F293968

General Info

Members Datasets Scaffolds Average Seq Length
191 138 382 156

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10037829|Ga0114129_100378293
Length 145
Sequence MAGRECYHCKQWIEDGEDHDCWTTTEAALTRDLSEDLQDAWQRLRETAASFGDQRIYASHHSIMFSRKSCYFFVRPKRNFLELCVFLGRAVRDEVESPVTDWLREAYDLSDVLAAKTRTTSSPKSGARKTATRXXXGSTRKAKRR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 1.57
Rhizosphere 95.81
Stem 0
Stem Tuber 0
Unclassified 22.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10037829 3300009147 Bacteria 6811
2 JGI25406J46586_10002212 3300003203 Bacteria 9174
3 Ga0065704_10458181 3300005289 Unclassified 699
4 Ga0065712_10337570 3300005290 Unclassified 797
5 Ga0065715_10537321 3300005293 Unclassified 751
6 Ga0070690_100308753 3300005330 Bacteria 1136
7 Ga0070666_10010483 3300005335 Bacteria 5799
8 Ga0068868_100244940 3300005338 Unclassified 1507
9 Ga0068868_100384037 3300005338 Bacteria 1209
10 Ga0070689_100009934 3300005340 Bacteria 6770
11 Ga0070689_100194426 3300005340 Unclassified 1653
12 Ga0070689_101306021 3300005340 Unclassified 653
13 Ga0070661_100200294 3300005344 Unclassified 1525
14 Ga0070661_100318551 3300005344 Bacteria 1214
15 Ga0070669_100339655 3300005353 Unclassified 1217
16 Ga0070675_100000102 3300005354 Bacteria 50103
17 Ga0070675_100188680 3300005354 Bacteria 1785
18 Ga0070675_100441027 3300005354 Bacteria 1166
19 Ga0070671_100048482 3300005355 Unclassified 3532
20 Ga0070673_100108450 3300005364 Unclassified 2299
21 Ga0070673_101381786 3300005364 Unclassified 662
22 Ga0070688_100010300 3300005365 Bacteria 5151
23 Ga0070659_100059059 3300005366 Bacteria 3028
24 Ga0070667_100029026 3300005367 Unclassified 4607
25 Ga0070701_10188090 3300005438 Bacteria 1213
26 Ga0070705_100048953 3300005440 Unclassified 2452
27 Ga0070678_100785932 3300005456 Bacteria 863
28 Ga0070662_100195918 3300005457 Bacteria 1600
29 Ga0070662_100477895 3300005457 Unclassified 1037
30 Ga0068867_100391301 3300005459 Bacteria 1170
31 Ga0070685_10001037 3300005466 Bacteria 14899
32 Ga0070685_10187241 3300005466 Bacteria 1337
33 Ga0070685_10348088 3300005466 Unclassified 1012
34 Ga0070707_100568052 3300005468 Unclassified 1096
35 Ga0070697_100959997 3300005536 Unclassified 759
36 Ga0070686_100254123 3300005544 Bacteria 1285
37 Ga0070664_100045146 3300005564 Unclassified 3721
38 Ga0068857_100262700 3300005577 Bacteria 1585
39 Ga0068852_101594367 3300005616 Unclassified 675
40 Ga0068859_100001584 3300005617 Bacteria 23196
41 Ga0068859_100001612 3300005617 Bacteria 23064
42 Ga0068859_100088402 3300005617 Bacteria 3148
43 Ga0068864_100055464 3300005618 Unclassified 3422
44 Ga0068864_100123548 3300005618 Unclassified 2317
45 Ga0068863_100002479 3300005841 Bacteria 18349
46 Ga0068858_100019978 3300005842 Bacteria 6264
47 Ga0068858_100736764 3300005842 Bacteria 960
48 Ga0068860_100010173 3300005843 Bacteria 9317
49 Ga0068862_100021403 3300005844 Bacteria 5403
50 Ga0081539_10001118 3300005985 Bacteria 48678
51 Ga0070712_100019755 3300006175 Bacteria 4400
52 Ga0075367_10006470 3300006178 Bacteria 5921
53 Ga0075366_10029910 3300006195 Bacteria 3200
54 Ga0097621_100041349 3300006237 Unclassified 3710
55 Ga0068871_100014492 3300006358 Bacteria 5882
56 Ga0075428_101125508 3300006844 Bacteria 829
57 Ga0075430_100096906 3300006846 Bacteria 2465
58 Ga0075430_100762129 3300006846 Bacteria 798
59 Ga0075430_100864713 3300006846 Unclassified 745
60 Ga0075431_100014602 3300006847 Bacteria 7944
61 Ga0075431_100141052 3300006847 Bacteria 2484
62 Ga0075431_100657959 3300006847 Unclassified 1028
63 Ga0075433_10062617 3300006852 Bacteria 3258
