F292153

General Info

Members Datasets Scaffolds Average Seq Length
190 129 380 136

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100272257|Ga0070684_1002722571
Length 150
Sequence LPVREPSRFGWNCIQIYMEVRVQHLGNVKFEASTRGHRVLCDQPQENSGTDSGMTPPELLLASLGTCAGFYAAQYLKLHNLPADGLDVCVSADKLKQPARLGDFRIEVTVPGLNERDEAGVLRAVHACLIHNTLLNAPAIETVVKTMAPA

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 99.47
Stem 0
Stem Tuber 0
Unclassified 36.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100272257 3300005535 Bacteria 1550
2 Ga0070658_10045735 3300005327 Bacteria 3539
3 Ga0070683_100088394 3300005329 Bacteria 2907
4 Ga0070670_100988378 3300005331 Unclassified 765
5 Ga0070660_100266805 3300005339 Unclassified 1399
6 Ga0070667_101485627 3300005367 Unclassified 636
7 Ga0070709_10714054 3300005434 Bacteria 781
8 Ga0070714_100342480 3300005435 Bacteria 1403
9 Ga0070713_100027294 3300005436 Bacteria 4493
10 Ga0070713_100813859 3300005436 Bacteria 896
11 Ga0070710_10009901 3300005437 Bacteria 4672
12 Ga0070711_100030163 3300005439 Unclassified 3587
13 Ga0070711_100904981 3300005439 Bacteria 753
14 Ga0070681_10340834 3300005458 Unclassified 1409
15 Ga0070707_101869461 3300005468 Unclassified 568
16 Ga0070698_100003443 3300005471 Bacteria 17403
17 Ga0070684_100193123 3300005535 Bacteria 1853
18 Ga0070686_101215923 3300005544 Unclassified 626
19 Ga0070665_101635680 3300005548 Unclassified 652
20 Ga0068855_100077221 3300005563 Bacteria 3863
21 Ga0068855_100224113 3300005563 Bacteria 2107
22 Ga0068855_100892144 3300005563 Unclassified 940
23 Ga0068855_101269868 3300005563 Bacteria 763
24 Ga0068852_100054305 3300005616 Bacteria 3453
25 Ga0068859_101235476 3300005617 Unclassified 823
26 Ga0068858_100800784 3300005842 Bacteria 919
27 Ga0070717_10081757 3300006028 Bacteria 2713
28 Ga0070717_10506343 3300006028 Unclassified 1091
29 Ga0070717_10788555 3300006028 Unclassified 864
30 Ga0070716_100035907 3300006173 Bacteria 2729
31 Ga0070712_100095577 3300006175 Bacteria 2186
32 Ga0070712_100231964 3300006175 Unclassified 1466
33 Ga0097621_100434384 3300006237 Bacteria 1180
34 Ga0075428_100756272 3300006844 Bacteria 1034
35 Ga0097620_101235727 3300006931 Unclassified 823
36 Ga0075435_100355427 3300007076 Unclassified 1256
37 Ga0099795_10051561 3300007788 Bacteria 1500
38 Ga0105240_10003708 3300009093 Bacteria 23610
39 Ga0105240_10051134 3300009093 Bacteria 5203
40 Ga0105240_10552667 3300009093 Bacteria 1274
41 Ga0105245_10374615 3300009098 Bacteria 1416
42 Ga0105248_10044455 3300009177 Bacteria 4980
43 Ga0105248_11225102 3300009177 Bacteria 849
44 Ga0105248_12357475 3300009177 Unclassified 606
45 Ga0105237_10004765 3300009545 Bacteria 15594
46 Ga0105237_10007654 3300009545 Bacteria 11807
47 Ga0105237_10035309 3300009545 Bacteria 5059
48 Ga0105238_10963286 3300009551 Unclassified 873
49 Ga0105249_11087101 3300009553 Bacteria 870
50 Ga0099796_10018863 3300010159 Bacteria 2081
51 Ga0105239_10015135 3300010375 Bacteria 8550
52 Ga0157370_10372501 3300013104 Bacteria 1316
53 Ga0157374_10166979 3300013296 Bacteria 2145
