F292102

General Info

Members Datasets Scaffolds Average Seq Length
190 117 380 202

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100033725|Ga0070708_1000337253
Length 213
Sequence VTAAATVALIDYGAGNVPSVERALQRLGVASKRVTQPSELGSTRAIILPGVGHYAAIIRALDEQNLRACLLEAMAQGVPFLGICLGLQALYSSSEEAPTLSGLNLFSGSVRSLPATVKLPHMGWNRLHLQRTSQLLAGLSDSNYFYFAHTFAAAVSSNSNEVVATCNHGATFTAVLEHKNIFATQFHPEKSGAAGARLLRNFLSLAAGMSDPA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
77 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 1.58
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 15.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100033725 3300005445 Bacteria 4448
2 Ga0070674_100043589 3300005356 Bacteria 3053
3 Ga0070703_10012589 3300005406 Bacteria 2397
4 Ga0070709_10010375 3300005434 Bacteria 5158
5 Ga0070713_100013216 3300005436 Bacteria 6087
6 Ga0070713_100019633 3300005436 Bacteria 5167
7 Ga0070710_10239380 3300005437 Bacteria 1162
8 Ga0070711_100009420 3300005439 Bacteria 6015
9 Ga0070711_100011715 3300005439 Bacteria 5452
10 Ga0070705_100003586 3300005440 Bacteria 7603
11 Ga0070705_100014170 3300005440 Bacteria 4096
12 Ga0070694_100004376 3300005444 Bacteria 8498
13 Ga0070708_100003426 3300005445 Bacteria 12417
14 Ga0070708_100095997 3300005445 Bacteria 2707
15 Ga0070708_100130406 3300005445 Bacteria 2326
16 Ga0070708_100675616 3300005445 Bacteria 973
17 Ga0070706_100114907 3300005467 Bacteria 2506
18 Ga0070707_100023215 3300005468 Bacteria 5867
19 Ga0070707_100062327 3300005468 Bacteria 3577
20 Ga0070707_100362590 3300005468 Bacteria 1408
21 Ga0070698_100007945 3300005471 Bacteria 11478
22 Ga0070698_100437424 3300005471 Bacteria 1243
23 Ga0070699_100008646 3300005518 Bacteria 8826
24 Ga0070699_100828866 3300005518 Unclassified 847
25 Ga0070679_100002920 3300005530 Bacteria 15547
26 Ga0070697_100000286 3300005536 Bacteria 40928
27 Ga0070697_100063808 3300005536 Bacteria 3008
28 Ga0070697_100127146 3300005536 Bacteria 2135
29 Ga0070697_100393278 3300005536 Bacteria 1202
30 Ga0070695_100003015 3300005545 Bacteria 9815
31 Ga0070695_100648302 3300005545 Bacteria 834
32 Ga0070693_100000403 3300005547 Bacteria 19635
33 Ga0070665_100011707 3300005548 Bacteria 8865
34 Ga0070665_100483400 3300005548 Bacteria 1249
35 Ga0070704_100002472 3300005549 Bacteria 10388
36 Ga0068859_100285203 3300005617 Unclassified 1744
37 Ga0068859_100325901 3300005617 Bacteria 1630
38 Ga0068863_100014703 3300005841 Bacteria 7532
39 Ga0068860_100881577 3300005843 Bacteria 910
40 Ga0070717_10377529 3300006028 Bacteria 1271
41 Ga0070715_10060272 3300006163 Bacteria 1663
42 Ga0070716_100000242 3300006173 Bacteria 21872
43 Ga0070716_100000402 3300006173 Bacteria 17771
44 Ga0070716_100048848 3300006173 Bacteria 2394
45 Ga0070716_100177368 3300006173 Unclassified 1396
46 Ga0070712_100027098 3300006175 Bacteria 3824
47 Ga0070712_100031129 3300006175 Bacteria 3592
48 Ga0070712_100239187 3300006175 Bacteria 1446
49 Ga0075366_10062037 3300006195 Bacteria 2222
50 Ga0068871_100002948 3300006358 Bacteria 11672
51 Ga0075433_10167520 3300006852 Bacteria 1955
52 Ga0075434_100016375 3300006871 Bacteria 7126
53 Ga0075436_100009639 3300006914 Bacteria 6609
54 Ga0075436_100032586 3300006914 Bacteria 3592