64 Ga0075434_100002656 3300006871 Bacteria 15783
65 Ga0075434_100005083 3300006871 Bacteria 11944
66 Ga0075429_100549485 3300006880 Bacteria 1012
67 Ga0075429_100689470 3300006880 Bacteria 895
68 Ga0097620_100001584 3300006931 Bacteria 23196
69 Ga0097620_100001612 3300006931 Bacteria 23064
70 Ga0097620_100088401 3300006931 Bacteria 3148
71 Ga0075435_100037526 3300007076 Unclassified 3859
72 Ga0111539_10074927 3300009094 Bacteria 3988
73 Ga0111539_11264378 3300009094 Bacteria 857
74 Ga0105245_10200923 3300009098 Unclassified 1914
75 Ga0114129_11382292 3300009147 Unclassified 869
76 Ga0105248_10000244 3300009177 Bacteria 62961
77 Ga0105248_10078140 3300009177 Bacteria 3721
78 Ga0105248_10842103 3300009177 Bacteria 1035
79 Ga0105237_10011808 3300009545 Bacteria 9238
80 Ga0105238_11443941 3300009551 Bacteria 716
81 Ga0105239_10503792 3300010375 Bacteria 1377
82 Ga0157370_11525660 3300013104 Bacteria 601
83 Ga0157374_10040522 3300013296 Plasmid 4290
84 Ga0163162_10001968 3300013306 Bacteria 19312
85 Ga0163162_10952284 3300013306 Bacteria 970
86 Ga0157375_10000216 3300013308 Bacteria 53883
87 Ga0157375_10244495 3300013308 Bacteria 1954
88 Ga0163163_10003898 3300014325 Bacteria 12721
89 Ga0157380_10056440 3300014326 Bacteria 3123
90 Ga0157380_10504910 3300014326 Bacteria 1176
91 Ga0157377_11061442 3300014745 Unclassified 618
92 Ga0157379_10000091 3300014968 Bacteria 61113
93 Ga0157379_10026392 3300014968 Bacteria 5172
94 Ga0182007_10173597 3300015262 Bacteria 742
95 Ga0207680_10329979 3300025903 Bacteria 1068
96 Ga0207647_10283068 3300025904 Bacteria 946
97 Ga0207699_10464528 3300025906 Bacteria 910
98 Ga0207643_10327196 3300025908 Bacteria 958
99 Ga0207693_10109396 3300025915 Bacteria 2167
100 Ga0207662_10233738 3300025918 Bacteria 1201
101 Ga0207649_10823912 3300025920 Bacteria 725
102 Ga0207646_10008808 3300025922 Bacteria 10068
103 Ga0207681_10123684 3300025923 Bacteria 1901
104 Ga0207694_10997183 3300025924 Bacteria 709
105 Ga0207659_10013221 3300025926 Bacteria 5280
106 Ga0207659_10015976 3300025926 Unclassified 4877
107 Ga0207659_11789897 3300025926 Unclassified 522
108 Ga0207644_10213573 3300025931 Unclassified 1526
109 Ga0207690_10105363 3300025932 Bacteria 2022
110 Ga0207706_10114783 3300025933 Unclassified 2369
111 Ga0207670_10412592 3300025936 Unclassified 1082
112 Ga0207670_11025939 3300025936 Unclassified 695
113 Ga0207669_10067144 3300025937 Bacteria 2233
114 Ga0207669_10437841 3300025937 Bacteria 1033
115 Ga0207691_10590405 3300025940 Bacteria 941
116 Ga0207711_10004808 3300025941 Bacteria 11469
117 Ga0207679_10029103 3300025945 Unclassified 3843
118 Ga0207651_10134273 3300025960 Bacteria 1900
119 Ga0207668_10271020 3300025972 Bacteria 1388
120 Ga0207677_10190561 3300026023 Unclassified 1621
121 Ga0207703_10018301 3300026035 Bacteria 5471
122 Ga0207703_10488904 3300026035 Bacteria 1154
123 Ga0207678_10233222 3300026067 Bacteria 1576
124 Ga0207641_10001423 3300026088 Bacteria 23551
125 Ga0207648_10431952 3300026089 Bacteria 1197
126 Ga0207674_10211963 3300026116 Bacteria 1886
127 Ga0207675_102066258 3300026118 Bacteria 587
128 Ga0207683_10017913 3300026121 Bacteria 6040
129 Ga0207428_10001446 3300027907 Bacteria 24876
130 Ga0207428_10237369 3300027907 Unclassified 1363
131 Ga0207428_10411561 3300027907 Bacteria 989
132 Ga0268265_10743313 3300028380 Bacteria 951
133 Ga0268264_10003055 3300028381 Bacteria 14503
134 Ga0307405_10013147 3300031731 Bacteria 4408
135 Ga0307413_11249085 3300031824 Unclassified 648
136 Ga0307409_100304266 3300031995 Bacteria 1485
137 Ga0307416_100050057 3300032002 Bacteria 3327
138 Ga0307416_101472207 3300032002 Unclassified 787
