F292590

General Info

Members Datasets Scaffolds Average Seq Length
190 133 380 482

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10025264|Ga0207710_100252642
Length 512
Sequence MGIGGEVLVPTVKNQVQLITYADRFSGNINSLKYLLNGPLKGTFGGVHILPFFYPIDGADAGFDPIDHTEVDPRIGDWNDVRALATDYNVVADLIVNHVSSDSPQFKDFSKRGASSPFAGMFLTYDRVFPMGASESDLLSIYRPRPGLPFTSSVLESGERHLLWTTFTSKQIDIDVKHPQGEKYLTSILERFRDANIRMIRLDAVGYAIKKAGTCCFMIPETFRFIAALTSQAHALGIQVLVEIHSHYLQQVQIAQQVDWVYDFALPPLILHSLFSRNAGALNHWLSIRPQNAVTVLDTHDGIGVIDVGAGPEGEAGLLSPNEINELVETIHSRSDGQSRKATGAAANNLDLYQINCTFYDALGRRDNEYLIARAVQFFSPGIPQVYYVGLLAGINDMVLLEKTQVGRDINRHYYTKDEVSDDLHKPVVQGLLELIRLRSSHPAFGGQAEIQSKSEEILIISWRSDGEWAKLEVNFAEPQAVITYSTDRTQSSTSGKWQSISNGAPAAKEIR

