F292852

General Info

Members Datasets Scaffolds Average Seq Length
190 122 380 395

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_209037|Ga0400483_209037_695_1975
Length 426
Sequence MRISVYLILKMRFFVYYRKCIVLGVVKYFFWGNTMKNTRLFTSESVTEGHPDKMCDQISDAVLDAIFAEDPQSRVACETATSTGLVLVMGEISTDCYVDIPKIARDTVIEIGYDRAKYGFDGNTCSVLTSINEQSKDIAQGVDNSIETRDGDEHDTGAGDQGMMFGFACKETDVLMPMPIYLAHKMSKRLADVRKQGILDYLRPDGKTQVTVRYEDDKPVAIDTVVVATQHHPDVSHAQIEADIIEHVVKPSLPESLDTSNVKYLINATGRFVIGGPMGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYASRWVAKHVVASGAAEKCEIELAYAIGVAQPVSIMVETFGTGKMSDKEIITAIGDVFDLRPSKIISELELRRPIYKQTASYGHFGRDDLNLPWEQLSKLEEFKKAIKA

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
122 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.26
Metatranscriptomes 4.21
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0
Rhizoplane 6.32
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_209037 3300039062 Bacteria 2579
2 Ga0070683_100004912 3300005329 Bacteria 11085
3 Ga0070689_100002502 3300005340 Bacteria 12021
4 Ga0070691_10004560 3300005341 Bacteria 6291
5 Ga0070668_100024620 3300005347 Bacteria 4561
6 Ga0070671_100010933 3300005355 Bacteria 7290
7 Ga0070714_100063495 3300005435 Bacteria 3177
8 Ga0070706_100002063 3300005467 Bacteria 20522
9 Ga0070706_100004298 3300005467 Bacteria 13801
10 Ga0070706_100067383 3300005467 Unclassified 3311
11 Ga0070707_100000982 3300005468 Bacteria 28218
12 Ga0070707_100004178 3300005468 Bacteria 13530
13 Ga0070707_100024289 3300005468 Bacteria 5739
14 Ga0070698_100028803 3300005471 Bacteria 5764
15 Ga0070698_100115749 3300005471 Bacteria 2645
16 Ga0070699_100001566 3300005518 Bacteria 20911
17 Ga0070679_100020962 3300005530 Bacteria 6376
18 Ga0070679_100075520 3300005530 Bacteria 3359
19 Ga0070684_100006507 3300005535 Bacteria 9045
20 Ga0070684_100045348 3300005535 Bacteria 3807
21 Ga0070672_100214263 3300005543 Bacteria 1614
22 Ga0070665_100013564 3300005548 Bacteria 8199
23 Ga0070664_100013705 3300005564 Bacteria 6607
24 Ga0068857_100000634 3300005577 Bacteria 25861
25 Ga0068857_100032542 3300005577 Bacteria 4612
26 Ga0068856_100001652 3300005614 Bacteria 23366
27 Ga0068860_100006729 3300005843 Bacteria 11532
28 Ga0075365_10001960 3300006038 Bacteria 9720
29 Ga0075365_10006571 3300006038 Bacteria 6412
30 Ga0075365_10076337 3300006038 Bacteria 2262
31 Ga0075363_100031813 3300006048 Bacteria 2737
32 Ga0075364_10001780 3300006051 Bacteria 11925
33 Ga0075364_10001966 3300006051 Bacteria 11452
34 Ga0075364_10086777 3300006051 Bacteria 2073
35 Ga0075362_10014963 3300006177 Bacteria 3145
36 Ga0075428_100001806 3300006844 Bacteria 22910
37 Ga0075428_100090239 3300006844 Bacteria 3343
38 Ga0075431_100009441 3300006847 Bacteria 9792
39 Ga0111539_10000963 3300009094 Bacteria 37795
40 Ga0105248_10113675 3300009177 Bacteria 3053
41 Ga0157375_10068218 3300013308 Bacteria 3558
42 Ga0163163_10153290 3300014325 Bacteria 2348
43 Ga0157380_10352271 3300014326 Bacteria 1378
44 Ga0182008_10109570 3300014497 Bacteria 1368
45 Ga0206356_10091574 3300020070 Bacteria 3296
46 Ga0206351_10893835 3300020077 Bacteria 3172
47 Ga0206350_11324271 3300020080 Bacteria 3615
48 Ga0206354_10348709 3300020081 Bacteria 3055
49 Ga0206354_10953110 3300020081 Bacteria 1436
50 Ga0213874_10000058 3300021377 Bacteria 16031
51 Ga0213874_10000996 3300021377 Bacteria 5778
52 Ga0213874_10001957 3300021377 Bacteria 4337
53 Ga0224712_10001971 3300022467 Bacteria 4963
54 Ga0224712_10005366 3300022467 Bacteria 3561
55 Ga0224712_10005533 3300022467 Bacteria 3527
56 Ga0207684_10000805 3300025910 Bacteria 36260
