F293137

General Info

Members Datasets Scaffolds Average Seq Length
190 137 380 134

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0154110|Ga0501039_0154110_48_464
Length 138
Sequence MLGRIHHVAYVVADIDAALERLGATFDLRPAVREVMADQGVEAALCGPAGAAVELIRPLDADGAIARFLEARGEGLHHVAFEVADLEAALTELRARGAELIDERPRAGLGGHLVAFVHPRSANGVLTELVEAEGDRAH

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
68 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
69 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.58
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 20.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0154110 3300049575 Bacteria 1805
2 JGI25405J52794_10020205 3300003911 Bacteria 1340
3 Ga0070689_100382148 3300005340 Bacteria 1187
4 Ga0070668_101201137 3300005347 Unclassified 687
5 Ga0070674_100379761 3300005356 Bacteria 1149
6 Ga0070674_100511099 3300005356 Bacteria 1002
7 Ga0070667_100002001 3300005367 Bacteria 18056
8 Ga0070700_100438294 3300005441 Bacteria 991
9 Ga0070662_100230615 3300005457 Bacteria 1481
10 Ga0070685_10709299 3300005466 Bacteria 734
11 Ga0070706_101321177 3300005467 Bacteria 661
12 Ga0070707_100388014 3300005468 Unclassified 1356
13 Ga0070699_100643233 3300005518 Bacteria 968
14 Ga0070684_100673478 3300005535 Bacteria 964
15 Ga0070697_101319662 3300005536 Bacteria 644
16 Ga0068855_100036745 3300005563 Bacteria 5827
17 Ga0068855_100142549 3300005563 Bacteria 2730
18 Ga0068856_100916691 3300005614 Bacteria 895
19 Ga0081455_10004665 3300005937 Bacteria 15258
20 Ga0081455_10058792 3300005937 Bacteria 3250
21 Ga0075433_10844959 3300006852 Unclassified 799
22 Ga0075434_101667068 3300006871 Unclassified 646
23 Ga0068865_101000641 3300006881 Bacteria 732
24 Ga0075436_100166392 3300006914 Bacteria 1556
25 Ga0105240_10009134 3300009093 Bacteria 14072
26 Ga0105240_10783623 3300009093 Bacteria 1034
27 Ga0111539_11270074 3300009094 Unclassified 855
28 Ga0111539_11287728 3300009094 Unclassified 848
29 Ga0105245_10200219 3300009098 Bacteria 1917
30 Ga0105245_10507727 3300009098 Unclassified 1222
31 Ga0114129_11045292 3300009147 Unclassified 1026
32 Ga0105243_10190611 3300009148 Unclassified 1790
33 Ga0105243_10354147 3300009148 Bacteria 1349
34 Ga0105239_10064870 3300010375 Bacteria 4009
35 Ga0105239_10124941 3300010375 Bacteria 2859
36 Ga0105239_10384580 3300010375 Bacteria 1587
37 Ga0157339_1039412 3300012505 Bacteria 587
38 Ga0157370_10005135 3300013104 Bacteria 14764
39 Ga0157369_10002470 3300013105 Bacteria 22156
40 Ga0157378_10246245 3300013297 Bacteria 1710
41 Ga0163162_10692482 3300013306 Unclassified 1141
42 Ga0163163_10998351 3300014325 Bacteria 900
43 Ga0157376_11980594 3300014969 Bacteria 620
44 Ga0206356_11789866 3300020070 Bacteria 648
45 Ga0206354_10656512 3300020081 Unclassified 1629
46 Ga0206353_10595646 3300020082 Bacteria 3426
47 Ga0207653_10142139 3300025885 Unclassified 878
48 Ga0207642_10367935 3300025899 Unclassified 852
49 Ga0207705_10058762 3300025909 Bacteria 2774
50 Ga0207646_10244933 3300025922 Bacteria 1619
51 Ga0207646_10327333 3300025922 Unclassified 1384
52 Ga0207687_10497305 3300025927 Bacteria 1017
53 Ga0207687_11095763 3300025927 Bacteria 684
54 Ga0207706_10419668 3300025933 Unclassified 1159
55 Ga0207711_10975499 3300025941 Bacteria 787
56 Ga0207667_10211949 3300025949 Bacteria 1985
57 Ga0207667_10283606 3300025949 Bacteria 1692
58 Ga0207667_10309683 3300025949 Unclassified 1613
59 Ga0207712_10246107 3300025961 Unclassified 1443
60 Ga0207668_11309346 3300025972 Unclassified 652