54 Ga0157374_11821479 3300013296 Unclassified 634
55 Ga0157378_10868011 3300013297 Unclassified 932
56 Ga0157372_10824279 3300013307 Bacteria 1077
57 Ga0157375_10697026 3300013308 Unclassified 1169
58 Ga0163163_10030855 3300014325 Bacteria 5169
59 Ga0157380_10792110 3300014326 Bacteria 964
60 Ga0182008_10004011 3300014497 Bacteria 8700
61 Ga0157376_10381625 3300014969 Unclassified 1358
62 Ga0207692_10238929 3300025898 Unclassified 1084
63 Ga0207680_10887866 3300025903 Unclassified 639
64 Ga0207699_10039446 3300025906 Bacteria 2713
65 Ga0207705_10014933 3300025909 Bacteria 5584
66 Ga0207707_10246831 3300025912 Unclassified 1551
67 Ga0207695_10006340 3300025913 Bacteria 15391
68 Ga0207695_10573161 3300025913 Bacteria 1010
69 Ga0207695_10745845 3300025913 Unclassified 859
70 Ga0207695_10801994 3300025913 Unclassified 822
71 Ga0207671_10070625 3300025914 Bacteria 2604
72 Ga0207693_10096430 3300025915 Bacteria 2318
73 Ga0207663_10030764 3300025916 Bacteria 3169
74 Ga0207657_10258281 3300025919 Unclassified 1387
75 Ga0207652_10546120 3300025921 Bacteria 1042
76 Ga0207694_10545507 3300025924 Bacteria 973
77 Ga0207700_10004107 3300025928 Bacteria 8538
78 Ga0207665_10047172 3300025939 Unclassified 2887
79 Ga0207665_11122932 3300025939 Bacteria 627
80 Ga0207711_10030866 3300025941 Bacteria 4520
81 Ga0207661_10067124 3300025944 Bacteria 2916
82 Ga0207667_10234460 3300025949 Bacteria 1879
83 Ga0207667_10650775 3300025949 Bacteria 1059
84 Ga0207703_10688617 3300026035 Bacteria 972
85 Ga0207674_10765065 3300026116 Bacteria 932
86 Ga0207698_10317742 3300026142 Unclassified 1457
87 Ga0265319_1179116 3300028563 Bacteria 653
88 Ga0265338_10006826 3300028800 Bacteria 14382
89 Ga0265338_10042066 3300028800 Unclassified 4262
90 Ga0265338_10072257 3300028800 Unclassified 2946
91 Ga0265338_10305482 3300028800 Unclassified 1155
92 Ga0265328_10045587 3300031239 Bacteria 1612
93 Ga0265320_10013686 3300031240 Bacteria 4653
94 Ga0265325_10004817 3300031241 Bacteria 8448
95 Ga0265325_10014367 3300031241 Bacteria 4477
96 Ga0265325_10045967 3300031241 Bacteria 2266
97 Ga0265329_10014495 3300031242 Bacteria 2781
98 Ga0265339_10007408 3300031249 Bacteria 7095
99 Ga0265339_10031897 3300031249 Bacteria 2974
100 Ga0265339_10083905 3300031249 Unclassified 1680
101 Ga0265331_10004506 3300031250 Bacteria 8692
102 Ga0265316_10004486 3300031344 Bacteria 13868
103 Ga0265316_10013848 3300031344 Bacteria 7141
104 Ga0265316_10050011 3300031344 Unclassified 3290
105 Ga0265316_10505341 3300031344 Unclassified 863
106 Ga0265313_10245664 3300031595 Bacteria 731
107 Ga0265314_10185036 3300031711 Bacteria 1244
108 Ga0265314_10468237 3300031711 Unclassified 668
109 Ga0265342_10045211 3300031712 Bacteria 2652
110 Ga0373926_0211431 3300035083 Unclassified 748
111 Ga0373923_0011740 3300035111 Unclassified 3224
112 Ga0373945_0228540 3300035116 Unclassified 780
113 Ga0373953_0089080 3300035117 Bacteria 1289
114 Ga0373954_0000107 3300035118 Bacteria 28069
115 Ga0373956_0004407 3300035119 Bacteria 5634