57 Ga0207684_10002720 3300025910 Bacteria 17633
58 Ga0207684_10002823 3300025910 Bacteria 17257
59 Ga0207684_10014787 3300025910 Bacteria 6720
60 Ga0207671_10209841 3300025914 Bacteria 1523
61 Ga0207646_10012261 3300025922 Bacteria 8246
62 Ga0207646_10110710 3300025922 Bacteria 2464
63 Ga0207646_10132515 3300025922 Bacteria 2244
64 Ga0207700_10017586 3300025928 Bacteria 4781
65 Ga0207664_10017903 3300025929 Bacteria 5205
66 Ga0207664_10094279 3300025929 Bacteria 2460
67 Ga0207709_10176622 3300025935 Bacteria 1504
68 Ga0207670_10004618 3300025936 Bacteria 7452
69 Ga0207711_10177443 3300025941 Bacteria 1936
70 Ga0207702_10019730 3300026078 Bacteria 5582
71 Ga0207674_10000337 3300026116 Bacteria 60187
72 Ga0207674_10122104 3300026116 Bacteria 2571
73 Ga0207675_100023940 3300026118 Bacteria 5678
74 Ga0207683_10055218 3300026121 Bacteria 3483
75 Ga0207428_10005443 3300027907 Bacteria 11873
76 Ga0268266_10009165 3300028379 Bacteria 8735
77 Ga0268266_10248468 3300028379 Bacteria 1645
78 Ga0268264_10008573 3300028381 Bacteria 8496
79 Ga0265338_10061835 3300028800 Bacteria 3279
80 Ga0265338_10120404 3300028800 Bacteria 2093
81 Ga0316579_10070358 3300031691 Bacteria 1657
82 Ga0265314_10034168 3300031711 Bacteria 3719
83 Ga0316576_10005344 3300031727 Bacteria 7830
84 Ga0316576_10007168 3300031727 Bacteria 6993
85 Ga0316576_10018146 3300031727 Bacteria 4797
86 Ga0316576_10055129 3300031727 Bacteria 2900
87 Ga0316576_10083966 3300031727 Bacteria 2366
88 Ga0316576_10129694 3300031727 Bacteria 1897
89 Ga0316578_10004054 3300031728 Bacteria 6846
90 Ga0316578_10037651 3300031728 Bacteria 2786
91 Ga0316577_10049147 3300031733 Bacteria 2354
92 Ga0316577_10078637 3300031733 Bacteria 1842
93 Ga0316580_10002317 3300032139 Bacteria 5223
94 Ga0316580_10012489 3300032139 Bacteria 2589
95 Ga0373953_0029183 3300035117 Bacteria 2132
96 Ga0373954_0089312 3300035118 Bacteria 1479
97 Ga0373955_0062158 3300035172 Bacteria 2065
98 Ga0316574_0053673 3300035398 Bacteria 2516
99 Ga0316574_0077673 3300035398 Bacteria 2104
100 Ga0316574_0124394 3300035398 Bacteria 1657
101 Ga0373927_0000153 3300035695 Bacteria 54130
102 Ga0373933_0001704 3300035724 Bacteria 12759
103 Ga0373933_0025834 3300035724 Bacteria 3370
104 Ga0373937_0012265 3300036401 Bacteria 7531
105 Ga0373937_0071238 3300036401 Bacteria 3206
106 Ga0373937_0206420 3300036401 Bacteria 1848
107 Ga0316582_0016336 3300036647 Bacteria 4267
108 Ga0316582_0030587 3300036647 Bacteria 3281
109 Ga0316582_0035322 3300036647 Bacteria 3085
110 Ga0316582_0085113 3300036647 Bacteria 2071
111 Ga0316584_0000221 3300036712 Bacteria 28147
112 Ga0316584_0113675 3300036712 Bacteria 2025
113 Ga0316584_0173821 3300036712 Bacteria 1596
114 Ga0395905_0004652 3300037471 Bacteria 14191
115 Ga0316581_0000880 3300037588 Bacteria 6345
116 Ga0436363_0036629 3300039450 Bacteria 4301
117 Ga0436363_0480609 3300039450 Bacteria 1747
118 Ga0436362_0068908 3300039453 Bacteria 2405
119 Ga0439466_0045845 3300041411 Bacteria 1445
120 Ga0439465_0002885 3300041413 Bacteria 5631
121 Ga0451791_0001851 3300041451 Bacteria 1318
122 Ga0451837_0153293 3300041494 Bacteria 2256
123 Ga0451577_0010017 3300042876 Bacteria 9079
124 Ga0466969_0011131 3300044656 Bacteria 4764
125 Ga0466966_0000438 3300044684 Bacteria 26785
126 Ga0466963_0206905 3300044694 Bacteria 1373
127 Ga0466964_0000070 3300044706 Bacteria 22664
128 Ga0453684_0000543 3300044712 Bacteria 142555
129 Ga0453684_0029252 3300044712 Bacteria 7834
130 Ga0453684_0110024 3300044712 Bacteria 3350
131 Ga0466968_0000048 3300044735 Bacteria 34075
132 Ga0466970_0001180 3300044765 Bacteria 12694