55 Ga0075436_100373558 3300006914 Unclassified 1030
56 Ga0075436_100462476 3300006914 Bacteria 925
57 Ga0097620_100285213 3300006931 Unclassified 1744
58 Ga0097620_100325894 3300006931 Bacteria 1630
59 Ga0075435_100038924 3300007076 Bacteria 3794
60 Ga0099794_10001826 3300007265 Bacteria 7603
61 Ga0099794_10006647 3300007265 Bacteria 4697
62 Ga0099794_10008131 3300007265 Bacteria 4345
63 Ga0099794_10009873 3300007265 Unclassified 4034
64 Ga0099794_10026107 3300007265 Bacteria 2697
65 Ga0099794_10036415 3300007265 Bacteria 2326
66 Ga0099794_10037630 3300007265 Bacteria 2291
67 Ga0099794_10043098 3300007265 Bacteria 2153
68 Ga0099794_10050863 3300007265 Bacteria 1994
69 Ga0099794_10085227 3300007265 Bacteria 1563
70 Ga0099794_10149433 3300007265 Bacteria 1185
71 Ga0099794_10298392 3300007265 Bacteria 834
72 Ga0099795_10065544 3300007788 Bacteria 1358
73 Ga0105240_10095989 3300009093 Unclassified 3614
74 Ga0105247_10061550 3300009101 Unclassified 2327
75 Ga0105248_10334230 3300009177 Bacteria 1706
76 Ga0105237_10418502 3300009545 Unclassified 1345
77 Ga0099796_10018800 3300010159 Bacteria 2083
78 Ga0157378_10041922 3300013297 Bacteria 4061
79 Ga0163162_10941090 3300013306 Unclassified 975
80 Ga0157375_10404451 3300013308 Bacteria 1532
81 Ga0157379_10282591 3300014968 Bacteria 1510
82 Ga0157376_10000028 3300014969 Bacteria 202069
83 Ga0228598_1000206 3300024227 Bacteria 10905
84 Ga0207699_10004018 3300025906 Bacteria 7039
85 Ga0207699_10011472 3300025906 Bacteria 4476
86 Ga0207684_10000817 3300025910 Bacteria 35995
87 Ga0207684_10019445 3300025910 Bacteria 5812
88 Ga0207654_10244023 3300025911 Unclassified 1201
89 Ga0207693_10004978 3300025915 Bacteria 11151
90 Ga0207693_10076228 3300025915 Bacteria 2626
91 Ga0207693_10217022 3300025915 Bacteria 1503
92 Ga0207663_10003082 3300025916 Bacteria 8080
93 Ga0207663_10066146 3300025916 Bacteria 2313
94 Ga0207663_10175723 3300025916 Bacteria 1525
95 Ga0207652_10005676 3300025921 Bacteria 10125
96 Ga0207646_10000992 3300025922 Bacteria 36429
97 Ga0207646_10046031 3300025922 Bacteria 3915
98 Ga0207646_10531426 3300025922 Bacteria 1058
99 Ga0207646_10783439 3300025922 Bacteria 850
100 Ga0207700_10004218 3300025928 Bacteria 8442
101 Ga0207686_10280565 3300025934 Bacteria 1230
102 Ga0207669_10105042 3300025937 Bacteria 1878
103 Ga0207665_10000584 3300025939 Bacteria 24557
104 Ga0207665_10006221 3300025939 Bacteria 7930
105 Ga0207665_10018847 3300025939 Bacteria 4535
106 Ga0207665_10136636 3300025939 Unclassified 1745
107 Ga0207665_10158103 3300025939 Unclassified 1628
108 Ga0207711_10763041 3300025941 Unclassified 901
109 Ga0207641_10009492 3300026088 Bacteria 8019
110 Ga0209588_1000342 3300027671 Bacteria 12249
111 Ga0209588_1002109 3300027671 Bacteria 5368
112 Ga0209588_1006380 3300027671 Bacteria 3426
113 Ga0209588_1046278 3300027671 Bacteria 1407
114 Ga0265354_1004455 3300028016 Bacteria 1470
115 Ga0268266_10000267 3300028379 Bacteria 86736
116 Ga0265319_1015172 3300028563 Bacteria 2997
117 Ga0265338_10047621 3300028800 Bacteria 3913
118 Ga0265770_1005696 3300030878 Bacteria 1723
119 Ga0265765_1000250 3300030879 Bacteria 3872
120 Ga0265320_10059233 3300031240 Bacteria 1832
121 Ga0265320_10077814 3300031240 Bacteria 1552
122 Ga0265320_10186833 3300031240 Bacteria 928