61 Ga0207658_10026210 3300025986 Bacteria 4085
62 Ga0207708_10610053 3300026075 Bacteria 925
63 Ga0207698_10298868 3300026142 Bacteria 1498
64 Ga0265318_10149918 3300028577 Bacteria 856
65 Ga0265338_10131381 3300028800 Bacteria 1976
66 Ga0265338_10328777 3300028800 Bacteria 1105
67 Ga0265320_10159244 3300031240 Bacteria 1017
68 Ga0307408_101247246 3300031548 Bacteria 695
69 Ga0307405_10781523 3300031731 Bacteria 798
70 Ga0307412_11109493 3300031911 Bacteria 704
71 Ga0307415_100134088 3300032126 Bacteria 1880
72 Ga0373956_0326705 3300035119 Bacteria 731
73 Ga0373943_0300030 3300035170 Bacteria 912
74 Ga0395899_0084210 3300037312 Bacteria 2311
75 Ga0395899_0459101 3300037312 Unclassified 833
76 Ga0395900_0042253 3300037418 Bacteria 4696
77 Ga0395900_0719786 3300037418 Bacteria 930
78 Ga0395898_0059385 3300037466 Bacteria 3721
79 Ga0395905_0110980 3300037471 Bacteria 2575
80 Ga0395905_0224450 3300037471 Bacteria 1758
81 Ga0395901_0044800 3300038443 Bacteria 4588
82 Ga0395901_0150018 3300038443 Bacteria 2450
83 Ga0395901_0478647 3300038443 Bacteria 1270
84 Ga0395901_0662417 3300038443 Bacteria 1046
85 Ga0436363_0545451 3300039450 Bacteria 675
86 Ga0451853_2644876 3300041512 Unclassified 927
87 Ga0450908_045041 3300042184 Bacteria 766
88 Ga0439434_0296020 3300042435 Bacteria 559
89 Ga0450916_035762 3300042530 Bacteria 739
90 Ga0466963_0004144 3300044694 Bacteria 8387
91 Ga0466957_0021911 3300044842 Bacteria 3768
92 Ga0466957_0497687 3300044842 Bacteria 845
93 Ga0451576_0378659 3300045051 Unclassified 1483
94 Ga0466958_0079407 3300045836 Bacteria 2017
95 Ga0466967_0051481 3300045976 Bacteria 3609
96 Ga0466967_0388486 3300045976 Bacteria 1356
97 Ga0466967_0673280 3300045976 Unclassified 1024
98 Ga0466967_0866551 3300045976 Bacteria 898
99 Ga0495592_0153340 3300046454 Unclassified 1591
100 Ga0495629_0032511 3300046459 Bacteria 3693
101 Ga0495629_0176982 3300046459 Bacteria 1479
102 Ga0495641_0032455 3300046461 Bacteria 2485
103 Ga0495582_0104993 3300046473 Bacteria 1584
104 Ga0495582_0177751 3300046473 Bacteria 1212
105 Ga0495664_0618914 3300046477 Unclassified 643
106 Ga0495608_0034473 3300046511 Bacteria 3416
107 Ga0495608_0754003 3300046511 Bacteria 577
108 Ga0495618_0125480 3300046514 Bacteria 1644
109 Ga0495628_0051179 3300046516 Bacteria 3266
110 Ga0495628_0312182 3300046516 Bacteria 1162
111 Ga0495630_0002134 3300046517 Bacteria 13757
112 Ga0495630_0095949 3300046517 Bacteria 2242
113 Ga0495630_0281931 3300046517 Bacteria 1269
114 Ga0495630_1203067 3300046517 Bacteria 573
115 Ga0495666_0308834 3300046526 Bacteria 714
116 Ga0495640_0014274 3300046533 Bacteria 6018
117 Ga0495640_0207557 3300046533 Bacteria 1240
118 Ga0495586_0008339 3300046535 Bacteria 5515
119 Ga0495586_0163390 3300046535 Bacteria 1256
120 Ga0495587_0421355 3300046536 Unclassified 741
121 Ga0495598_0072423 3300046537 Bacteria 1088
122 Ga0495645_0327374 3300046543 Unclassified 993
123 Ga0495633_0298510 3300046558 Bacteria 732
124 Ga0495667_0012309 3300046559 Bacteria 5799
125 Ga0495656_0597584 3300046615 Unclassified 590
126 Ga0495634_0099056 3300046642 Bacteria 1885
127 Ga0495657_0052841 3300046675 Bacteria 2722
128 Ga0495613_0043435 3300046689 Bacteria 3325
129 Ga0495600_0805607 3300046809 Unclassified 559
130 Ga0495581_0041608 3300047315 Bacteria 2660
131 Ga0495674_0009083 3300047319 Bacteria 9443
132 Ga0495674_0117574 3300047319 Bacteria 2249
133 Ga0495674_1122811 3300047319 Unclassified 597
134 Ga0495680_0002425 3300047322 Bacteria 19080