133 Ga0466959_0002099 3300045049 Bacteria 12607
134 Ga0466959_0029827 3300045049 Bacteria 4040
135 Ga0466959_0167281 3300045049 Bacteria 1543
136 Ga0451576_0042662 3300045051 Bacteria 4789
137 Ga0466967_0113622 3300045976 Bacteria 2492
138 Ga0466967_0151058 3300045976 Bacteria 2171
139 Ga0495603_0126413 3300046455 Bacteria 1490
140 Ga0495653_0108216 3300046463 Bacteria 2002
141 Ga0495674_0090710 3300047319 Bacteria 2611
142 Ga0495674_0122285 3300047319 Bacteria 2198
143 Ga0495674_0217826 3300047319 Bacteria 1579
144 Ga0495680_0078051 3300047322 Bacteria 2507
145 Ga0495602_0090634 3300048088 Bacteria 2539
146 Ga0496102_0086960 3300048905 Bacteria 2887
147 Ga0496104_0057866 3300048907 Bacteria 3669
148 Ga0496108_0044836 3300048911 Bacteria 3692
149 Ga0496109_0057734 3300048912 Bacteria 3544
150 Ga0496110_0038420 3300048913 Bacteria 4166
151 Ga0496110_0078000 3300048913 Bacteria 2948
152 Ga0496111_0013252 3300048914 Bacteria 5605
153 Ga0496112_0060923 3300048915 Bacteria 3719
154 Ga0496114_0015548 3300048917 Bacteria 6118
155 Ga0496114_0111492 3300048917 Bacteria 2344
156 Ga0496114_0199183 3300048917 Bacteria 1754
157 Ga0501034_0032115 3300049571 Bacteria 5334
158 Ga0501034_0140333 3300049571 Bacteria 2396
159 Ga0501038_0158695 3300049574 Bacteria 1840
160 Ga0501038_0163050 3300049574 Bacteria 1810
161 Ga0501039_0072012 3300049575 Bacteria 2686
162 Ga0501039_0120519 3300049575 Bacteria 2056
163 Ga0501039_0163299 3300049575 Bacteria 1751
164 Ga0501040_0007141 3300049576 Bacteria 7231
165 Ga0501047_0054701 3300049581 Bacteria 3861
166 Ga0501068_0097903 3300049584 Bacteria 1816
167 Ga0501072_0138778 3300049588 Bacteria 1938
168 Ga0501072_0168432 3300049588 Bacteria 1748
169 Ga0501075_0003327 3300049591 Bacteria 10749
170 Ga0501076_0263863 3300049592 Bacteria 1410
171 Ga0501079_0047391 3300049741 Bacteria 3316
172 Ga0501079_0183536 3300049741 Bacteria 1633
173 Ga0501083_0000099 3300049744 Bacteria 58939
174 Ga0501044_0008831 3300049823 Bacteria 11022
175 Ga0501045_0010603 3300049824 Bacteria 6455
176 Ga0501045_0010999 3300049824 Bacteria 6342
177 Ga0501045_0094119 3300049824 Bacteria 2216
178 nmdc:mga0yw44_10945_c1 3300050492 Bacteria 4654
179 nmdc:mga0yw44_130929_c1 3300050492 Bacteria 1624
180 nmdc:mga0yw44_2960_c1 3300050492 Bacteria 7399
181 nmdc:mga0yw44_63040_c1 3300050492 Bacteria 2278
182 nmdc:mga06z11_151721_c1 3300050494 Bacteria 1318
183 nmdc:mga07m45_179653_c1 3300050496 Bacteria 1230
184 nmdc:mga08y16_264_c1 3300050511 Bacteria 47394
185 Ga0500641_0028263 3300053096 Bacteria 2189
186 Ga0500616_0000418 3300053153 Bacteria 57046
187 Ga0501082_0126006 3300060353 Bacteria 2221
188 Ga0530510_0015534 3300061734 Bacteria 5381
189 Ga0530510_0184331 3300061734 Bacteria 1548
190 2837187198 2837183177 Bacteria 4637169
191 Ga0400483_209037
192 Ga0070683_100004912
193 Ga0070689_100002502
194 Ga0070691_10004560
195 Ga0070668_100024620
196 Ga0070671_100010933
197 Ga0070714_100063495
198 Ga0070706_100002063
199 Ga0070706_100004298
200 Ga0070706_100067383
201 Ga0070707_100000982
202 Ga0070707_100004178
203 Ga0070707_100024289
204 Ga0070698_100028803
205 Ga0070698_100115749
206 Ga0070699_100001566
207 Ga0070679_100020962
208 Ga0070679_100075520
209 Ga0070684_100006507
210 Ga0070684_100045348
211 Ga0070672_100214263
212 Ga0070665_100013564
213 Ga0070664_100013705
214 Ga0068857_100000634
215 Ga0068857_100032542
216 Ga0068856_100001652
217 Ga0068860_100006729
218 Ga0075365_10001960
219 Ga0075365_10006571
220 Ga0075365_10076337
221 Ga0075363_100031813
222 Ga0075364_10001780
223 Ga0075364_10001966
224 Ga0075364_10086777
