F293596

General Info

Members Datasets Scaffolds Average Seq Length
191 122 382 457

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100034391|Ga0070669_1000343912
Length 516
Sequence MNRDDLPSGLLKARAVTRRHFFRSGGMGLGAIALQSLLTRDNVLAQGANSATQRVSALAPKPPMLAPRAKRVIYLHMAGSPSQLELFEYKPELEKLHLKDCPPSFLEGKRFAFIKGTPKILAGQFRFERQGQSGQWISELLPHFAKVVDKTCVIRTVQTDQFNHAPAQLFVHTGSPRLGNASLGSWVTYGLGSVNENLPGFVVLLSGGKTPDAGKSLWGSGFLPSVYQGVQCRTNGDPVLYLGNPAGIDRELRRRTLDALAEMNNAEYARSGDNETLTRIAQYELAFRMQLSVPEVMDISKEPQHVLDLYGAKPGFVSPAESADDPRKLYKGDDPTFANNCLLARRLIENGVRFVQLYDWGWDHHGSSPGESIDETLPIKCQQIDRAVAALLRDLEQRGLLNETLVIWGGEFGRTPMMQNNVRTELKKGFIGRDHHTSAYAIWLAGGGIKGGLAYGATDEFGYYPVENPVSVRDLQATIQYILGLDPYKFSYPYQGLNNRLIGPSDEGQVLKGILS

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
116 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
122 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 0
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100034391 3300005353 Bacteria 3669
2 Ga0065707_10090523 3300005295 Bacteria 4124
3 Ga0070658_10007916 3300005327 Bacteria 8559
4 Ga0070658_10021577 3300005327 Bacteria 5161
5 Ga0070670_100110795 3300005331 Unclassified 2365
6 Ga0070666_10011178 3300005335 Bacteria 5626
7 Ga0068868_100005606 3300005338 Bacteria 8830
8 Ga0070660_100009971 3300005339 Bacteria 6698
9 Ga0070669_100036642 3300005353 Bacteria 3556
10 Ga0070669_100053989 3300005353 Bacteria 2942
11 Ga0070675_100010953 3300005354 Bacteria 7097
12 Ga0070671_100008083 3300005355 Bacteria 8422
13 Ga0070671_100014493 3300005355 Bacteria 6372
14 Ga0070673_100020031 3300005364 Bacteria 4816
15 Ga0070688_100032034 3300005365 Bacteria 3166
16 Ga0070667_100004033 3300005367 Bacteria 12426
17 Ga0070705_100088786 3300005440 Bacteria 1920
18 Ga0070681_10017633 3300005458 Bacteria 7134
19 Ga0070681_10153308 3300005458 Bacteria 2230
20 Ga0070685_10006316 3300005466 Bacteria 6041
21 Ga0070707_100001031 3300005468 Bacteria 27596
22 Ga0070699_100135494 3300005518 Bacteria 2172
23 Ga0070679_100148623 3300005530 Bacteria 2320
24 Ga0068853_100012657 3300005539 Bacteria 6869
25 Ga0068853_100016516 3300005539 Bacteria 6077
26 Ga0070696_100023510 3300005546 Bacteria 4190
27 Ga0070665_100003635 3300005548 Bacteria 16339
28 Ga0070665_100080204 3300005548 Unclassified 3269
29 Ga0068855_100003685 3300005563 Bacteria 18743
30 Ga0068855_100031027 3300005563 Bacteria 6387
31 Ga0068855_100074175 3300005563 Bacteria 3952
32 Ga0068855_100123825 3300005563 Bacteria 2957
33 Ga0068855_100131512 3300005563 Bacteria 2858
34 Ga0068855_100222037 3300005563 Bacteria 2118
35 Ga0068857_100019351 3300005577 Bacteria 5977
36 Ga0068857_100028861 3300005577 Bacteria 4896
37 Ga0068856_100010815 3300005614 Bacteria 8862
38 Ga0068856_100012474 3300005614 Bacteria 8228
39 Ga0070702_100097224 3300005615 Bacteria 1799
40 Ga0068864_100057561 3300005618 Bacteria 3358
41 Ga0068861_100034028 3300005719 Bacteria 3765
42 Ga0068861_100161647 3300005719 Bacteria 1848
43 Ga0068858_100010258 3300005842 Bacteria 8886
44 Ga0068858_100042508 3300005842 Bacteria 4214
45 Ga0068862_100002180 3300005844 Bacteria 17576
46 Ga0068862_100032836 3300005844 Bacteria 4383
47 Ga0081455_10010235 3300005937 Bacteria 9538
48 Ga0081455_10029606 3300005937 Bacteria 4990
