F293974

General Info

Members Datasets Scaffolds Average Seq Length
191 128 191 143

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10213126|Ga0114129_102131264
Length 157
Sequence VGRVSLKAVDRSGATGVRGMASEQDAYNELCAYTLAHRGAEFIHQHVVDAFAAQRADDRSKPIGVAFALVGLYLHVERRFSGRQVQQVHMLLARRKRAWPAFVLPRDRGSMTAVDVMQAPPGLERDRAIDAWCASVWTAFVDSRPIVVDLLKQHGIG

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 0.52
Rhizosphere 95.81
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10731294 3300005293 Unclassified 639
2 Ga0070658_11277795 3300005327 Unclassified 638
3 Ga0070683_100040301 3300005329 Bacteria 4294
4 Ga0070683_100093301 3300005329 Bacteria 2828
5 Ga0070683_100327485 3300005329 Bacteria 1458
6 Ga0070690_100498667 3300005330 Unclassified 910
7 Ga0070670_100476374 3300005331 Bacteria 1108
8 Ga0070670_100604136 3300005331 Bacteria 982
9 Ga0068869_100086165 3300005334 Bacteria 2354
10 Ga0070682_100566866 3300005337 Bacteria 891
11 Ga0070689_100965529 3300005340 Unclassified 757
12 Ga0070687_100004186 3300005343 Bacteria 5717
13 Ga0070661_100061197 3300005344 Unclassified 2763
14 Ga0070661_100259932 3300005344 Bacteria 1342
15 Ga0070661_100380975 3300005344 Bacteria 1112
16 Ga0070669_100002151 3300005353 Bacteria 14248
17 Ga0070669_100011182 3300005353 Bacteria 6369
18 Ga0070669_100056609 3300005353 Bacteria 2875
19 Ga0070669_100585654 3300005353 Bacteria 933
20 Ga0070675_100009830 3300005354 Bacteria 7455
21 Ga0070671_100179717 3300005355 Unclassified 1791
22 Ga0070674_100064048 3300005356 Bacteria 2575
23 Ga0070674_100434342 3300005356 Bacteria 1080
24 Ga0070673_100131952 3300005364 Bacteria 2097
25 Ga0070673_100491426 3300005364 Bacteria 1109
26 Ga0070688_100036532 3300005365 Bacteria 2988
27 Ga0070688_100141844 3300005365 Bacteria 1633
28 Ga0070659_100281036 3300005366 Unclassified 1385
29 Ga0070667_100382964 3300005367 Bacteria 1278
30 Ga0070714_100140120 3300005435 Bacteria 2170
31 Ga0070713_100019398 3300005436 Bacteria 5190
32 Ga0070705_101031073 3300005440 Unclassified 669
33 Ga0070694_100003697 3300005444 Bacteria 9129
34 Ga0070708_100021376 3300005445 Bacteria 5469
35 Ga0070707_100019891 3300005468 Bacteria 6329
36 Ga0070707_100109138 3300005468 Bacteria 2684
37 Ga0070707_101240909 3300005468 Bacteria 712
38 Ga0070698_102115222 3300005471 Bacteria 516
39 Ga0070684_100131514 3300005535 Bacteria 2258
40 Ga0070684_100500985 3300005535 Bacteria 1125
41 Ga0070684_101420467 3300005535 Unclassified 654
42 Ga0070697_100545320 3300005536 Bacteria 1017
43 Ga0070697_101111989 3300005536 Unclassified 703
44 Ga0070672_100022190 3300005543 Bacteria 4657
45 Ga0070686_100211691 3300005544 Unclassified 1396
46 Ga0070695_100001405 3300005545 Bacteria 13335
47 Ga0070696_100009836 3300005546 Bacteria 6394
48 Ga0070665_100143390 3300005548 Unclassified 2392
49 Ga0070704_100165705 3300005549 Unclassified 1752
50 Ga0070704_100331721 3300005549 Unclassified 1278