139 Ga0307414_10086813 3300032004 Bacteria 2310
140 Ga0307411_10920260 3300032005 Unclassified 778
141 Ga0307415_100117266 3300032126 Unclassified 1988
142 Ga0307415_100758040 3300032126 Bacteria 882
143 Ga0373931_0437780 3300035691 Bacteria 834
144 Ga0439434_0236731 3300042435 Archaea 622
145 Ga0439435_0017816 3300042436 Bacteria 1800
146 Ga0451576_0335732 3300045051 Bacteria 1582
147 Ga0495638_0079882 3300046460 Bacteria 1988
148 Ga0495643_0006152 3300046522 Bacteria 7972
149 Ga0495621_0070774 3300046539 Unclassified 1284
150 Ga0495621_0367394 3300046539 Bacteria 606
151 Ga0496106_0077024 3300048909 Bacteria 2557
152 Ga0496109_1206045 3300048912 Bacteria 693
153 Ga0496112_0143983 3300048915 Bacteria 2352
154 Ga0501033_0103961 3300049570 Bacteria 2071
155 Ga0501037_0106294 3300049573 Bacteria 2023
156 Ga0501041_0875041 3300049577 Bacteria 577
157 Ga0501042_0033789 3300049578 Bacteria 3626
158 Ga0501046_0019348 3300049580 Bacteria 5650
159 Ga0501048_0070020 3300049582 Bacteria 2478
160 Ga0501071_0871035 3300049587 Bacteria 695
161 Ga0501073_0026889 3300049589 Bacteria 4119
162 Ga0501074_0105791 3300049590 Bacteria 2014
163 Ga0501075_0112879 3300049591 Bacteria 2066
164 Ga0501076_0005976 3300049592 Bacteria 8788
165 Ga0501079_0137427 3300049741 Bacteria 1903
166 Ga0501079_0362629 3300049741 Bacteria 1136
167 Ga0501081_0052090 3300049743 Bacteria 2823
168 Ga0501045_0157998 3300049824 Bacteria 1687
169 nmdc:mga00v17_3495_c1 3300050491 Bacteria 8136
170 nmdc:mga0k408_30325_c1 3300050493 Bacteria 3083
171 nmdc:mga07m45_228004_c1 3300050496 Bacteria 1084
172 nmdc:mga05p37_1541414_c1 3300050507 Bacteria 659
173 nmdc:mga05p37_39651_c1 3300050507 Bacteria 5784
174 nmdc:mga0qj67_141315_c1 3300050509 Bacteria 1952
175 nmdc:mga0qj67_356007_c1 3300050509 Bacteria 1183
176 nmdc:mga0qj67_89678_c1 3300050509 Bacteria 2469
177 nmdc:mga06r32_138149_c1 3300050510 Bacteria 2411
178 nmdc:mga06r32_157793_c1 3300050510 Bacteria 2251
179 nmdc:mga06r32_199289_c1 3300050510 Bacteria 1990
180 nmdc:mga06r32_70647_c1 3300050510 Bacteria 3377
181 nmdc:mga08y16_1069288_c1 3300050511 Unclassified 783
182 nmdc:mga08y16_284842_c1 3300050511 Bacteria 1704
183 nmdc:mga08y16_543_c1 3300050511 Bacteria 34913
184 nmdc:mga08y16_76988_c1 3300050511 Bacteria 3477
185 nmdc:mga08y16_839274_c1 3300050511 Bacteria 909
186 nmdc:mga0n895_1508_c1 3300050512 Bacteria 17471
187 nmdc:mga0n895_7884_c1 3300050512 Bacteria 9183
188 nmdc:mga0rr50_4662_c1 3300050513 Bacteria 8081
189 nmdc:mga0a205_758541_c1 3300050515 Bacteria 819
190 nmdc:mga0a205_765_c1 3300050515 Bacteria 25996
191 Ga0501084_0189686 3300054114 Bacteria 1734
192 Ga0114129_10037829
193 JGI25406J46586_10002212
194 Ga0065704_10458181
195 Ga0065712_10337570
196 Ga0065715_10537321
197 Ga0070690_100308753
198 Ga0070666_10010483
199 Ga0068868_100244940
200 Ga0068868_100384037
201 Ga0070689_100009934
202 Ga0070689_100194426
203 Ga0070689_101306021
204 Ga0070661_100200294
205 Ga0070661_100318551
206 Ga0070669_100339655
207 Ga0070675_100000102
208 Ga0070675_100188680
209 Ga0070675_100441027
210 Ga0070671_100048482
211 Ga0070673_100108450
212 Ga0070673_101381786
213 Ga0070688_100010300
214 Ga0070659_100059059
215 Ga0070667_100029026
216 Ga0070701_10188090
217 Ga0070705_100048953
218 Ga0070678_100785932
219 Ga0070662_100195918
220 Ga0070662_100477895
221 Ga0068867_100391301
222 Ga0070685_10001037
223 Ga0070685_10187241
224 Ga0070685_10348088
225 Ga0070707_100568052
226 Ga0070697_100959997
227 Ga0070686_100254123
228 Ga0070664_100045146
229 Ga0068857_100262700
230 Ga0068852_101594367
231 Ga0068859_100001584
232 Ga0068859_100001612