49 Ga0068871_100122834 3300006358 Bacteria 2195
50 Ga0068871_100138963 3300006358 Bacteria 2064
51 Ga0075428_100004358 3300006844 Bacteria 15615
52 Ga0075428_100034070 3300006844 Bacteria 5618
53 Ga0075428_100053322 3300006844 Bacteria 4431
54 Ga0075428_100060074 3300006844 Bacteria 4163
55 Ga0075430_100049230 3300006846 Bacteria 3557
56 Ga0075431_100040870 3300006847 Bacteria 4781
57 Ga0075433_10008279 3300006852 Bacteria 8288
58 Ga0075433_10019785 3300006852 Bacteria 5618
59 Ga0075429_100157439 3300006880 Bacteria 1989
60 Ga0105240_10020988 3300009093 Bacteria 8694
61 Ga0105240_10058550 3300009093 Bacteria 4810
62 Ga0111539_10004601 3300009094 Bacteria 18029
63 Ga0111539_10040646 3300009094 Bacteria 5596
64 Ga0105245_10011006 3300009098 Bacteria 7874
65 Ga0114129_10002348 3300009147 Bacteria 26266
66 Ga0114129_10003113 3300009147 Bacteria 23270
67 Ga0114129_10034145 3300009147 Bacteria 7184
68 Ga0114129_10056945 3300009147 Bacteria 5472
69 Ga0114129_10281278 3300009147 Bacteria 2223
70 Ga0114129_10481134 3300009147 Bacteria 1624
71 Ga0105243_10034602 3300009148 Bacteria 3912
72 Ga0105241_10010055 3300009174 Bacteria 6945
73 Ga0105241_10053050 3300009174 Bacteria 3099
74 Ga0105237_10005776 3300009545 Bacteria 13899
75 Ga0105237_10025718 3300009545 Bacteria 6018
76 Ga0105237_10031510 3300009545 Bacteria 5375
77 Ga0105237_10101368 3300009545 Unclassified 2871
78 Ga0105238_10000455 3300009551 Bacteria 42985
79 Ga0105238_10012313 3300009551 Bacteria 8626
80 Ga0105238_10154348 3300009551 Bacteria 2271
81 Ga0105238_10174037 3300009551 Bacteria 2129
82 Ga0105239_10003792 3300010375 Bacteria 18399
83 Ga0105239_10017083 3300010375 Bacteria 8021
84 Ga0105239_10114146 3300010375 Bacteria 2996
85 Ga0105239_10135199 3300010375 Bacteria 2745
86 Ga0105239_10198200 3300010375 Bacteria 2249
87 Ga0157370_10197134 3300013104 Bacteria 1869
88 Ga0157369_10134354 3300013105 Bacteria 2620
89 Ga0157374_10007637 3300013296 Bacteria 9229
90 Ga0157378_10014867 3300013297 Bacteria 6811
91 Ga0163162_10003854 3300013306 Bacteria 14395
92 Ga0157375_10011341 3300013308 Bacteria 7870
93 Ga0157375_10030806 3300013308 Bacteria 5063
94 Ga0163163_10041543 3300014325 Bacteria 4498
95 Ga0157380_10073052 3300014326 Bacteria 2780
96 Ga0207705_10024474 3300025909 Bacteria 4308
97 Ga0207654_10027483 3300025911 Bacteria 3092
98 Ga0207707_10026048 3300025912 Bacteria 5114
99 Ga0207707_10099350 3300025912 Bacteria 2543
100 Ga0207695_10018629 3300025913 Bacteria 8022
101 Ga0207695_10046601 3300025913 Bacteria 4595
102 Ga0207671_10022709 3300025914 Bacteria 4739
103 Ga0207671_10051510 3300025914 Bacteria 3051
104 Ga0207671_10058444 3300025914 Unclassified 2859
105 Ga0207657_10002108 3300025919 Bacteria 21511
106 Ga0207646_10001528 3300025922 Bacteria 28314
107 Ga0207681_10012313 3300025923 Bacteria 5276
108 Ga0207681_10132091 3300025923 Bacteria 1847
109 Ga0207694_10020577 3300025924 Bacteria 4995
110 Ga0207694_10063157 3300025924 Bacteria 2885
111 Ga0207650_10029981 3300025925 Bacteria 3915
112 Ga0207644_10039313 3300025931 Bacteria 3339
113 Ga0207691_10009248 3300025940 Bacteria 9455
114 Ga0207711_10010648 3300025941 Bacteria 7647
115 Ga0207667_10004290 3300025949 Bacteria 17469