116 Ga0373957_0000428 3300035120 Bacteria 10628
117 Ga0373957_0509205 3300035120 Unclassified 524
118 Ga0373943_0015700 3300035170 Unclassified 3444
119 Ga0373955_0000823 3300035172 Bacteria 13265
120 Ga0373924_0023146 3300035410 Bacteria 2434
121 Ga0373935_0090781 3300035692 Unclassified 2000
122 Ga0373933_0000462 3300035724 Bacteria 25399
123 Ga0373947_0049924 3300035725 Bacteria 2514
124 Ga0373947_0605024 3300035725 Unclassified 747
125 Ga0373937_0001966 3300036401 Bacteria 17195
126 Ga0373937_0353106 3300036401 Unclassified 1393
127 Ga0373925_0259895 3300037068 Unclassified 1395
128 Ga0373925_1335623 3300037068 Unclassified 588
129 Ga0436360_0071296 3300039438 Unclassified 691
130 Ga0451577_1046208 3300042876 Bacteria 732
131 Ga0453683_0377522 3300044673 Unclassified 912
132 Ga0466963_0522544 3300044694 Bacteria 838
133 Ga0466957_0523879 3300044842 Bacteria 824
134 Ga0466959_0405782 3300045049 Unclassified 926
135 Ga0451576_0663714 3300045051 Unclassified 1096
136 Ga0451576_1016062 3300045051 Unclassified 869
137 Ga0466958_0115204 3300045836 Bacteria 1680
138 Ga0495651_0064923 3300046462 Unclassified 2789
139 Ga0495651_0426304 3300046462 Bacteria 861
140 Ga0495653_0324300 3300046463 Bacteria 997
141 Ga0495580_0059880 3300046472 Unclassified 2676
142 Ga0495580_0086127 3300046472 Bacteria 2188
143 Ga0495664_0213620 3300046477 Unclassified 1168
144 Ga0495594_0544182 3300046499 Bacteria 659
145 Ga0495608_0091305 3300046511 Bacteria 1970
146 Ga0495628_0057032 3300046516 Unclassified 3073
147 Ga0495628_0402194 3300046516 Bacteria 1000
148 Ga0495630_0060365 3300046517 Bacteria 2846
149 Ga0495630_0436038 3300046517 Bacteria 1004
150 Ga0495630_1396045 3300046517 Bacteria 527
151 Ga0495652_0222930 3300046529 Bacteria 1416
152 Ga0495665_0060875 3300046531 Unclassified 1994
153 Ga0495665_0086143 3300046531 Unclassified 1651
154 Ga0495640_0354477 3300046533 Bacteria 905
155 Ga0495587_0002020 3300046536 Bacteria 13524
156 Ga0495645_0127617 3300046543 Unclassified 1786
157 Ga0495645_0190802 3300046543 Bacteria 1397
158 Ga0495645_0406076 3300046543 Unclassified 867
159 Ga0495645_0650304 3300046543 Bacteria 644
160 Ga0495623_0006502 3300046679 Bacteria 7607
161 Ga0495623_0022525 3300046679 Bacteria 4070
162 Ga0495623_0070962 3300046679 Bacteria 2169
163 Ga0495623_0525598 3300046679 Bacteria 622
164 Ga0495613_0250282 3300046689 Unclassified 1237
165 Ga0495600_0129542 3300046809 Unclassified 1641
166 Ga0495600_0166104 3300046809 Bacteria 1426
167 Ga0495581_0121982 3300047315 Unclassified 1517
168 Ga0495581_0283174 3300047315 Bacteria 969
169 Ga0495604_0000424 3300047317 Bacteria 38047
170 Ga0495604_0353916 3300047317 Bacteria 975
171 Ga0495674_0003992 3300047319 Bacteria 14305
172 Ga0495674_0028381 3300047319 Bacteria 5102
173 Ga0495674_0988875 3300047319 Unclassified 645
174 Ga0495680_0469186 3300047322 Unclassified 859
175 Ga0495675_0039278 3300047444 Bacteria 3014
176 Ga0495675_0212206 3300047444 Bacteria 1175
177 Ga0495675_0607330 3300047444 Bacteria 620
178 Ga0495684_0013361 3300047471 Bacteria 6322