225 Ga0075362_10014963
226 Ga0075428_100001806
227 Ga0075428_100090239
228 Ga0075431_100009441
229 Ga0111539_10000963
230 Ga0105248_10113675
231 Ga0157375_10068218
232 Ga0163163_10153290
233 Ga0157380_10352271
234 Ga0182008_10109570
235 Ga0206356_10091574
236 Ga0206351_10893835
237 Ga0206350_11324271
238 Ga0206354_10348709
239 Ga0206354_10953110
240 Ga0213874_10000058
241 Ga0213874_10000996
242 Ga0213874_10001957
243 Ga0224712_10001971
244 Ga0224712_10005366
245 Ga0224712_10005533
246 Ga0207684_10000805
247 Ga0207684_10002720
248 Ga0207684_10002823
249 Ga0207684_10014787
250 Ga0207671_10209841
251 Ga0207646_10012261
252 Ga0207646_10110710
253 Ga0207646_10132515
254 Ga0207700_10017586
255 Ga0207664_10017903
256 Ga0207664_10094279
257 Ga0207709_10176622
258 Ga0207670_10004618
259 Ga0207711_10177443
260 Ga0207702_10019730
261 Ga0207674_10000337
262 Ga0207674_10122104
263 Ga0207675_100023940
264 Ga0207683_10055218
265 Ga0207428_10005443
266 Ga0268266_10009165
267 Ga0268266_10248468
268 Ga0268264_10008573
269 Ga0265338_10061835
270 Ga0265338_10120404
271 Ga0316579_10070358
272 Ga0265314_10034168
273 Ga0316576_10005344
274 Ga0316576_10007168
275 Ga0316576_10018146
276 Ga0316576_10055129
277 Ga0316576_10083966
278 Ga0316576_10129694
279 Ga0316578_10004054
280 Ga0316578_10037651
281 Ga0316577_10049147
282 Ga0316577_10078637
283 Ga0316580_10002317
284 Ga0316580_10012489
285 Ga0373953_0029183
286 Ga0373954_0089312
287 Ga0373955_0062158
288 Ga0316574_0053673
289 Ga0316574_0077673
290 Ga0316574_0124394
291 Ga0373927_0000153
292 Ga0373933_0001704
293 Ga0373933_0025834
294 Ga0373937_0012265
295 Ga0373937_0071238
296 Ga0373937_0206420
297 Ga0316582_0016336
298 Ga0316582_0030587
299 Ga0316582_0035322
300 Ga0316582_0085113
301 Ga0316584_0000221
302 Ga0316584_0113675
303 Ga0316584_0173821
304 Ga0395905_0004652
305 Ga0316581_0000880
306 Ga0436363_0036629
307 Ga0436363_0480609
308 Ga0436362_0068908
309 Ga0439466_0045845
310 Ga0439465_0002885
311 Ga0451791_0001851
312 Ga0451837_0153293
313 Ga0451577_0010017
314 Ga0466969_0011131
315 Ga0466966_0000438
316 Ga0466963_0206905
317 Ga0466964_0000070
318 Ga0453684_0000543
319 Ga0453684_0029252
320 Ga0453684_0110024
321 Ga0466968_0000048
322 Ga0466970_0001180
323 Ga0466959_0002099
324 Ga0466959_0029827
325 Ga0466959_0167281
326 Ga0451576_0042662
327 Ga0466967_0113622
328 Ga0466967_0151058
329 Ga0495603_0126413
330 Ga0495653_0108216
331 Ga0495674_0090710
332 Ga0495674_0122285
333 Ga0495674_0217826
334 Ga0495680_0078051
335 Ga0495602_0090634
336 Ga0496102_0086960
337 Ga0496104_0057866
338 Ga0496108_0044836
339 Ga0496109_0057734
340 Ga0496110_0038420
341 Ga0496110_0078000
342 Ga0496111_0013252
343 Ga0496112_0060923
344 Ga0496114_0015548
345 Ga0496114_0111492
346 Ga0496114_0199183
347 Ga0501034_0032115
348 Ga0501034_0140333
349 Ga0501038_0158695
350 Ga0501038_0163050
351 Ga0501039_0072012
352 Ga0501039_0120519
353 Ga0501039_0163299
354 Ga0501040_0007141
355 Ga0501047_0054701
356 Ga0501068_0097903
357 Ga0501072_0138778
358 Ga0501072_0168432
359 Ga0501075_0003327
360 Ga0501076_0263863
361 Ga0501079_0047391
362 Ga0501079_0183536
363 Ga0501083_0000099
364 Ga0501044_0008831
365 Ga0501045_0010603
366 Ga0501045_0010999
367 Ga0501045_0094119
368 nmdc:mga0yw44_10945_c1
369 nmdc:mga0yw44_130929_c1
370 nmdc:mga0yw44_2960_c1
371 nmdc:mga0yw44_63040_c1
372 nmdc:mga06z11_151721_c1
373 nmdc:mga07m45_179653_c1
374 nmdc:mga08y16_264_c1
375 Ga0500641_0028263
376 Ga0500616_0000418
377 Ga0501082_0126006
378 Ga0530510_0015534
379 Ga0530510_0184331
380 2837187198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00438

