032921
318 Ga0373925_0004185
319 Ga0373925_0004488
320 Ga0451577_0508441
321 Ga0451576_0282637
322 Ga0495603_0073949
323 Ga0495629_0021307
324 Ga0495580_0018438
325 Ga0495582_0015419
326 Ga0495639_0001232
327 Ga0495662_0012056
328 Ga0495594_0035309
329 Ga0495594_0042963
330 Ga0495630_0011918
331 Ga0495666_0062453
332 Ga0495665_0073965
333 Ga0495622_0183615
334 Ga0495634_0186289
335 Ga0495647_0004182
336 Ga0495658_0017878
337 Ga0495669_0070689
338 Ga0495669_0146068
339 Ga0495669_0160182
340 Ga0495613_0006047
341 Ga0495581_0014272
342 Ga0495581_0162205
343 Ga0495674_0086264
344 Ga0495676_0148465
345 Ga0495593_0046187
346 Ga0495614_0042382
347 Ga0496104_0002582
348 Ga0496105_0027754
349 Ga0496108_0000208
350 Ga0496108_0010487
351 Ga0496109_0001332
352 Ga0496110_0035140
353 Ga0496111_0022291
354 Ga0496111_0044201
355 Ga0496112_0001262
356 Ga0496112_0008454
357 Ga0496112_0194010
358 Ga0496112_0313312
359 Ga0496112_0343422
360 Ga0496113_0114572
361 Ga0496114_0033203
362 nmdc:mga05p37_271435_c1
363 nmdc:mga05p37_27_c1
364 nmdc:mga05p37_364524_c1
365 nmdc:mga09592_5483_c1
366 nmdc:mga09592_82535_c1
367 nmdc:mga0qj67_11334_c1
368 nmdc:mga06r32_788_c1
369 nmdc:mga08y16_121847_c1
370 nmdc:mga08y16_201606_c1
371 nmdc:mga08y16_317947_c1
372 nmdc:mga0n895_110450_c1
373 nmdc:mga0n895_32082_c1
374 nmdc:mga0n895_36752_c1
375 nmdc:mga0n895_46363_c1
376 nmdc:mga0rr50_143679_c1
377 nmdc:mga0rr50_23480_c1
378 nmdc:mga0rr50_330_c1
379 nmdc:mga08x19_257_c1
380 nmdc:mga0a205_151_c1
381 nmdc:mga0a205_26125_c1
382 Ga0495595_0060851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07485

DUF1529

Domain of Unknown Function (DUF1259)

194

313

0.98

PF07485

DUF1529

Domain of Unknown Function (DUF1259)

55

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bj3-assembly1.cif.gz_D nikr-apo 0.7263 221 287
6mrj-assembly1.cif.gz_A crystal structure of h.pylori nikr in complex with dna 0.716 219 287
2bj1-assembly1.cif.gz_B-2 nikr in open conformation and nickel bound to high-affinity sites 0.7159 220 287
6mmo-assembly1.cif.gz_B carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to amp 0.7079 221 288
2cz4-assembly1.cif.gz_C crystal structure of a putative pii-like signaling protein (ttha0516) from thermus thermophilus hb8 0.6948 221 288
ID Description Score Start End Superfamily
af_I6X9E2_51_172_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.961 31 149 3.30.1460.10
af_I6X9E2_193_312_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9399 171 287 3.30.1460.10
af_I6X9E2_51_172_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9307 31 149 3.30.1460.10
af_I6X9E2_193_312_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9101 171 287 3.30.1460.10
af_A0A1D6GPI2_538_640_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8313 226 271 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V9LSU1-F1-model_v4 DUF1259 domain-containing protein 1 212 291
AF-A0A2V6KAH2-F1-model_v4 DUF1259 domain-containing protein 0.9936 212 288
AF-A0A7V9JV62-F1-model_v4 DUF1259 domain-containing protein 0.9897 218 291
AF-A0A3D4AXT3-F1-model_v4 DUF1259 domain-containing protein 0.9823 227 291
AF-A0A3N5Y4N2-F1-model_v4 DUF1259 domain-containing protein 0.9805 190 288

Map