51 Ga0070704_100472614 3300005549 Unclassified 1083
52 Ga0068855_100252832 3300005563 Unclassified 1965
53 Ga0070664_100024288 3300005564 Bacteria 5012
54 Ga0070664_100108130 3300005564 Bacteria 2425
55 Ga0070664_100256890 3300005564 Bacteria 1571
56 Ga0068857_100052031 3300005577 Unclassified 3634
57 Ga0068857_100200811 3300005577 Unclassified 1817
58 Ga0068854_101119492 3300005578 Unclassified 702
59 Ga0068856_100581494 3300005614 Viruses 1141
60 Ga0068856_101726441 3300005614 Unclassified 638
61 Ga0070702_100020573 3300005615 Unclassified 3459
62 Ga0068852_100627572 3300005616 Unclassified 1081
63 Ga0068852_101844781 3300005616 Unclassified 627
64 Ga0068859_100061434 3300005617 Bacteria 3786
65 Ga0068870_10151970 3300005840 Unclassified 1365
66 Ga0068863_101653802 3300005841 Bacteria 650
67 Ga0068858_100831679 3300005842 Unclassified 901
68 Ga0068862_100009035 3300005844 Bacteria 8248
69 Ga0068862_100107831 3300005844 Bacteria 2442
70 Ga0081539_10086191 3300005985 Bacteria 1635
71 Ga0070717_10355611 3300006028 Bacteria 1310
72 Ga0075365_10507514 3300006038 Bacteria 852
73 Ga0075364_10266911 3300006051 Bacteria 1164
74 Ga0070716_100130485 3300006173 Unclassified 1588
75 Ga0097621_101768271 3300006237 Bacteria 589
76 Ga0075428_100410422 3300006844 Bacteria 1451
77 Ga0075428_100430796 3300006844 Bacteria 1413
78 Ga0075430_100117094 3300006846 Bacteria 2221
79 Ga0075431_100037490 3300006847 Bacteria 4993
80 Ga0075433_10061274 3300006852 Bacteria 3296
81 Ga0075434_100005979 3300006871 Bacteria 11138
82 Ga0075434_100369839 3300006871 Bacteria 1454
83 Ga0075436_100045964 3300006914 Unclassified 3012
84 Ga0075436_100436178 3300006914 Unclassified 952
85 Ga0097620_100061434 3300006931 Bacteria 3786
86 Ga0075435_100000904 3300007076 Bacteria 18681
87 Ga0075435_100027966 3300007076 Bacteria 4418
88 Ga0075435_100465930 3300007076 Bacteria 1090
89 Ga0111539_10008022 3300009094 Bacteria 13469
90 Ga0111539_10800713 3300009094 Unclassified 1097
91 Ga0105247_10563399 3300009101 Unclassified 839
92 Ga0114129_10056848 3300009147 Bacteria 5477
93 Ga0114129_10094324 3300009147 Bacteria 4145
94 Ga0114129_10124470 3300009147 Bacteria 3545
95 Ga0114129_10213126 3300009147 Unclassified 2610
96 Ga0114129_10361527 3300009147 Unclassified 1920
97 Ga0114129_11336704 3300009147 Unclassified 887
98 Ga0105248_10393071 3300009177 Unclassified 1561
99 Ga0105249_10001474 3300009553 Bacteria 20625
100 Ga0105249_10161150 3300009553 Unclassified 2168
101 Ga0105246_10220542 3300011119 Unclassified 1486
102 Ga0157369_11054431 3300013105 Bacteria 832
103 Ga0163162_10271567 3300013306 Unclassified 1827
104 Ga0157375_10290167 3300013308 Bacteria 1799
105 Ga0157380_10810256 3300014326 Unclassified 954
106 Ga0157380_10846350 3300014326 Unclassified 936
107 Ga0157377_10000142 3300014745 Bacteria 45556
108 Ga0157377_10011778 3300014745 Unclassified 4375