116 Ga0207667_10020535 3300025949 Bacteria 7341
117 Ga0207667_10023689 3300025949 Bacteria 6758
118 Ga0207667_10085737 3300025949 Bacteria 3260
119 Ga0207651_10020116 3300025960 Bacteria 4020
120 Ga0207712_10104368 3300025961 Bacteria 2113
121 Ga0207658_10026622 3300025986 Bacteria 4056
122 Ga0207703_10007527 3300026035 Bacteria 8642
123 Ga0207639_10002811 3300026041 Bacteria 11679
124 Ga0207639_10099738 3300026041 Bacteria 2344
125 Ga0207708_10143595 3300026075 Bacteria 1874
126 Ga0207702_10115440 3300026078 Bacteria 2394
127 Ga0207702_10250655 3300026078 Bacteria 1663
128 Ga0207641_10004998 3300026088 Bacteria 11371
129 Ga0207676_10082659 3300026095 Bacteria 2613
130 Ga0207674_10007094 3300026116 Bacteria 13093
131 Ga0207674_10016523 3300026116 Bacteria 8075
132 Ga0207674_10142902 3300026116 Unclassified 2352
133 Ga0207675_100010143 3300026118 Bacteria 8829
134 Ga0207428_10012386 3300027907 Bacteria 7493
135 Ga0268266_10108976 3300028379 Bacteria 2451
136 Ga0268265_10007559 3300028380 Bacteria 7335
137 Ga0268265_10012860 3300028380 Bacteria 5681
138 Ga0268264_10311533 3300028381 Bacteria 1485
139 Ga0265338_10019993 3300028800 Bacteria 7068
140 Ga0265332_10015897 3300031238 Bacteria 3321
141 Ga0265332_10055864 3300031238 Bacteria 1692
142 Ga0265325_10000503 3300031241 Bacteria 28242
143 Ga0265339_10000890 3300031249 Bacteria 22943
144 Ga0265331_10004006 3300031250 Bacteria 9301
145 Ga0265331_10026158 3300031250 Bacteria 2937
146 Ga0265314_10001541 3300031711 Bacteria 25411
147 Ga0265314_10047070 3300031711 Bacteria 3038
148 Ga0265342_10078121 3300031712 Bacteria 1916
149 Ga0395905_0213658 3300037471 Bacteria 1807
150 Ga0451577_0002463 3300042876 Bacteria 22008
151 Ga0495643_0000290 3300046522 Bacteria 71544
152 Ga0495658_0040163 3300046683 Bacteria 2600
153 Ga0496126_0146469 3300048929 Bacteria 2028
154 Ga0501034_0012729 3300049571 Bacteria 8677
155 Ga0501034_0114624 3300049571 Bacteria 2684
156 Ga0501036_0057455 3300049572 Bacteria 3296
157 Ga0501036_0180878 3300049572 Bacteria 1775
158 Ga0501037_0067332 3300049573 Bacteria 2608
159 Ga0501040_0157648 3300049576 Bacteria 1603
160 Ga0501041_0059556 3300049577 Bacteria 2337
161 Ga0501043_0111412 3300049579 Bacteria 2149
162 Ga0501046_0043601 3300049580 Bacteria 3571
163 Ga0501047_0003958 3300049581 Bacteria 13928
164 Ga0501048_0096647 3300049582 Bacteria 2083
165 Ga0501072_0052614 3300049588 Bacteria 3206
166 Ga0501075_0029789 3300049591 Bacteria 4038
167 Ga0501076_0036183 3300049592 Bacteria 3867
168 Ga0501079_0084098 3300049741 Bacteria 2462
169 Ga0501081_0133667 3300049743 Bacteria 1774
170 Ga0501044_0149457 3300049823 Bacteria 2319
171 Ga0501045_0049300 3300049824 Bacteria 3070
172 nmdc:mga0k408_47843_c1 3300050493 Bacteria 2472
173 nmdc:mga05p37_14243_c1 3300050507 Bacteria 9550
174 nmdc:mga05p37_2363_c1 3300050507 Bacteria 21951
175 nmdc:mga05p37_288221_c1 3300050507 Bacteria 1955
176 nmdc:mga05p37_60395_c1 3300050507 Bacteria 4668
177 nmdc:mga05p37_78175_c1 3300050507 Bacteria 4074
178 nmdc:mga06r32_38773_c1 3300050510 Bacteria 4517
179 nmdc:mga08y16_9027_c1 3300050511 Bacteria 10469
180 nmdc:mga0a205_3110_c1 3300050515 Bacteria 14723
181 nmdc:mga0a205_68835_c1 3300050515 Bacteria 3418
182 Ga0495601_0007175 3300053077 Bacteria 6537