179 Ga0495684_0037887 3300047471 Bacteria 3698
180 Ga0495684_0331352 3300047471 Unclassified 1086
181 Ga0495684_0444761 3300047471 Bacteria 902
182 Ga0495602_0013604 3300048088 Bacteria 8308
183 Ga0495602_0336160 3300048088 Bacteria 1094
184 Ga0495614_0099736 3300048089 Bacteria 1268
185 Ga0496113_0983690 3300048916 Unclassified 665
186 nmdc:mga0rr50_255993_c1 3300050513 Unclassified 1455
187 Ga0495601_0063474 3300053077 Bacteria 2348
188 Ga0495612_0053106 3300053078 Unclassified 1668
189 Ga0495619_0139947 3300053085 Unclassified 1666
190 Ga0495619_0241686 3300053085 Bacteria 1251
191 Ga0070684_100272257
192 Ga0070658_10045735
193 Ga0070683_100088394
194 Ga0070670_100988378
195 Ga0070660_100266805
196 Ga0070667_101485627
197 Ga0070709_10714054
198 Ga0070714_100342480
199 Ga0070713_100027294
200 Ga0070713_100813859
201 Ga0070710_10009901
202 Ga0070711_100030163
203 Ga0070711_100904981
204 Ga0070681_10340834
205 Ga0070707_101869461
206 Ga0070698_100003443
207 Ga0070684_100193123
208 Ga0070686_101215923
209 Ga0070665_101635680
210 Ga0068855_100077221
211 Ga0068855_100224113
212 Ga0068855_100892144
213 Ga0068855_101269868
214 Ga0068852_100054305
215 Ga0068859_101235476
216 Ga0068858_100800784
217 Ga0070717_10081757
218 Ga0070717_10506343
219 Ga0070717_10788555
220 Ga0070716_100035907
221 Ga0070712_100095577
222 Ga0070712_100231964
223 Ga0097621_100434384
224 Ga0075428_100756272
225 Ga0097620_101235727
226 Ga0075435_100355427
227 Ga0099795_10051561
228 Ga0105240_10003708
229 Ga0105240_10051134
230 Ga0105240_10552667
231 Ga0105245_10374615
232 Ga0105248_10044455
233 Ga0105248_11225102
234 Ga0105248_12357475
235 Ga0105237_10004765
236 Ga0105237_10007654
237 Ga0105237_10035309
238 Ga0105238_10963286
239 Ga0105249_11087101
240 Ga0099796_10018863
241 Ga0105239_10015135
242 Ga0157370_10372501
243 Ga0157374_10166979
244 Ga0157374_11821479
245 Ga0157378_10868011
246 Ga0157372_10824279
247 Ga0157375_10697026
248 Ga0163163_10030855
249 Ga0157380_10792110
250 Ga0182008_10004011
251 Ga0157376_10381625
252 Ga0207692_10238929
253 Ga0207680_10887866
254 Ga0207699_10039446
255 Ga0207705_10014933
256 Ga0207707_10246831
257 Ga0207695_10006340
258 Ga0207695_10573161
259 Ga0207695_10745845
260 Ga0207695_10801994
261 Ga0207671_10070625
262 Ga0207693_10096430
263 Ga0207663_10030764
264 Ga0207657_10258281
265 Ga0207652_10546120
266 Ga0207694_10545507
267 Ga0207700_10004107
268 Ga0207665_10047172
269 Ga0207665_11122932
270 Ga0207711_10030866
271 Ga0207661_10067124
272 Ga0207667_10234460
273 Ga0207667_10650775
274 Ga0207703_10688617
275 Ga0207674_10765065
276 Ga0207698_10317742
277 Ga0265319_1179116
278 Ga0265338_10006826
279 Ga0265338_10042066
280 Ga0265338_10072257
281 Ga0265338_10305482
282 Ga0265328_10045587
283 Ga0265320_10013686
284 Ga0265325_10004817
285 Ga0265325_10014367
286 Ga0265325_10045967
287 Ga0265329_10014495
288 Ga0265339_10007408
289 Ga0265339_10031897
290 Ga0265339_10083905
291 Ga0265331_10004506
292 Ga0265316_10004486
293 Ga0265316_10013848
294 Ga0265316_10050011