109 Ga0182007_10018923 3300015262 Bacteria 2486
110 Ga0207697_10050922 3300025315 Unclassified 1710
111 Ga0207688_10026913 3300025901 Bacteria 3163
112 Ga0207699_10151786 3300025906 Bacteria 1533
113 Ga0207699_11040491 3300025906 Unclassified 606
114 Ga0207645_10208611 3300025907 Bacteria 1286
115 Ga0207705_10783553 3300025909 Unclassified 740
116 Ga0207705_10793775 3300025909 Bacteria 735
117 Ga0207662_10014178 3300025918 Bacteria 4466
118 Ga0207649_10144010 3300025920 Bacteria 1634
119 Ga0207649_10224659 3300025920 Bacteria 1339
120 Ga0207646_10157973 3300025922 Unclassified 2045
121 Ga0207646_10191289 3300025922 Bacteria 1848
122 Ga0207681_10337159 3300025923 Unclassified 1203
123 Ga0207650_10403019 3300025925 Bacteria 1132
124 Ga0207659_10009547 3300025926 Bacteria 6068
125 Ga0207700_10018722 3300025928 Bacteria 4661
126 Ga0207700_10111280 3300025928 Bacteria 2204
127 Ga0207644_10650302 3300025931 Bacteria 877
128 Ga0207690_10129800 3300025932 Bacteria 1843
129 Ga0207706_10238735 3300025933 Bacteria 1589
130 Ga0207670_10534911 3300025936 Unclassified 956
131 Ga0207669_10123849 3300025937 Bacteria 1761
132 Ga0207669_10392568 3300025937 Bacteria 1084
133 Ga0207691_10005656 3300025940 Bacteria 12086
134 Ga0207691_10029574 3300025940 Bacteria 5124
135 Ga0207711_10529324 3300025941 Unclassified 1099
136 Ga0207689_10102213 3300025942 Bacteria 2354
137 Ga0207661_10064680 3300025944 Bacteria 2966
138 Ga0207661_10106094 3300025944 Bacteria 2368
139 Ga0207661_10107510 3300025944 Bacteria 2354
140 Ga0207661_10542474 3300025944 Bacteria 1065
141 Ga0207679_10029458 3300025945 Bacteria 3822
142 Ga0207679_10084345 3300025945 Bacteria 2438
143 Ga0207679_10155346 3300025945 Unclassified 1867
144 Ga0207667_10210883 3300025949 Unclassified 1991
145 Ga0207651_10030587 3300025960 Bacteria 3431
146 Ga0207651_10488483 3300025960 Bacteria 1062
147 Ga0207712_10037066 3300025961 Bacteria 3325
148 Ga0207674_10010959 3300026116 Bacteria 10201
149 Ga0268265_10214349 3300028380 Bacteria 1680
150 Ga0268265_10240311 3300028380 Unclassified 1598
151 Ga0268264_11170988 3300028381 Unclassified 778
152 Ga0265326_10017164 3300028558 Archaea 2089
153 Ga0307407_10279448 3300031903 Unclassified 1156
154 Ga0373947_0566403 3300035725 Bacteria 774
155 Ga0373937_0474659 3300036401 Bacteria 1188
156 Ga0373937_0916470 3300036401 Bacteria 825
157 Ga0395900_0522154 3300037418 Unclassified 1135
158 Ga0395905_0244413 3300037471 Unclassified 1677
159 Ga0395905_0911744 3300037471 Bacteria 782
160 Ga0436364_0348250 3300037853 Bacteria 844
161 Ga0436364_1073935 3300037853 Unclassified 981
162 Ga0451793_1035293 3300041452 Bacteria 634
163 Ga0466967_0224829 3300045976 Unclassified 1785
164 Ga0495598_0131990 3300046537 Unclassified 857
165 Ga0495645_0714195 3300046543 Bacteria 607
166 Ga0495657_0108009 3300046675 Bacteria 1766
167 Ga0495602_0002311 3300048088 Bacteria 19269