Samples

Sample ID Description Type Environment
1 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
87 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
131 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
132 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
133 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.16
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 13.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207710_10025264 3300025900 Unclassified 2563
2 Ga0070683_100036266 3300005329 Bacteria 4512
3 Ga0070690_100057320 3300005330 Unclassified 2500
4 Ga0070670_100028227 3300005331 Unclassified 4830
5 Ga0068868_100131493 3300005338 Bacteria 2048
6 Ga0070661_100083951 3300005344 Unclassified 2353
7 Ga0070675_100010724 3300005354 Bacteria 7168
8 Ga0070675_100072265 3300005354 Unclassified 2864
9 Ga0070671_100030341 3300005355 Unclassified 4462
10 Ga0070673_100012899 3300005364 Bacteria 5756
11 Ga0070667_100005961 3300005367 Bacteria 10130
12 Ga0070667_100153070 3300005367 Bacteria 2027
13 Ga0070714_100000874 3300005435 Bacteria 21382
14 Ga0070713_100008331 3300005436 Bacteria 7352
15 Ga0070713_100024067 3300005436 Bacteria 4737
16 Ga0070713_100049028 3300005436 Bacteria 3482
17 Ga0070708_100237234 3300005445 Bacteria 1712
18 Ga0070681_10000717 3300005458 Bacteria 27458
19 Ga0070699_100016193 3300005518 Bacteria 6400
20 Ga0070679_100009336 3300005530 Bacteria 9274
21 Ga0070684_100111244 3300005535 Bacteria 2456
22 Ga0068853_100009391 3300005539 Bacteria 7885
23 Ga0070672_100003460 3300005543 Bacteria 10233
24 Ga0070672_100183759 3300005543 Bacteria 1743
25 Ga0070664_100185299 3300005564 Unclassified 1852
26 Ga0068857_100020712 3300005577 Bacteria 5787
27 Ga0068854_100034770 3300005578 Bacteria 3522
28 Ga0068856_100002183 3300005614 Bacteria 20301
29 Ga0068852_100081677 3300005616 Bacteria 2870
30 Ga0068859_100025410 3300005617 Bacteria 5941
31 Ga0068863_100001928 3300005841 Bacteria 20597
32 Ga0068858_100028455 3300005842 Bacteria 5191
33 Ga0068858_100034959 3300005842 Bacteria 4661
34 Ga0068858_100067137 3300005842 Bacteria 3322
35 Ga0068860_100091472 3300005843 Unclassified 2898
36 Ga0070717_10019572 3300006028 Bacteria 5312
37 Ga0070715_10009732 3300006163 Bacteria 3399
38 Ga0097621_100000409 3300006237 Bacteria 29993
39 Ga0097621_100002957 3300006237 Bacteria 11664
40 Ga0097621_100005982 3300006237 Bacteria 8601
41 Ga0097621_100015161 3300006237 Bacteria 5791
42 Ga0097621_100018257 3300006237 Bacteria 5352
43 Ga0097621_100024846 3300006237 Unclassified 4684
44 Ga0097621_100109221 3300006237 Bacteria 2336
45 Ga0068871_100000126 3300006358 Bacteria 48480
46 Ga0068871_100002702 3300006358 Bacteria 12100
47 Ga0068871_100006820 3300006358 Bacteria 8122
48 Ga0068871_100010197 3300006358 Bacteria 6843
49 Ga0068871_100016747 3300006358 Bacteria 5531
50 Ga0068871_100160937 3300006358 Unclassified 1920
51 Ga0075430_100130677 3300006846 Bacteria 2093
52 Ga0075431_100035566 3300006847 Bacteria 5128
53 Ga0075433_10063537 3300006852 Bacteria 3234
54 Ga0068865_100002823 3300006881 Bacteria 10334
55 Ga0068865_100013099 3300006881 Bacteria 5233
56 Ga0097620_100025410 3300006931 Bacteria 5941
57 Ga0111539_10063051 3300009094 Bacteria 4386
58 Ga0105245_10004051 3300009098 Bacteria 13022
59 Ga0114129_10115028 3300009147 Bacteria 3709
60 Ga0105241_10002501 3300009174 Bacteria 13814
61 Ga0105242_10001177 3300009176 Bacteria 20603
62 Ga0105242_10007559 3300009176 Bacteria 8365
63 Ga0105242_10026170 3300009176 Unclassified 4623
64 Ga0105248_10006094 3300009177 Bacteria 13228
65 Ga0105248_10008745 3300009177 Bacteria 11122
66 Ga0105248_10023981 3300009177 Bacteria 6782
67 Ga0105248_10155610 3300009177 Unclassified 2579
68 Ga0105239_10039503 3300010375 Bacteria 5170
69 Ga0157369_10125229 3300013105 Bacteria 2725
70 Ga0157374_10000228 3300013296 Bacteria 52018
71 Ga0157374_10011089 3300013296 Bacteria 7788
72 Ga0157378_10056239 3300013297 Bacteria 3505
73 Ga0163162_10002561 3300013306 Bacteria 17206
74 Ga0163162_10008193 3300013306 Bacteria 10196
75 Ga0157375_10001831 3300013308 Bacteria 18265
76 Ga0157375_10026712 3300013308 Bacteria 5386
77 Ga0163163_10026133 3300014325 Bacteria 5576
78 Ga0163163_10048456 3300014325 Bacteria 4178
79 Ga0157379_10000853 3300014968 Bacteria 24703
80 Ga0157379_10072736 3300014968 Bacteria 3076
81 Ga0157376_10002393 3300014969 Bacteria 12664
82 Ga0157376_10023838 3300014969 Bacteria 4797
83 Ga0157376_10046995 3300014969 Bacteria 3562
84 Ga0157376_10068665 3300014969 Bacteria 3002
85 Ga0163161_10096173 3300017792 Bacteria 2198
86 Ga0213872_10010912 3300021361 Bacteria 4312
87 Ga0207680_10060700 3300025903 Unclassified 2303