295 Ga0265316_10505341
296 Ga0265313_10245664
297 Ga0265314_10185036
298 Ga0265314_10468237
299 Ga0265342_10045211
300 Ga0373926_0211431
301 Ga0373923_0011740
302 Ga0373945_0228540
303 Ga0373953_0089080
304 Ga0373954_0000107
305 Ga0373956_0004407
306 Ga0373957_0000428
307 Ga0373957_0509205
308 Ga0373943_0015700
309 Ga0373955_0000823
310 Ga0373924_0023146
311 Ga0373935_0090781
312 Ga0373933_0000462
313 Ga0373947_0049924
314 Ga0373947_0605024
315 Ga0373937_0001966
316 Ga0373937_0353106
317 Ga0373925_0259895
318 Ga0373925_1335623
319 Ga0436360_0071296
320 Ga0451577_1046208
321 Ga0453683_0377522
322 Ga0466963_0522544
323 Ga0466957_0523879
324 Ga0466959_0405782
325 Ga0451576_0663714
326 Ga0451576_1016062
327 Ga0466958_0115204
328 Ga0495651_0064923
329 Ga0495651_0426304
330 Ga0495653_0324300
331 Ga0495580_0059880
332 Ga0495580_0086127
333 Ga0495664_0213620
334 Ga0495594_0544182
335 Ga0495608_0091305
336 Ga0495628_0057032
337 Ga0495628_0402194
338 Ga0495630_0060365
339 Ga0495630_0436038
340 Ga0495630_1396045
341 Ga0495652_0222930
342 Ga0495665_0060875
343 Ga0495665_0086143
344 Ga0495640_0354477
345 Ga0495587_0002020
346 Ga0495645_0127617
347 Ga0495645_0190802
348 Ga0495645_0406076
349 Ga0495645_0650304
350 Ga0495623_0006502
351 Ga0495623_0022525
352 Ga0495623_0070962
353 Ga0495623_0525598
354 Ga0495613_0250282
355 Ga0495600_0129542
356 Ga0495600_0166104
357 Ga0495581_0121982
358 Ga0495581_0283174
359 Ga0495604_0000424
360 Ga0495604_0353916
361 Ga0495674_0003992
362 Ga0495674_0028381
363 Ga0495674_0988875
364 Ga0495680_0469186
365 Ga0495675_0039278
366 Ga0495675_0212206
367 Ga0495675_0607330
368 Ga0495684_0013361
369 Ga0495684_0037887
370 Ga0495684_0331352
371 Ga0495684_0444761
372 Ga0495602_0013604
373 Ga0495602_0336160
374 Ga0495614_0099736
375 Ga0496113_0983690
376 nmdc:mga0rr50_255993_c1
377 Ga0495601_0063474
378 Ga0495612_0053106
379 Ga0495619_0139947
380 Ga0495619_0241686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

49

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.9277 1 117
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.8773 3 129
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8708 3 121
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8082 1 121
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.8075 3 129
ID Description Score Start End Superfamily
2pn2A00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9027 4 117 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8813 1 119 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8484 39 118 3.30.300.20
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8464 3 118 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8335 5 121 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2U3JZ74-F1-model_v4 OsmC family protein 0.9791 2 134
AF-Q0EXP4-F1-model_v4 OsmC-like protein 0.9752 2 129
AF-A0A7C3W0C0-F1-model_v4 OsmC family peroxiredoxin 0.975 5 129
AF-A0A832KBZ7-F1-model_v4 OsmC family peroxiredoxin 0.9737 2 130
AF-A0A2M7WMS4-F1-model_v4 Osmotically inducible protein OsmC 0.9737 1 104

Map