123 Ga0265325_10004284 3300031241 Bacteria 9046
124 Ga0265329_10018740 3300031242 Bacteria 2361
125 Ga0265340_10111533 3300031247 Unclassified 1264
126 Ga0265340_10261613 3300031247 Unclassified 770
127 Ga0265331_10025811 3300031250 Bacteria 2962
128 Ga0265316_10081930 3300031344 Bacteria 2473
129 Ga0265316_10125714 3300031344 Bacteria 1934
130 Ga0265313_10003012 3300031595 Bacteria 14010
131 Ga0373926_0001829 3300035083 Bacteria 6618
132 Ga0373934_0011034 3300035086 Unclassified 3399
133 Ga0373934_0145047 3300035086 Unclassified 971
134 Ga0373932_0113427 3300035112 Bacteria 896
135 Ga0373953_0260008 3300035117 Unclassified 755
136 Ga0373954_0020935 3300035118 Unclassified 2960
137 Ga0373956_0074338 3300035119 Bacteria 1554
138 Ga0373956_0090514 3300035119 Unclassified 1411
139 Ga0373943_0102657 3300035170 Bacteria 1498
140 Ga0373955_0018523 3300035172 Unclassified 3464
141 Ga0373931_0044105 3300035691 Bacteria 2351
142 Ga0373931_0289163 3300035691 Unclassified 1009
143 Ga0373935_0204221 3300035692 Unclassified 1367
144 Ga0373927_0000179 3300035695 Bacteria 50200
145 Ga0373933_0000401 3300035724 Bacteria 27407
146 Ga0373937_0000173 3300036401 Bacteria 63077
147 Ga0373937_0035820 3300036401 Bacteria 4519
148 Ga0373937_0267448 3300036401 Bacteria 1613
149 Ga0373925_0000500 3300037068 Bacteria 39549
150 Ga0373925_0276637 3300037068 Bacteria 1351
151 Ga0373925_0560950 3300037068 Bacteria 939
152 Ga0395905_0218610 3300037471 Bacteria 1784
153 Ga0495651_0009229 3300046462 Bacteria 7570
154 Ga0495653_0005401 3300046463 Bacteria 10403
155 Ga0495580_0045551 3300046472 Bacteria 3115
156 Ga0495580_0069460 3300046472 Bacteria 2462
157 Ga0495580_0082712 3300046472 Bacteria 2237
158 Ga0495580_0084138 3300046472 Bacteria 2216
159 Ga0495582_0000903 3300046473 Bacteria 16506
160 Ga0495582_0014657 3300046473 Bacteria 4307
161 Ga0495662_0160317 3300046476 Bacteria 1108
162 Ga0495594_0036436 3300046499 Bacteria 2682
163 Ga0495630_0009701 3300046517 Bacteria 6924
164 Ga0495652_0042097 3300046529 Unclassified 3939
165 Ga0495665_0051623 3300046531 Bacteria 2178
166 Ga0495587_0000053 3300046536 Bacteria 99889
167 Ga0495645_0039604 3300046543 Bacteria 3437
168 Ga0495634_0051654 3300046642 Bacteria 2758
169 Ga0495623_0072575 3300046679 Unclassified 2140
170 Ga0495658_0005309 3300046683 Bacteria 6338
171 Ga0495658_0113769 3300046683 Bacteria 1630
172 Ga0495581_0265580 3300047315 Bacteria 1003
173 Ga0495604_0099878 3300047317 Bacteria 2135
174 Ga0495674_0103540 3300047319 Bacteria 2420
175 Ga0495676_0254930 3300047321 Bacteria 1195
176 Ga0495676_0551629 3300047321 Unclassified 753
177 Ga0495675_0061095 3300047444 Unclassified 2387
178 Ga0495593_0075619 3300047673 Bacteria 1746
179 Ga0495602_0000304 3300048088 Bacteria 45402
180 Ga0496104_0050219 3300048907 Bacteria 3936
181 Ga0496114_0962812 3300048917 Archaea 736
182 Ga0496115_0018689 3300048918 Bacteria 5328
183 nmdc:mga0k408_21954_c1 3300050493 Bacteria 3590
184 nmdc:mga0n895_8828_c1 3300050512 Bacteria 8770
185 nmdc:mga0rr50_25152_c1 3300050513 Bacteria 4135
186 nmdc:mga08x19_18155_c1 3300050514 Bacteria 4310
187 nmdc:mga08x19_262319_c1 3300050514 Bacteria 1194
188 nmdc:mga08x19_48984_c1 3300050514 Unclassified 2708