168 Ga0501067_0106237 3300049583 Unclassified 1560
169 Ga0501080_0763980 3300049742 Bacteria 849
170 Ga0501268_076653 3300049765 Unclassified 684
171 Ga0501044_0381140 3300049823 Bacteria 1325
172 nmdc:mga00v17_310426_c1 3300050491 Bacteria 1024
173 nmdc:mga0yw44_338493_c1 3300050492 Bacteria 1012
174 nmdc:mga06z11_649795_c1 3300050494 Bacteria 642
175 nmdc:mga05p37_1117887_c1 3300050507 Unclassified 823
176 nmdc:mga05p37_59960_c1 3300050507 Bacteria 2613
177 nmdc:mga05p37_7869_c1 3300050507 Bacteria 3549
178 nmdc:mga05p37_814705_c1 3300050507 Unclassified 1019
179 nmdc:mga05p37_97676_c1 3300050507 Bacteria 3618
180 nmdc:mga09592_62965_c1 3300050508 Bacteria 3138
181 nmdc:mga0qj67_178014_c1 3300050509 Bacteria 1727
182 nmdc:mga06r32_63567_c1 3300050510 Bacteria 3558
183 nmdc:mga08y16_25471_c1 3300050511 Bacteria 6240
184 nmdc:mga0n895_15_c1 3300050512 Bacteria 102361
185 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
186 nmdc:mga0rr50_322753_c1 3300050513 Bacteria 1295
187 nmdc:mga08x19_110691_c1 3300050514 Bacteria 1832
188 nmdc:mga08x19_131_c1 3300050514 Bacteria 66501
189 nmdc:mga08x19_39399_c1 3300050514 Bacteria 3004
190 nmdc:mga08x19_492698_c1 3300050514 Unclassified 865
191 nmdc:mga0a205_16650_c1 3300050515 Bacteria 6885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005615 Ga0070702_100020573 Ga0070702_1000205732 127
2 3300009147 Ga0114129_10056848 Ga0114129_100568483 130
3 3300041452 Ga0451793_1035293 Ga0451793_1035293_36_431 131
4 3300049765 Ga0501268_076653 Ga0501268_076653_191_631 131
5 3300005353 Ga0070669_100585654 Ga0070669_1005856542 133
6 3300005356 Ga0070674_100064048 Ga0070674_1000640482 133
7 3300025937 Ga0207669_10123849 Ga0207669_101238492 133
8 3300009101 Ga0105247_10563399 Ga0105247_105633992 134
9 3300046543 Ga0495645_0714195 Ga0495645_0714195_111_539 134
10 3300037471 Ga0395905_0911744 Ga0395905_0911744_316_735 135
11 3300037853 Ga0436364_0348250 Ga0436364_0348250_335_745 135
12 3300045976 Ga0466967_0224829 Ga0466967_0224829_43_456 135
13 3300005353 Ga0070669_100056609 Ga0070669_1000566092 136
14 3300005471 Ga0070698_102115222 Ga0070698_1021152221 136
15 3300005548 Ga0070665_100143390 Ga0070665_1001433902 136
16 3300005563 Ga0068855_100252832 Ga0068855_1002528322 136
17 3300014326 Ga0157380_10846350 Ga0157380_108463502 136
18 3300014745 Ga0157377_10000142 Ga0157377_1000014223 136
19 3300025949 Ga0207667_10210883 Ga0207667_102108832 136
20 3300049742 Ga0501080_0763980 Ga0501080_0763980_10_423 136
21 3300005436 Ga0070713_100019398 Ga0070713_1000193983 137
22 3300005468 Ga0070707_100019891 Ga0070707_1000198916 137
23 3300005536 Ga0070697_101111989 Ga0070697_1011119891 137
24 3300005577 Ga0068857_100200811 Ga0068857_1002008112 137
25 3300005578 Ga0068854_101119492 Ga0068854_1011194921 137
26 3300005985 Ga0081539_10086191 Ga0081539_100861912 137
27 3300006028 Ga0070717_10355611 Ga0070717_103556111 137