233 Ga0068859_100088402
234 Ga0068864_100055464
235 Ga0068864_100123548
236 Ga0068863_100002479
237 Ga0068858_100019978
238 Ga0068858_100736764
239 Ga0068860_100010173
240 Ga0068862_100021403
241 Ga0081539_10001118
242 Ga0070712_100019755
243 Ga0075367_10006470
244 Ga0075366_10029910
245 Ga0097621_100041349
246 Ga0068871_100014492
247 Ga0075428_101125508
248 Ga0075430_100096906
249 Ga0075430_100762129
250 Ga0075430_100864713
251 Ga0075431_100014602
252 Ga0075431_100141052
253 Ga0075431_100657959
254 Ga0075433_10062617
255 Ga0075434_100002656
256 Ga0075434_100005083
257 Ga0075429_100549485
258 Ga0075429_100689470
259 Ga0097620_100001584
260 Ga0097620_100001612
261 Ga0097620_100088401
262 Ga0075435_100037526
263 Ga0111539_10074927
264 Ga0111539_11264378
265 Ga0105245_10200923
266 Ga0114129_11382292
267 Ga0105248_10000244
268 Ga0105248_10078140
269 Ga0105248_10842103
270 Ga0105237_10011808
271 Ga0105238_11443941
272 Ga0105239_10503792
273 Ga0157370_11525660
274 Ga0157374_10040522
275 Ga0163162_10001968
276 Ga0163162_10952284
277 Ga0157375_10000216
278 Ga0157375_10244495
279 Ga0163163_10003898
280 Ga0157380_10056440
281 Ga0157380_10504910
282 Ga0157377_11061442
283 Ga0157379_10000091
284 Ga0157379_10026392
285 Ga0182007_10173597
286 Ga0207680_10329979
287 Ga0207647_10283068
288 Ga0207699_10464528
289 Ga0207643_10327196
290 Ga0207693_10109396
291 Ga0207662_10233738
292 Ga0207649_10823912
293 Ga0207646_10008808
294 Ga0207681_10123684
295 Ga0207694_10997183
296 Ga0207659_10013221
297 Ga0207659_10015976
298 Ga0207659_11789897
299 Ga0207644_10213573
300 Ga0207690_10105363
301 Ga0207706_10114783
302 Ga0207670_10412592
303 Ga0207670_11025939
304 Ga0207669_10067144
305 Ga0207669_10437841
306 Ga0207691_10590405
307 Ga0207711_10004808
308 Ga0207679_10029103
309 Ga0207651_10134273
310 Ga0207668_10271020
311 Ga0207677_10190561
312 Ga0207703_10018301
313 Ga0207703_10488904
314 Ga0207678_10233222
315 Ga0207641_10001423
316 Ga0207648_10431952
317 Ga0207674_10211963
318 Ga0207675_102066258
319 Ga0207683_10017913
320 Ga0207428_10001446
321 Ga0207428_10237369
322 Ga0207428_10411561
323 Ga0268265_10743313
324 Ga0268264_10003055
325 Ga0307405_10013147
326 Ga0307413_11249085
327 Ga0307409_100304266
328 Ga0307416_100050057
329 Ga0307416_101472207
330 Ga0307414_10086813
331 Ga0307411_10920260
332 Ga0307415_100117266
333 Ga0307415_100758040
334 Ga0373931_0437780
335 Ga0439434_0236731
336 Ga0439435_0017816
337 Ga0451576_0335732
338 Ga0495638_0079882
339 Ga0495643_0006152
340 Ga0495621_0070774
341 Ga0495621_0367394
342 Ga0496106_0077024
343 Ga0496109_1206045
344 Ga0496112_0143983
345 Ga0501033_0103961
346 Ga0501037_0106294
347 Ga0501041_0875041
348 Ga0501042_0033789
349 Ga0501046_0019348
350 Ga0501048_0070020
351 Ga0501071_0871035
352 Ga0501073_0026889
353 Ga0501074_0105791
354 Ga0501075_0112879
355 Ga0501076_0005976
356 Ga0501079_0137427
357 Ga0501079_0362629
358 Ga0501081_0052090
359 Ga0501045_0157998
360 nmdc:mga00v17_3495_c1
361 nmdc:mga0k408_30325_c1
362 nmdc:mga07m45_228004_c1
363 nmdc:mga05p37_1541414_c1
364 nmdc:mga05p37_39651_c1
365 nmdc:mga0qj67_141315_c1
366 nmdc:mga0qj67_356007_c1
367 nmdc:mga0qj67_89678_c1
368 nmdc:mga06r32_138149_c1
369 nmdc:mga06r32_157793_c1
370 nmdc:mga06r32_199289_c1
371 nmdc:mga06r32_70647_c1
372 nmdc:mga08y16_1069288_c1
373 nmdc:mga08y16_284842_c1
374 nmdc:mga08y16_543_c1
375 nmdc:mga08y16_76988_c1
376 nmdc:mga08y16_839274_c1
377 nmdc:mga0n895_1508_c1
378 nmdc:mga0n895_7884_c1
379 nmdc:mga0rr50_4662_c1
380 nmdc:mga0a205_758541_c1
381 nmdc:mga0a205_765_c1
382 Ga0501084_0189686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18899