189 nmdc:mga08x19_5949_c1 3300050514 Bacteria 7217
190 nmdc:mga0a205_185047_c1 3300050515 Bacteria 1976
191 Ga0070708_100033725
192 Ga0070674_100043589
193 Ga0070703_10012589
194 Ga0070709_10010375
195 Ga0070713_100013216
196 Ga0070713_100019633
197 Ga0070710_10239380
198 Ga0070711_100009420
199 Ga0070711_100011715
200 Ga0070705_100003586
201 Ga0070705_100014170
202 Ga0070694_100004376
203 Ga0070708_100003426
204 Ga0070708_100095997
205 Ga0070708_100130406
206 Ga0070708_100675616
207 Ga0070706_100114907
208 Ga0070707_100023215
209 Ga0070707_100062327
210 Ga0070707_100362590
211 Ga0070698_100007945
212 Ga0070698_100437424
213 Ga0070699_100008646
214 Ga0070699_100828866
215 Ga0070679_100002920
216 Ga0070697_100000286
217 Ga0070697_100063808
218 Ga0070697_100127146
219 Ga0070697_100393278
220 Ga0070695_100003015
221 Ga0070695_100648302
222 Ga0070693_100000403
223 Ga0070665_100011707
224 Ga0070665_100483400
225 Ga0070704_100002472
226 Ga0068859_100285203
227 Ga0068859_100325901
228 Ga0068863_100014703
229 Ga0068860_100881577
230 Ga0070717_10377529
231 Ga0070715_10060272
232 Ga0070716_100000242
233 Ga0070716_100000402
234 Ga0070716_100048848
235 Ga0070716_100177368
236 Ga0070712_100027098
237 Ga0070712_100031129
238 Ga0070712_100239187
239 Ga0075366_10062037
240 Ga0068871_100002948
241 Ga0075433_10167520
242 Ga0075434_100016375
243 Ga0075436_100009639
244 Ga0075436_100032586
245 Ga0075436_100373558
246 Ga0075436_100462476
247 Ga0097620_100285213
248 Ga0097620_100325894
249 Ga0075435_100038924
250 Ga0099794_10001826
251 Ga0099794_10006647
252 Ga0099794_10008131
253 Ga0099794_10009873
254 Ga0099794_10026107
255 Ga0099794_10036415
256 Ga0099794_10037630
257 Ga0099794_10043098
258 Ga0099794_10050863
259 Ga0099794_10085227
260 Ga0099794_10149433
261 Ga0099794_10298392
262 Ga0099795_10065544
263 Ga0105240_10095989
264 Ga0105247_10061550
265 Ga0105248_10334230
266 Ga0105237_10418502
267 Ga0099796_10018800
268 Ga0157378_10041922
269 Ga0163162_10941090
270 Ga0157375_10404451
271 Ga0157379_10282591
272 Ga0157376_10000028
273 Ga0228598_1000206
274 Ga0207699_10004018
275 Ga0207699_10011472
276 Ga0207684_10000817
277 Ga0207684_10019445
278 Ga0207654_10244023
279 Ga0207693_10004978
280 Ga0207693_10076228
281 Ga0207693_10217022
282 Ga0207663_10003082
283 Ga0207663_10066146
284 Ga0207663_10175723
285 Ga0207652_10005676
286 Ga0207646_10000992
287 Ga0207646_10046031
288 Ga0207646_10531426
289 Ga0207646_10783439
290 Ga0207700_10004218
291 Ga0207686_10280565
292 Ga0207669_10105042
293 Ga0207665_10000584
294 Ga0207665_10006221
295 Ga0207665_10018847
296 Ga0207665_10136636
297 Ga0207665_10158103
298 Ga0207711_10763041
299 Ga0207641_10009492
300 Ga0209588_1000342
301 Ga0209588_1002109
302 Ga0209588_1006380
303 Ga0209588_1046278
304 Ga0265354_1004455
305 Ga0268266_10000267
306 Ga0265319_1015172
307 Ga0265338_10047621
308 Ga0265770_1005696
309 Ga0265765_1000250
310 Ga0265320_10059233
311 Ga0265320_10077814
312 Ga0265320_10186833
313 Ga0265325_10004284
314 Ga0265329_10018740
315 Ga0265340_10111533
316 Ga0265340_10261613
317 Ga0265331_10025811
318 Ga0265316_10081930
319 Ga0265316_10125714
320 Ga0265313_10003012
321 Ga0373926_0001829
322 Ga0373934_0011034
323 Ga0373934_0145047
324 Ga0373932_0113427
325 Ga0373953_0260008