28 3300006038 Ga0075365_10507514 Ga0075365_105075142 137
29 3300006051 Ga0075364_10266911 Ga0075364_102669112 137
30 3300006844 Ga0075428_100410422 Ga0075428_1004104222 137
31 3300006846 Ga0075430_100117094 Ga0075430_1001170942 137
32 3300006847 Ga0075431_100037490 Ga0075431_1000374904 137
33 3300006852 Ga0075433_10061274 Ga0075433_100612744 137
34 3300007076 Ga0075435_100027966 Ga0075435_1000279665 137
35 3300009094 Ga0111539_10800713 Ga0111539_108007133 137
36 3300009147 Ga0114129_10361527 Ga0114129_103615272 137
37 3300009147 Ga0114129_11336704 Ga0114129_113367042 137
38 3300009553 Ga0105249_10161150 Ga0105249_101611502 137
39 3300025907 Ga0207645_10208611 Ga0207645_102086111 137
40 3300025909 Ga0207705_10783553 Ga0207705_107835532 137
41 3300025922 Ga0207646_10157973 Ga0207646_101579732 137
42 3300025928 Ga0207700_10018722 Ga0207700_100187223 137
43 3300025942 Ga0207689_10102213 Ga0207689_101022132 137
44 3300035725 Ga0373947_0566403 Ga0373947_0566403_37_456 137
45 3300037853 Ga0436364_1073935 Ga0436364_1073935_456_890 137
46 3300046537 Ga0495598_0131990 Ga0495598_0131990_384_800 137
47 3300049823 Ga0501044_0381140 Ga0501044_0381140_686_1105 137
48 3300050491 nmdc:mga00v17_310426_c1 nmdc:mga00v17_310426_c1_471_887 137
49 3300050492 nmdc:mga0yw44_338493_c1 nmdc:mga0yw44_338493_c1_470_886 137
50 3300050494 nmdc:mga06z11_649795_c1 nmdc:mga06z11_649795_c1_216_632 137
51 3300050507 nmdc:mga05p37_1117887_c1 nmdc:mga05p37_1117887_c1_364_780 137
52 3300050507 nmdc:mga05p37_814705_c1 nmdc:mga05p37_814705_c1_417_833 137
53 3300050507 nmdc:mga05p37_97676_c1 nmdc:mga05p37_97676_c1_874_1290 137
54 3300050509 nmdc:mga0qj67_178014_c1 nmdc:mga0qj67_178014_c1_953_1369 137
55 3300050510 nmdc:mga06r32_63567_c1 nmdc:mga06r32_63567_c1_1652_2068 137
56 3300050513 nmdc:mga0rr50_322753_c1 nmdc:mga0rr50_322753_c1_41_457 137
57 3300050514 nmdc:mga08x19_492698_c1 nmdc:mga08x19_492698_c1_368_781 137
58 3300050515 nmdc:mga0a205_16650_c1 nmdc:mga0a205_16650_c1_5784_6200 137
59 3300005329 Ga0070683_100040301 Ga0070683_1000403012 138
60 3300005337 Ga0070682_100566866 Ga0070682_1005668662 138
61 3300025928 Ga0207700_10111280 Ga0207700_101112802 138
62 3300025944 Ga0207661_10107510 Ga0207661_101075102 138
63 3300006871 Ga0075434_100005979 Ga0075434_1000059797 139
64 3300006914 Ga0075436_100045964 Ga0075436_1000459642 139
65 3300007076 Ga0075435_100000904 Ga0075435_1000009045 139
66 3300050512 nmdc:mga0n895_15_c1 nmdc:mga0n895_15_c1_58262_58693 139
67 3300050513 nmdc:mga0rr50_15_c1 nmdc:mga0rr50_15_c1_130268_130699 139
68 3300050514 nmdc:mga08x19_131_c1 nmdc:mga08x19_131_c1_33132_33563 139
69 3300005293 Ga0065715_10731294 Ga0065715_107312941 140
70 3300005327 Ga0070658_11277795 Ga0070658_112777951 140
71 3300005329 Ga0070683_100093301 Ga0070683_1000933014 140
72 3300005329 Ga0070683_100327485 Ga0070683_1003274853 140
73 3300005330 Ga0070690_100498667 Ga0070690_1004986672 140