88 Ga0207654_10007406 3300025911 Bacteria 5527
89 Ga0207654_10031722 3300025911 Bacteria 2913
90 Ga0207707_10003757 3300025912 Bacteria 13459
91 Ga0207660_10005523 3300025917 Bacteria 8209
92 Ga0207652_10014983 3300025921 Bacteria 6289
93 Ga0207694_10011543 3300025924 Bacteria 6664
94 Ga0207650_10047513 3300025925 Unclassified 3163
95 Ga0207659_10008362 3300025926 Bacteria 6421
96 Ga0207700_10004068 3300025928 Bacteria 8574
97 Ga0207700_10040810 3300025928 Bacteria 3390
98 Ga0207664_10001404 3300025929 Bacteria 15843
99 Ga0207664_10050121 3300025929 Bacteria 3291
100 Ga0207644_10101744 3300025931 Bacteria 2160
101 Ga0207686_10007996 3300025934 Bacteria 5702
102 Ga0207686_10031000 3300025934 Bacteria 3171
103 Ga0207704_10001856 3300025938 Bacteria 9460
104 Ga0207665_10194148 3300025939 Bacteria 1476
105 Ga0207691_10019180 3300025940 Bacteria 6475
106 Ga0207711_10004544 3300025941 Bacteria 11809
107 Ga0207711_10132712 3300025941 Bacteria 2234
108 Ga0207679_10196685 3300025945 Unclassified 1681
109 Ga0207651_10068479 3300025960 Unclassified 2502
110 Ga0207658_10004878 3300025986 Bacteria 9256
111 Ga0207677_10110136 3300026023 Bacteria 2049
112 Ga0207703_10020269 3300026035 Bacteria 5200
113 Ga0207703_10029771 3300026035 Bacteria 4310
114 Ga0207703_10053196 3300026035 Unclassified 3290
115 Ga0207641_10006343 3300026088 Bacteria 9986
116 Ga0207641_10056555 3300026088 Unclassified 3334
117 Ga0207674_10029359 3300026116 Bacteria 5789
118 Ga0207675_100092758 3300026118 Bacteria 2840
119 Ga0268265_10070486 3300028380 Bacteria 2719
120 Ga0268264_10124532 3300028381 Unclassified 2276
121 Ga0265318_10002641 3300028577 Bacteria 9457
122 Ga0265318_10004302 3300028577 Bacteria 6928
123 Ga0265338_10005928 3300028800 Bacteria 15738
124 Ga0265338_10006749 3300028800 Bacteria 14489
125 Ga0265338_10007385 3300028800 Bacteria 13659
126 Ga0265330_10000555 3300031235 Bacteria 24313
127 Ga0265320_10023144 3300031240 Bacteria 3312
128 Ga0265325_10000577 3300031241 Bacteria 26646
129 Ga0265329_10010431 3300031242 Bacteria 3411
130 Ga0265340_10052622 3300031247 Bacteria 1968
131 Ga0265339_10003344 3300031249 Bacteria 11229
132 Ga0265316_10021445 3300031344 Bacteria 5471
133 Ga0265313_10001188 3300031595 Bacteria 24914
134 Ga0265313_10032078 3300031595 Bacteria 2687
135 Ga0316575_10027146 3300031665 Bacteria 2227
136 Ga0265314_10000219 3300031711 Bacteria 85090
137 Ga0265342_10000329 3300031712 Bacteria 53452
138 Ga0316578_10021883 3300031728 Bacteria 3554
139 Ga0316577_10026959 3300031733 Bacteria 3202
140 Ga0307409_100016525 3300031995 Bacteria 4885
141 Ga0373956_0036868 3300035119 Bacteria 2160
142 Ga0373957_0021511 3300035120 Bacteria 2291
143 Ga0373955_0002103 3300035172 Bacteria 8596
144 Ga0316574_0003027 3300035398 Bacteria 8567
145 Ga0316574_0054631 3300035398 Bacteria 2494
146 Ga0316574_0067315 3300035398 Unclassified 2258
147 Ga0373924_0001265 3300035410 Bacteria 8101
148 Ga0373935_0045566 3300035692 Bacteria 2767
149 Ga0373937_0020668 3300036401 Bacteria 5904
150 Ga0316584_0102624 3300036712 Bacteria 2141
151 Ga0373925_0004163 3300037068 Bacteria 10972
152 Ga0400483_011122 3300039062 Bacteria 70065
153 Ga0400483_184597 3300039062 Bacteria 102126
154 Ga0451577_0035056 3300042876 Bacteria 4520
155 Ga0453684_0000055 3300044712 Bacteria 532014
156 Ga0453684_0094170 3300044712 Unclassified 3686
157 Ga0453684_0203682 3300044712 Bacteria 2305
158 Ga0453684_0267762 3300044712 Bacteria 1954
159 Ga0453684_0293116 3300044712 Bacteria 1852
160 Ga0451576_0233171 3300045051 Bacteria 1922
161 Ga0451576_0396432 3300045051 Bacteria 1447
162 Ga0495580_0057065 3300046472 Unclassified 2748
163 Ga0495608_0013704 3300046511 Bacteria 5623
164 Ga0495628_0068019 3300046516 Bacteria 2780
165 Ga0495630_0001036 3300046517 Bacteria 19184
166 Ga0495652_0165844 3300046529 Unclassified 1710
167 Ga0495640_0028262 3300046533 Bacteria 4039
168 Ga0495640_0143961 3300046533 Bacteria 1535
169 Ga0495667_0016142 3300046559 Bacteria 5046
170 Ga0495657_0013734 3300046675 Bacteria 5962
171 Ga0495613_0001476 3300046689 Bacteria 17922
172 Ga0495613_0035747 3300046689 Unclassified 3685
173 Ga0495613_0111121 3300046689 Unclassified 1974
174 Ga0495687_007310 3300047443 Bacteria 6542
175 Ga0495684_0000024 3300047471 Bacteria 129369
176 Ga0496100_0001877 3300048903 Bacteria 10539
177 Ga0496100_0080499 3300048903 Bacteria 2198
178 Ga0496107_0006700 3300048910 Bacteria 7931
179 Ga0496108_0128322 3300048911 Bacteria 2179
180 Ga0496114_0000363 3300048917 Bacteria 33231
181 Ga0496115_0002093 3300048918 Bacteria 14291
182 nmdc:mga08y16_21699_c1 3300050511 Bacteria 6778
183 nmdc:mga08y16_219738_c1 3300050511 Bacteria 1967
184 Ga0495601_0000629 3300053077 Bacteria 18834