135 Ga0495675_0361487 3300047444 Bacteria 852
136 Ga0495684_0010008 3300047471 Bacteria 7331
137 Ga0496100_0379093 3300048903 Unclassified 1074
138 Ga0496101_0942197 3300048904 Unclassified 679
139 Ga0496102_0079562 3300048905 Bacteria 3019
140 Ga0496103_0251517 3300048906 Bacteria 1137
141 Ga0496104_0517541 3300048907 Bacteria 1104
142 Ga0496104_0873194 3300048907 Unclassified 805
143 Ga0496104_1575415 3300048907 Bacteria 560
144 Ga0496105_0524641 3300048908 Bacteria 927
145 Ga0496105_1044047 3300048908 Bacteria 609
146 Ga0496107_0068559 3300048910 Bacteria 2574
147 Ga0496108_0499985 3300048911 Bacteria 1062
148 Ga0496108_1263643 3300048911 Unclassified 622
149 Ga0496110_0004103 3300048913 Bacteria 11247
150 Ga0496110_0094719 3300048913 Bacteria 2674
151 Ga0496111_0000750 3300048914 Bacteria 17306
152 Ga0496112_1645744 3300048915 Bacteria 555
153 Ga0496114_0184931 3300048917 Bacteria 1821
154 Ga0496114_0415398 3300048917 Bacteria 1191
155 Ga0496114_1100915 3300048917 Unclassified 679
156 Ga0496114_1169960 3300048917 Bacteria 655
157 Ga0496115_0138929 3300048918 Bacteria 2004
158 Ga0496115_0235059 3300048918 Unclassified 1511
159 Ga0501038_0211345 3300049574 Bacteria 1552
160 Ga0501039_1550055 3300049575 Bacteria 509
161 Ga0501040_1027407 3300049576 Unclassified 598
162 Ga0501041_0369213 3300049577 Bacteria 908
163 Ga0501042_0077049 3300049578 Bacteria 2387
164 Ga0501046_0103360 3300049580 Bacteria 2184
165 Ga0501048_0540793 3300049582 Unclassified 836
166 Ga0501067_0570169 3300049583 Bacteria 634
167 Ga0501068_0548027 3300049584 Bacteria 752
168 Ga0501071_1247102 3300049587 Bacteria 574
169 Ga0501072_1134246 3300049588 Bacteria 608
170 Ga0501072_1322153 3300049588 Bacteria 558
171 Ga0501074_0391450 3300049590 Bacteria 986
172 Ga0501075_0076732 3300049591 Bacteria 2528
173 Ga0501075_0566894 3300049591 Bacteria 866
174 Ga0501076_0318661 3300049592 Bacteria 1275
175 Ga0501076_1477792 3300049592 Bacteria 558
176 Ga0501077_0445061 3300049593 Bacteria 829
177 Ga0501079_0060598 3300049741 Bacteria 2919
178 Ga0501079_0152648 3300049741 Bacteria 1800
179 Ga0501081_0044725 3300049743 Bacteria 3040
180 Ga0501081_0125818 3300049743 Bacteria 1828
181 Ga0501045_0040213 3300049824 Bacteria 3404
182 Ga0501045_0160855 3300049824 Bacteria 1671
183 nmdc:mga08y16_1369854_c1 3300050511 Unclassified 672
184 Ga0495595_0069739 3300053084 Bacteria 1660
185 Ga0495619_0310537 3300053085 Bacteria 1092
186 Ga0501084_0098646 3300054114 Bacteria 2453
187 Ga0501082_0026447 3300060353 Bacteria 5001
188 Ga0501082_0204050 3300060353 Bacteria 1720
189 Ga0501082_0388556 3300060353 Unclassified 1218
190 Ga0530510_0045189 3300061734 Bacteria 3182
191 Ga0501039_0154110
192 JGI25405J52794_10020205
193 Ga0070689_100382148
194 Ga0070668_101201137
195 Ga0070674_100379761
196 Ga0070674_100511099
197 Ga0070667_100002001
198 Ga0070700_100438294
199 Ga0070662_100230615
200 Ga0070685_10709299
201 Ga0070706_101321177
202 Ga0070707_100388014
203 Ga0070699_100643233
204 Ga0070684_100673478
205 Ga0070697_101319662
206 Ga0068855_100036745
207 Ga0068855_100142549
208 Ga0068856_100916691
209 Ga0081455_10004665
210 Ga0081455_10058792
211 Ga0075433_10844959
212 Ga0075434_101667068
213 Ga0068865_101000641
214 Ga0075436_100166392
215 Ga0105240_10009134
216 Ga0105240_10783623
217 Ga0111539_11270074
218 Ga0111539_11287728
219 Ga0105245_10200219
220 Ga0105245_10507727
221 Ga0114129_11045292
222 Ga0105243_10190611
223 Ga0105243_10354147
224 Ga0105239_10064870
225 Ga0105239_10124941
226 Ga0105239_10384580