183 Ga0500559_0023113 3300053136 Bacteria 2638
184 Ga0500616_0005371 3300053153 Bacteria 8719
185 Ga0501084_0039079 3300054114 Bacteria 3969
186 Ga0501082_0298430 3300060353 Bacteria 1403
187 2673163432 2671180531 Bacteria 9045424
188 2687234829 2684623219 Bacteria 8442773
189 2687235082 2684623219 Bacteria 8442773
190 2687236321 2684623219 Bacteria 8442773
191 2687240400 2684623219 Bacteria 8442773
192 Ga0070669_100034391
193 Ga0065707_10090523
194 Ga0070658_10007916
195 Ga0070658_10021577
196 Ga0070670_100110795
197 Ga0070666_10011178
198 Ga0068868_100005606
199 Ga0070660_100009971
200 Ga0070669_100036642
201 Ga0070669_100053989
202 Ga0070675_100010953
203 Ga0070671_100008083
204 Ga0070671_100014493
205 Ga0070673_100020031
206 Ga0070688_100032034
207 Ga0070667_100004033
208 Ga0070705_100088786
209 Ga0070681_10017633
210 Ga0070681_10153308
211 Ga0070685_10006316
212 Ga0070707_100001031
213 Ga0070699_100135494
214 Ga0070679_100148623
215 Ga0068853_100012657
216 Ga0068853_100016516
217 Ga0070696_100023510
218 Ga0070665_100003635
219 Ga0070665_100080204
220 Ga0068855_100003685
221 Ga0068855_100031027
222 Ga0068855_100074175
223 Ga0068855_100123825
224 Ga0068855_100131512
225 Ga0068855_100222037
226 Ga0068857_100019351
227 Ga0068857_100028861
228 Ga0068856_100010815
229 Ga0068856_100012474
230 Ga0070702_100097224
231 Ga0068864_100057561
232 Ga0068861_100034028
233 Ga0068861_100161647
234 Ga0068858_100010258
235 Ga0068858_100042508
236 Ga0068862_100002180
237 Ga0068862_100032836
238 Ga0081455_10010235
239 Ga0081455_10029606
240 Ga0068871_100122834
241 Ga0068871_100138963
242 Ga0075428_100004358
243 Ga0075428_100034070
244 Ga0075428_100053322
245 Ga0075428_100060074
246 Ga0075430_100049230
247 Ga0075431_100040870
248 Ga0075433_10008279
249 Ga0075433_10019785
250 Ga0075429_100157439
251 Ga0105240_10020988
252 Ga0105240_10058550
253 Ga0111539_10004601
254 Ga0111539_10040646
255 Ga0105245_10011006
256 Ga0114129_10002348
257 Ga0114129_10003113
258 Ga0114129_10034145
259 Ga0114129_10056945
260 Ga0114129_10281278
261 Ga0114129_10481134
262 Ga0105243_10034602
263 Ga0105241_10010055
264 Ga0105241_10053050
265 Ga0105237_10005776
266 Ga0105237_10025718
267 Ga0105237_10031510
268 Ga0105237_10101368
269 Ga0105238_10000455
270 Ga0105238_10012313
271 Ga0105238_10154348
272 Ga0105238_10174037
273 Ga0105239_10003792
274 Ga0105239_10017083
275 Ga0105239_10114146
276 Ga0105239_10135199
277 Ga0105239_10198200
278 Ga0157370_10197134
279 Ga0157369_10134354
280 Ga0157374_10007637
281 Ga0157378_10014867
282 Ga0163162_10003854
283 Ga0157375_10011341
284 Ga0157375_10030806
285 Ga0163163_10041543
286 Ga0157380_10073052
287 Ga0207705_10024474
288 Ga0207654_10027483
289 Ga0207707_10026048
290 Ga0207707_10099350
291 Ga0207695_10018629
292 Ga0207695_10046601
293 Ga0207671_10022709
294 Ga0207671_10051510
295 Ga0207671_10058444
296 Ga0207657_10002108
297 Ga0207646_10001528
298 Ga0207681_10012313
299 Ga0207681_10132091
300 Ga0207694_10020577
301 Ga0207694_10063157
302 Ga0207650_10029981
303 Ga0207644_10039313
304 Ga0207691_10009248
305 Ga0207711_10010648
306 Ga0207667_10004290
307 Ga0207667_10020535
308 Ga0207667_10023689
309 Ga0207667_10085737
310 Ga0207651_10020116