185 Ga0495619_0000474 3300053085 Bacteria 27047
186 Ga0501082_0218842 3300060353 Bacteria 1657
187 2523469092 2523231067 Bacteria 5230452
188 2537876880 2537561587 Bacteria 5425293
189 2739347443 2738543031 Bacteria 5769731
190 2916181406 2916178963 Bacteria 5265078
191 Ga0207710_10025264
192 Ga0070683_100036266
193 Ga0070690_100057320
194 Ga0070670_100028227
195 Ga0068868_100131493
196 Ga0070661_100083951
197 Ga0070675_100010724
198 Ga0070675_100072265
199 Ga0070671_100030341
200 Ga0070673_100012899
201 Ga0070667_100005961
202 Ga0070667_100153070
203 Ga0070714_100000874
204 Ga0070713_100008331
205 Ga0070713_100024067
206 Ga0070713_100049028
207 Ga0070708_100237234
208 Ga0070681_10000717
209 Ga0070699_100016193
210 Ga0070679_100009336
211 Ga0070684_100111244
212 Ga0068853_100009391
213 Ga0070672_100003460
214 Ga0070672_100183759
215 Ga0070664_100185299
216 Ga0068857_100020712
217 Ga0068854_100034770
218 Ga0068856_100002183
219 Ga0068852_100081677
220 Ga0068859_100025410
221 Ga0068863_100001928
222 Ga0068858_100028455
223 Ga0068858_100034959
224 Ga0068858_100067137
225 Ga0068860_100091472
226 Ga0070717_10019572
227 Ga0070715_10009732
228 Ga0097621_100000409
229 Ga0097621_100002957
230 Ga0097621_100005982
231 Ga0097621_100015161
232 Ga0097621_100018257
233 Ga0097621_100024846
234 Ga0097621_100109221
235 Ga0068871_100000126
236 Ga0068871_100002702
237 Ga0068871_100006820
238 Ga0068871_100010197
239 Ga0068871_100016747
240 Ga0068871_100160937
241 Ga0075430_100130677
242 Ga0075431_100035566
243 Ga0075433_10063537
244 Ga0068865_100002823
245 Ga0068865_100013099
246 Ga0097620_100025410
247 Ga0111539_10063051
248 Ga0105245_10004051
249 Ga0114129_10115028
250 Ga0105241_10002501
251 Ga0105242_10001177
252 Ga0105242_10007559
253 Ga0105242_10026170
254 Ga0105248_10006094
255 Ga0105248_10008745
256 Ga0105248_10023981
257 Ga0105248_10155610
258 Ga0105239_10039503
259 Ga0157369_10125229
260 Ga0157374_10000228
261 Ga0157374_10011089
262 Ga0157378_10056239
263 Ga0163162_10002561
264 Ga0163162_10008193
265 Ga0157375_10001831
266 Ga0157375_10026712
267 Ga0163163_10026133
268 Ga0163163_10048456
269 Ga0157379_10000853
270 Ga0157379_10072736
271 Ga0157376_10002393
272 Ga0157376_10023838
273 Ga0157376_10046995
274 Ga0157376_10068665
275 Ga0163161_10096173
276 Ga0213872_10010912
277 Ga0207680_10060700
278 Ga0207654_10007406
279 Ga0207654_10031722
280 Ga0207707_10003757
281 Ga0207660_10005523
282 Ga0207652_10014983
283 Ga0207694_10011543
284 Ga0207650_10047513
285 Ga0207659_10008362
286 Ga0207700_10004068
287 Ga0207700_10040810
288 Ga0207664_10001404
289 Ga0207664_10050121
290 Ga0207644_10101744
291 Ga0207686_10007996
292 Ga0207686_10031000
293 Ga0207704_10001856
294 Ga0207665_10194148
295 Ga0207691_10019180
296 Ga0207711_10004544
297 Ga0207711_10132712
298 Ga0207679_10196685
299 Ga0207651_10068479
300 Ga0207658_10004878
301 Ga0207677_10110136
302 Ga0207703_10020269
303 Ga0207703_10029771
304 Ga0207703_10053196
305 Ga0207641_10006343
306 Ga0207641_10056555
307 Ga0207674_10029359
308 Ga0207675_100092758
309 Ga0268265_10070486
310 Ga0268264_10124532
311 Ga0265318_10002641
312 Ga0265318_10004302
313 Ga0265338_10005928
314 Ga0265338_10006749
315 Ga0265338_10007385
316 Ga0265330_10000555
317 Ga0265320_10023144
318 Ga0265325_10000577
319 Ga0265329_10010431
320 Ga0265340_10052622
321 Ga0265339_10003344
322 Ga0265316_10021445
323 Ga0265313_10001188
324 Ga0265313_10032078
325 Ga0316575_10027146
326 Ga0265314_10000219
327 Ga0265342_10000329
328 Ga0316578_10021883
329 Ga0316577_10026959
330 Ga0307409_100016525
331 Ga0373956_0036868
332 Ga0373957_0021511
333 Ga0373955_0002103
334 Ga0316574_0003027
335 Ga0316574_0054631
336 Ga0316574_0067315
337 Ga0373924_0001265
338 Ga0373935_0045566
339 Ga0373937_0020668
340 Ga0316584_0102624
341 Ga0373925_0004163
342 Ga0400483_011122
343 Ga0400483_184597
344 Ga0451577_0035056
345 Ga0453684_0000055
346 Ga0453684_0094170
347 Ga0453684_0203682
348 Ga0453684_0267762
349 Ga0453684_0293116
350 Ga0451576_0233171
351 Ga0451576_0396432
352 Ga0495580_0057065
353 Ga0495608_0013704
354 Ga0495628_0068019
355 Ga0495630_0001036
356 Ga0495652_0165844
357 Ga0495640_0028262
358 Ga0495640_0143961
359 Ga0495667_0016142
360 Ga0495657_0013734
361 Ga0495613_0001476
362 Ga0495613_0035747
363 Ga0495613_0111121
364 Ga0495687_007310
365 Ga0495684_0000024
366 Ga0496100_0001877
367 Ga0496100_0080499
368 Ga0496107_0006700
369 Ga0496108_0128322
370 Ga0496114_0000363
371 Ga0496115_0002093
372 nmdc:mga08y16_21699_c1
373 nmdc:mga08y16_219738_c1
374 Ga0495601_0000629
375 Ga0495619_0000474
376 Ga0501082_0218842
377 2523469092
378 2537876880
379 2739347443
380 2916181406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