DUF5655

Domain of unknown function (DUF5655)

26

94

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5htx-assembly1.cif.gz_A putative sugar kinases from arabidopsis thaliana in complex with adp 0.7722 79 112
5htj-assembly1.cif.gz_A putative sugar kinases from synechococcus elongatus pcc7942-d8a 0.7488 79 112
5htn-assembly1.cif.gz_A putative sugar kinases from synechococcus elongatus pcc7942-apo form 0.7455 79 112
5hu2-assembly1.cif.gz_A sugar kinases from synechococcus elongatus pcc7942-t11a 0.7345 79 112
5hty-assembly1.cif.gz_A sugar kinases from synechococcus elongatus pcc7942-d221a 0.7336 79 112
ID Description Score Start End Superfamily
af_A0A0N7KNB0_143_270_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7868 72 112 3.30.420.40
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7545 41 85 3.90.1150.200
af_A0A0R0JI06_246_479_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7274 79 114 3.30.420.40
af_A0A1D8PMB3_317_456_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.727 74 112 3.30.420.40
af_P42826_310_571_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7236 79 112 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A4R9B2W3-F1-model_v4 DNA replication protein DnaC 0.979 39 134
AF-A0A2A5G9S6-F1-model_v4 DUF5655 domain-containing protein 0.9703 58 134
AF-A0A7W8KXQ5-F1-model_v4 deleted 0.9651 25 132
AF-A0A2V8L8K7-F1-model_v4 DUF5655 domain-containing protein 0.963 52 134
AF-A0A0F7GFX2-F1-model_v4 DUF5655 domain-containing protein 0.9607 32 134

Map