326 Ga0373954_0020935
327 Ga0373956_0074338
328 Ga0373956_0090514
329 Ga0373943_0102657
330 Ga0373955_0018523
331 Ga0373931_0044105
332 Ga0373931_0289163
333 Ga0373935_0204221
334 Ga0373927_0000179
335 Ga0373933_0000401
336 Ga0373937_0000173
337 Ga0373937_0035820
338 Ga0373937_0267448
339 Ga0373925_0000500
340 Ga0373925_0276637
341 Ga0373925_0560950
342 Ga0395905_0218610
343 Ga0495651_0009229
344 Ga0495653_0005401
345 Ga0495580_0045551
346 Ga0495580_0069460
347 Ga0495580_0082712
348 Ga0495580_0084138
349 Ga0495582_0000903
350 Ga0495582_0014657
351 Ga0495662_0160317
352 Ga0495594_0036436
353 Ga0495630_0009701
354 Ga0495652_0042097
355 Ga0495665_0051623
356 Ga0495587_0000053
357 Ga0495645_0039604
358 Ga0495634_0051654
359 Ga0495623_0072575
360 Ga0495658_0005309
361 Ga0495658_0113769
362 Ga0495581_0265580
363 Ga0495604_0099878
364 Ga0495674_0103540
365 Ga0495676_0254930
366 Ga0495676_0551629
367 Ga0495675_0061095
368 Ga0495593_0075619
369 Ga0495602_0000304
370 Ga0496104_0050219
371 Ga0496114_0962812
372 Ga0496115_0018689
373 nmdc:mga0k408_21954_c1
374 nmdc:mga0n895_8828_c1
375 nmdc:mga0rr50_25152_c1
376 nmdc:mga08x19_18155_c1
377 nmdc:mga08x19_262319_c1
378 nmdc:mga08x19_48984_c1
379 nmdc:mga08x19_5949_c1
380 nmdc:mga0a205_185047_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

21

188

0.86

PF00117

GATase

Glutamine amidotransferase class-I

8

206

0.85

PF07722

Peptidase_C26

Peptidase C26

58

189

0.78

PF01174

SNO

SNO glutamine amidotransferase family

13

205

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9308 1 198
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9217 1 198
1ox6-assembly2.cif.gz_B towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase 0.9155 2 198
1ox4-assembly1.cif.gz_A towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase 0.9122 2 198
1ox5-assembly2.cif.gz_B towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase 0.91 3 198
ID Description Score Start End Superfamily
af_Q9SZ30_59_284_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9481 2 196 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9343 2 197 3.40.50.880
1ka9H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9308 1 198 3.40.50.880
af_A0A1D6L7F2_93_266_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9304 22 185 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9233 3 197 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V9HET8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9828 1 200 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A2V9HET8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.978 1 200 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A1Q7VB25-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9777 1 181 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0016829
AF-A0A522RDP7-F1-model_v4 Multifunctional fusion protein [Includes: Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) (EC 3.5.1.2); Imidazole glycerol phosphate synthase subunit HisF (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF)] 0.9769 3 196 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A7C5Z272-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9711 3 197 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829

Map