311 Ga0207712_10104368
312 Ga0207658_10026622
313 Ga0207703_10007527
314 Ga0207639_10002811
315 Ga0207639_10099738
316 Ga0207708_10143595
317 Ga0207702_10115440
318 Ga0207702_10250655
319 Ga0207641_10004998
320 Ga0207676_10082659
321 Ga0207674_10007094
322 Ga0207674_10016523
323 Ga0207674_10142902
324 Ga0207675_100010143
325 Ga0207428_10012386
326 Ga0268266_10108976
327 Ga0268265_10007559
328 Ga0268265_10012860
329 Ga0268264_10311533
330 Ga0265338_10019993
331 Ga0265332_10015897
332 Ga0265332_10055864
333 Ga0265325_10000503
334 Ga0265339_10000890
335 Ga0265331_10004006
336 Ga0265331_10026158
337 Ga0265314_10001541
338 Ga0265314_10047070
339 Ga0265342_10078121
340 Ga0395905_0213658
341 Ga0451577_0002463
342 Ga0495643_0000290
343 Ga0495658_0040163
344 Ga0496126_0146469
345 Ga0501034_0012729
346 Ga0501034_0114624
347 Ga0501036_0057455
348 Ga0501036_0180878
349 Ga0501037_0067332
350 Ga0501040_0157648
351 Ga0501041_0059556
352 Ga0501043_0111412
353 Ga0501046_0043601
354 Ga0501047_0003958
355 Ga0501048_0096647
356 Ga0501072_0052614
357 Ga0501075_0029789
358 Ga0501076_0036183
359 Ga0501079_0084098
360 Ga0501081_0133667
361 Ga0501044_0149457
362 Ga0501045_0049300
363 nmdc:mga0k408_47843_c1
364 nmdc:mga05p37_14243_c1
365 nmdc:mga05p37_2363_c1
366 nmdc:mga05p37_288221_c1
367 nmdc:mga05p37_60395_c1
368 nmdc:mga05p37_78175_c1
369 nmdc:mga06r32_38773_c1
370 nmdc:mga08y16_9027_c1
371 nmdc:mga0a205_3110_c1
372 nmdc:mga0a205_68835_c1
373 Ga0495601_0007175
374 Ga0500559_0023113
375 Ga0500616_0005371
376 Ga0501084_0039079
377 Ga0501082_0298430
378 2673163432
379 2687234829
380 2687235082
381 2687236321
382 2687240400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

69

515

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zg7-assembly1.cif.gz_A structural basis for inhibition of human autotaxin by four novel compounds 0.6958 315 389
5mhp-assembly1.cif.gz_A novel imidazo[1,2-a]pyridine derivatives with potent autotaxin/enpp2 inhibitor activity 0.6918 315 389
6y5m-assembly1.cif.gz_A crystal structure of mouse autotaxin in complex with compound 1a 0.6908 315 389
2xr9-assembly1.cif.gz_A crystal structure of autotaxin (enpp2) 0.6884 315 389
5ijs-assembly1.cif.gz_A crystal structure of autotaxin with orthovanadate bound as a trigonal bipyramidal intermediate analog 0.6853 315 389
ID Description Score Start End Superfamily
af_Q4DMU3_256_347_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.6041 236 281 1.20.272.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5926 67 449 3.40.720.10
af_O45359_17_416_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5858 305 479 3.40.720.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5805 67 449 3.40.720.10
af_P75785_205_504_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5727 65 450 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A225DNH9-F1-model_v4 Sulfatase 0.9652 359 479
AF-A0A3B8KYX2-F1-model_v4 DUF1501 domain-containing protein 0.9648 365 479
AF-A0A353Z806-F1-model_v4 DUF1501 domain-containing protein 0.9617 353 479
AF-A0A1N6DNS1-F1-model_v4 Planctomycete cytochrome C 0.9601 66 479 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E7L5W7-F1-model_v4 DUF1501 domain-containing protein 0.9595 406 479

Map