74 3300005331 Ga0070670_100476374 Ga0070670_1004763742 140
75 3300005331 Ga0070670_100604136 Ga0070670_1006041362 140
76 3300005334 Ga0068869_100086165 Ga0068869_1000861652 140
77 3300005340 Ga0070689_100965529 Ga0070689_1009655292 140
78 3300005343 Ga0070687_100004186 Ga0070687_1000041863 140
79 3300005344 Ga0070661_100061197 Ga0070661_1000611972 140
80 3300005344 Ga0070661_100259932 Ga0070661_1002599322 140
81 3300005344 Ga0070661_100380975 Ga0070661_1003809752 140
82 3300005353 Ga0070669_100002151 Ga0070669_1000021515 140
83 3300005353 Ga0070669_100011182 Ga0070669_1000111827 140
84 3300005354 Ga0070675_100009830 Ga0070675_1000098303 140
85 3300005355 Ga0070671_100179717 Ga0070671_1001797173 140
86 3300005356 Ga0070674_100434342 Ga0070674_1004343421 140
87 3300005364 Ga0070673_100131952 Ga0070673_1001319523 140
88 3300005364 Ga0070673_100491426 Ga0070673_1004914262 140
89 3300005365 Ga0070688_100036532 Ga0070688_1000365323 140
90 3300005365 Ga0070688_100141844 Ga0070688_1001418442 140
91 3300005366 Ga0070659_100281036 Ga0070659_1002810363 140
92 3300005367 Ga0070667_100382964 Ga0070667_1003829643 140
93 3300005435 Ga0070714_100140120 Ga0070714_1001401204 140
94 3300005440 Ga0070705_101031073 Ga0070705_1010310731 140
95 3300005444 Ga0070694_100003697 Ga0070694_10000369714 140
96 3300005445 Ga0070708_100021376 Ga0070708_1000213762 140
97 3300005468 Ga0070707_100109138 Ga0070707_1001091382 140
98 3300005468 Ga0070707_101240909 Ga0070707_1012409092 140
99 3300005535 Ga0070684_100131514 Ga0070684_1001315142 140
100 3300005535 Ga0070684_100500985 Ga0070684_1005009852 140
101 3300005535 Ga0070684_101420467 Ga0070684_1014204671 140
102 3300005536 Ga0070697_100545320 Ga0070697_1005453202 140
103 3300005543 Ga0070672_100022190 Ga0070672_1000221903 140
104 3300005544 Ga0070686_100211691 Ga0070686_1002116913 140
105 3300005545 Ga0070695_100001405 Ga0070695_1000014053 140
106 3300005546 Ga0070696_100009836 Ga0070696_1000098363 140
107 3300005549 Ga0070704_100165705 Ga0070704_1001657052 140
108 3300005549 Ga0070704_100331721 Ga0070704_1003317213 140
109 3300005549 Ga0070704_100472614 Ga0070704_1004726142 140
110 3300005564 Ga0070664_100024288 Ga0070664_1000242884 140
111 3300005564 Ga0070664_100108130 Ga0070664_1001081302 140
112 3300005564 Ga0070664_100256890 Ga0070664_1002568903 140
113 3300005577 Ga0068857_100052031 Ga0068857_1000520311 140
114 3300005614 Ga0068856_100581494 Ga0068856_1005814942 140
115 3300005614 Ga0068856_101726441 Ga0068856_1017264412 140
116 3300005616 Ga0068852_100627572 Ga0068852_1006275722 140
117 3300005616 Ga0068852_101844781 Ga0068852_1018447812 140
118 3300005617 Ga0068859_100061434 Ga0068859_1000614343 140
119 3300005840 Ga0068870_10151970 Ga0068870_101519703 140
120 3300005841 Ga0068863_101653802 Ga0068863_1016538022 140
121 3300005842 Ga0068858_100831679 Ga0068858_1008316791 140