227 Ga0157339_1039412
228 Ga0157370_10005135
229 Ga0157369_10002470
230 Ga0157378_10246245
231 Ga0163162_10692482
232 Ga0163163_10998351
233 Ga0157376_11980594
234 Ga0206356_11789866
235 Ga0206354_10656512
236 Ga0206353_10595646
237 Ga0207653_10142139
238 Ga0207642_10367935
239 Ga0207705_10058762
240 Ga0207646_10244933
241 Ga0207646_10327333
242 Ga0207687_10497305
243 Ga0207687_11095763
244 Ga0207706_10419668
245 Ga0207711_10975499
246 Ga0207667_10211949
247 Ga0207667_10283606
248 Ga0207667_10309683
249 Ga0207712_10246107
250 Ga0207668_11309346
251 Ga0207658_10026210
252 Ga0207708_10610053
253 Ga0207698_10298868
254 Ga0265318_10149918
255 Ga0265338_10131381
256 Ga0265338_10328777
257 Ga0265320_10159244
258 Ga0307408_101247246
259 Ga0307405_10781523
260 Ga0307412_11109493
261 Ga0307415_100134088
262 Ga0373956_0326705
263 Ga0373943_0300030
264 Ga0395899_0084210
265 Ga0395899_0459101
266 Ga0395900_0042253
267 Ga0395900_0719786
268 Ga0395898_0059385
269 Ga0395905_0110980
270 Ga0395905_0224450
271 Ga0395901_0044800
272 Ga0395901_0150018
273 Ga0395901_0478647
274 Ga0395901_0662417
275 Ga0436363_0545451
276 Ga0451853_2644876
277 Ga0450908_045041
278 Ga0439434_0296020
279 Ga0450916_035762
280 Ga0466963_0004144
281 Ga0466957_0021911
282 Ga0466957_0497687
283 Ga0451576_0378659
284 Ga0466958_0079407
285 Ga0466967_0051481
286 Ga0466967_0388486
287 Ga0466967_0673280
288 Ga0466967_0866551
289 Ga0495592_0153340
290 Ga0495629_0032511
291 Ga0495629_0176982
292 Ga0495641_0032455
293 Ga0495582_0104993
294 Ga0495582_0177751
295 Ga0495664_0618914
296 Ga0495608_0034473
297 Ga0495608_0754003
298 Ga0495618_0125480
299 Ga0495628_0051179
300 Ga0495628_0312182
301 Ga0495630_0002134
302 Ga0495630_0095949
303 Ga0495630_0281931
304 Ga0495630_1203067
305 Ga0495666_0308834
306 Ga0495640_0014274
307 Ga0495640_0207557
308 Ga0495586_0008339
309 Ga0495586_0163390
310 Ga0495587_0421355
311 Ga0495598_0072423
312 Ga0495645_0327374
313 Ga0495633_0298510
314 Ga0495667_0012309
315 Ga0495656_0597584
316 Ga0495634_0099056
317 Ga0495657_0052841
318 Ga0495613_0043435
319 Ga0495600_0805607
320 Ga0495581_0041608
321 Ga0495674_0009083
322 Ga0495674_0117574
323 Ga0495674_1122811
324 Ga0495680_0002425
325 Ga0495675_0361487
326 Ga0495684_0010008
327 Ga0496100_0379093
328 Ga0496101_0942197
329 Ga0496102_0079562
330 Ga0496103_0251517
331 Ga0496104_0517541
332 Ga0496104_0873194
333 Ga0496104_1575415
334 Ga0496105_0524641
335 Ga0496105_1044047
336 Ga0496107_0068559
337 Ga0496108_0499985
338 Ga0496108_1263643
339 Ga0496110_0004103
340 Ga0496110_0094719
341 Ga0496111_0000750
342 Ga0496112_1645744
343 Ga0496114_0184931
344 Ga0496114_0415398
345 Ga0496114_1100915
346 Ga0496114_1169960
347 Ga0496115_0138929
348 Ga0496115_0235059
349 Ga0501038_0211345
350 Ga0501039_1550055
351 Ga0501040_1027407
352 Ga0501041_0369213
353 Ga0501042_0077049
354 Ga0501046_0103360
355 Ga0501048_0540793
356 Ga0501067_0570169
357 Ga0501068_0548027
358 Ga0501071_1247102
359 Ga0501072_1134246
360 Ga0501072_1322153
361 Ga0501074_0391450
362 Ga0501075_0076732
363 Ga0501075_0566894
364 Ga0501076_0318661
365 Ga0501076_1477792
366 Ga0501077_0445061
367 Ga0501079_0060598
368 Ga0501079_0152648
369 Ga0501081_0044725
370 Ga0501081_0125818
371 Ga0501045_0040213
372 Ga0501045_0160855
373 nmdc:mga08y16_1369854_c1
374 Ga0495595_0069739
375 Ga0495619_0310537
376 Ga0501084_0098646
377 Ga0501082_0026447
378 Ga0501082_0204050
379 Ga0501082_0388556
380 Ga0530510_0045189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