S-AdoMet_synt_N

S-adenosylmethionine synthetase, N-terminal domain

38

136

0.98

PF02773

S-AdoMet_synt_C

S-adenosylmethionine synthetase, C-terminal domain

274

413

0.98

PF02772

S-AdoMet_synt_M

S-adenosylmethionine synthetase, central domain

155

272

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iml-assembly1.cif.gz_B crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.9842 6 406
3iml-assembly2.cif.gz_C crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.9836 6 397
3iml-assembly2.cif.gz_D crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.9818 6 397
3iml-assembly1.cif.gz_B crystal structure of s-adenosylmethionine synthetase from burkholderia pseudomallei 0.9814 6 406
5t8t-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium 0.9809 5 406
ID Description Score Start End Superfamily
af_Q2G1W4_285_396_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.993 294 404 3.30.300.10
af_O60198_14_99_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9929 15 100 3.30.300.10
af_Q58EF9_292_361_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9884 294 361 3.30.300.10
af_Q4CSC4_13_109_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9876 14 109 3.30.300.10
af_O60198_14_99_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9816 15 100 3.30.300.10
ID Description Score Start End GO Terms
AF-A0A6B1G4E8-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9969 292 405 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872
AF-A0A7X9C1G4-F1-model_v4 Methionine adenosyltransferase domain-containing protein 0.9957 285 406 GO:0004478
GO:0005524
GO:0006556
GO:0006730
GO:0046872
AF-A0A0S7KRT2-F1-model_v4 deleted 0.9956 8 106
AF-A0A529L095-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9953 8 105 GO:0004478
GO:0005524
GO:0006556
GO:0046872
AF-A0A1A7XM39-F1-model_v4 Methionine adenosyltransferase I, alpha 0.9951 8 104 GO:0004478
GO:0005524
GO:0006556
GO:0046872

Map