122 3300005844 Ga0068862_100009035 Ga0068862_1000090352 140
123 3300005844 Ga0068862_100107831 Ga0068862_1001078313 140
124 3300006173 Ga0070716_100130485 Ga0070716_1001304853 140
125 3300006237 Ga0097621_101768271 Ga0097621_1017682711 140
126 3300006844 Ga0075428_100430796 Ga0075428_1004307962 140
127 3300006871 Ga0075434_100369839 Ga0075434_1003698392 140
128 3300006914 Ga0075436_100436178 Ga0075436_1004361782 140
129 3300006931 Ga0097620_100061434 Ga0097620_1000614343 140
130 3300007076 Ga0075435_100465930 Ga0075435_1004659302 140
131 3300009094 Ga0111539_10008022 Ga0111539_100080222 140
132 3300009147 Ga0114129_10094324 Ga0114129_100943244 140
133 3300009147 Ga0114129_10124470 Ga0114129_101244703 140
134 3300009147 Ga0114129_10213126 Ga0114129_102131264 140
135 3300009177 Ga0105248_10393071 Ga0105248_103930713 140
136 3300009553 Ga0105249_10001474 Ga0105249_1000147415 140
137 3300011119 Ga0105246_10220542 Ga0105246_102205422 140
138 3300013105 Ga0157369_11054431 Ga0157369_110544312 140
139 3300013306 Ga0163162_10271567 Ga0163162_102715673 140
140 3300013308 Ga0157375_10290167 Ga0157375_102901672 140
141 3300014326 Ga0157380_10810256 Ga0157380_108102561 140
142 3300014745 Ga0157377_10011778 Ga0157377_100117782 140
143 3300015262 Ga0182007_10018923 Ga0182007_100189232 140
144 3300025315 Ga0207697_10050922 Ga0207697_100509221 140
145 3300025901 Ga0207688_10026913 Ga0207688_100269133 140
146 3300025906 Ga0207699_10151786 Ga0207699_101517861 140
147 3300025906 Ga0207699_11040491 Ga0207699_110404911 140
148 3300025909 Ga0207705_10793775 Ga0207705_107937752 140
149 3300025918 Ga0207662_10014178 Ga0207662_100141783 140
150 3300025920 Ga0207649_10144010 Ga0207649_101440102 140
151 3300025920 Ga0207649_10224659 Ga0207649_102246593 140
152 3300025922 Ga0207646_10191289 Ga0207646_101912892 140
153 3300025923 Ga0207681_10337159 Ga0207681_103371592 140
154 3300025925 Ga0207650_10403019 Ga0207650_104030192 140
155 3300025926 Ga0207659_10009547 Ga0207659_100095477 140
156 3300025931 Ga0207644_10650302 Ga0207644_106503022 140
157 3300025932 Ga0207690_10129800 Ga0207690_101298003 140
158 3300025933 Ga0207706_10238735 Ga0207706_102387353 140
159 3300025936 Ga0207670_10534911 Ga0207670_105349113 140
160 3300025937 Ga0207669_10392568 Ga0207669_103925683 140
161 3300025940 Ga0207691_10005656 Ga0207691_1000565610 140
162 3300025940 Ga0207691_10029574 Ga0207691_100295745 140
163 3300025941 Ga0207711_10529324 Ga0207711_105293243 140
164 3300025944 Ga0207661_10064680 Ga0207661_100646802 140
165 3300025944 Ga0207661_10106094 Ga0207661_101060942 140
166 3300025944 Ga0207661_10542474 Ga0207661_105424742 140
167 3300025945 Ga0207679_10029458 Ga0207679_100294586 140
168 3300025945 Ga0207679_10084345 Ga0207679_100843454 140
169 3300025945 Ga0207679_10155346 Ga0207679_101553463 140
170 3300025960 Ga0207651_10030587 Ga0207651_100305872 140
171 3300025960 Ga0207651_10488483 Ga0207651_104884831 140