116

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

129

0.91

PF13468

Glyoxalase_3

Glyoxalase-like domain

5

137

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i4h-assembly1.cif.gz_A structural studies of protein tyrosine phosphatase beta catalytic domain co-crystallized with a sulfamic acid inhibitor 0.8037 19 49
8jqq-assembly1.cif.gz_B protocatecuate hydroxylase from xylophilus ampelinus c347t mutant 0.787 19 49
2r5v-assembly2.cif.gz_B hydroxymandelate synthase crystal structure 0.7865 2 123
2i3r-assembly2.cif.gz_B engineered catalytic domain of protein tyrosine phosphatase hptpbeta 0.7819 19 49
2r5v-assembly1.cif.gz_A hydroxymandelate synthase crystal structure 0.7674 2 123
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8768 1 48 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8269 66 120 3.30.720.110
af_Q6ZDH1_135_440_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8179 19 50 2.130.10.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8101 66 122 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7993 66 121 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A0F8X1U4-F1-model_v4 VOC domain-containing protein 1.002 70 123 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W0S5D7-F1-model_v4 VOC family protein 0.9985 1 65
AF-A0A7X8DPA0-F1-model_v4 Methylmalonyl-CoA epimerase 0.9803 67 123 GO:0004493
GO:0046491
GO:0046872
AF-A0A0F8X1U4-F1-model_v4 VOC domain-containing protein 0.9659 70 123 GO:0004493
GO:0046491
GO:0046872
AF-A0A7C1NF24-F1-model_v4 VOC domain-containing protein 0.9583 2 64

Map