25

234

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qqj-assembly1.cif.gz_A sucrose phosphorylase from jeotgalibaca ciconiae 0.9654 6 449
2gdu-assembly1.cif.gz_B e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose 0.9617 3 457
7qqj-assembly2.cif.gz_B sucrose phosphorylase from jeotgalibaca ciconiae 0.9597 4 449
1r7a-assembly1.cif.gz_A sucrose phosphorylase from bifidobacterium adolescentis 0.9578 3 457
5man-assembly1.cif.gz_B structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose 0.9527 3 457
ID Description Score Start End Superfamily
5m9xB02 Alpha Beta;Alpha-Beta Complex;Oligo-1,6-glucosidase; domain 2;Oligo-1,6-glucosidase; Domain 2 0.9766 58 138 3.90.400.10
2gdvA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9562 3 401 3.20.20.80
5m9xB02 Alpha Beta;Alpha-Beta Complex;Oligo-1,6-glucosidase; domain 2;Oligo-1,6-glucosidase; Domain 2 0.9533 58 138 3.90.400.10
2gdvA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8679 3 401 3.20.20.80
af_P76041_133_205_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8504 59 140 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A060CGZ2-F1-model_v4 CAZy families GH13 protein 0.9844 126 291
AF-A0A2D7A3V7-F1-model_v4 Sucrose phosphorylase 0.9782 3 448 GO:0004645
GO:0005975
AF-A0A358D8P6-F1-model_v4 Sucrose phosphorylase 0.9768 2 413 GO:0004645
GO:0005975
AF-A0A0F9FD12-F1-model_v4 Sucrose phosphorylase 0.9733 110 460
AF-A0A060CBL4-F1-model_v4 CAZy families GH13 protein 0.9727 61 232

Map