172 3300025961 Ga0207712_10037066 Ga0207712_100370662 140
173 3300026116 Ga0207674_10010959 Ga0207674_100109598 140
174 3300028380 Ga0268265_10214349 Ga0268265_102143492 140
175 3300028380 Ga0268265_10240311 Ga0268265_102403113 140
176 3300028381 Ga0268264_11170988 Ga0268264_111709882 140
177 3300028558 Ga0265326_10017164 Ga0265326_100171642 140
178 3300031903 Ga0307407_10279448 Ga0307407_102794482 140
179 3300036401 Ga0373937_0474659 Ga0373937_0474659_96_530 140
180 3300036401 Ga0373937_0916470 Ga0373937_0916470_15_452 140
181 3300037418 Ga0395900_0522154 Ga0395900_0522154_51_500 140
182 3300037471 Ga0395905_0244413 Ga0395905_0244413_1173_1622 140
183 3300046675 Ga0495657_0108009 Ga0495657_0108009_693_1127 140
184 3300048088 Ga0495602_0002311 Ga0495602_0002311_8979_9413 140
185 3300049583 Ga0501067_0106237 Ga0501067_0106237_797_1225 140
186 3300050507 nmdc:mga05p37_59960_c1 nmdc:mga05p37_59960_c1_1466_1939 140
187 3300050507 nmdc:mga05p37_7869_c1 nmdc:mga05p37_7869_c1_2304_2741 140
188 3300050508 nmdc:mga09592_62965_c1 nmdc:mga09592_62965_c1_1391_1813 140
189 3300050511 nmdc:mga08y16_25471_c1 nmdc:mga08y16_25471_c1_4882_5304 140
190 3300050514 nmdc:mga08x19_110691_c1 nmdc:mga08x19_110691_c1_931_1383 140
191 3300050514 nmdc:mga08x19_39399_c1 nmdc:mga08x19_39399_c1_909_1370 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19371

DUF5946

Family of unknown function (DUF5946)

13

141

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ldc-assembly1.cif.gz_A-3 high resolution open mthk pore structure crystallized in 100 mm k+ 0.3695 47 140
3ldc-assembly1.cif.gz_A high resolution open mthk pore structure crystallized in 100 mm k+ 0.3657 47 140
3ous-assembly1.cif.gz_A mthk channel pore t59a mutant 0.3626 47 140
5kdi-assembly2.cif.gz_B how fapp2 selects simple glycosphingolipids using the gltp-fold 0.3566 7 139
5kdi-assembly2.cif.gz_B how fapp2 selects simple glycosphingolipids using the gltp-fold 0.3405 7 139
ID Description Score Start End Superfamily
af_P46571_34_305_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5109 27 79 1.20.1070.10
af_Q9Y7X4_19_260_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4701 29 80 1.50.40.10
af_I1JI88_31_107_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4522 33 102 1.10.238.10
1zg5E00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4072 38 82 1.10.10.10
4qe7A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3761 46 140 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2E0VXS0-F1-model_v4 Uncharacterized protein 0.9986 32 139
AF-A0A0S7Z9M6-F1-model_v4 Uncharacterized protein 0.9939 10 138
AF-Q01N72-F1-model_v4 Uncharacterized protein 0.9878 6 138
AF-A0A1I5I1X8-F1-model_v4 Uncharacterized protein 0.9859 7 139
AF-A0A2V8GQQ4-F1-model_v4 Uncharacterized protein 0.9846 9 139

Feature Viewer

pLDDT pTM Quality
94.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map