F292091

General Info

Members Datasets Scaffolds Average Seq Length
190 80 380 336

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100032839|Ga0070705_1000328392
Length 363
Sequence MAVKSGSIPRAVQPQDRRMSDVIHDTLRRPLASLRLSVTDRCNLRCRYCMPEDEYAWLPRTSILTFEEIERLTGVFSGLGVHKVRLTGGEPLLRHDLSTLVAMIARNPRIRDLAITTNGLLLGKHAAALRTAGLQRVTVSLDTLRPERMLAFAKSARHADVLEGIAAARQAGFARLKLNAVVIRGFNDDELTDLIEFARAHDAEVRFIEYMDVGGATRWSRDQVVSQREMLDVLAQRYGAIEPIRPIGDDGRAPAERFRLADGTTFGIIASVTAPFCRTCDRSRITADGTWFLCLYAGAGIDLREPLRRGAPDEELASLIRETWQGRTDRGAEERLGVADRGALYRIESLRADPHREMHTRGG

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
53 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
64 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
65 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
66 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
70 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
71 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
79 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
80 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100032839 3300005440 Bacteria 2887
2 Ga0070680_100008119 3300005336 Bacteria 8016
3 Ga0070680_100452937 3300005336 Bacteria 1096
4 Ga0070689_100050317 3300005340 Bacteria 3219
5 Ga0070692_10006103 3300005345 Bacteria 5205
6 Ga0070703_10001016 3300005406 Bacteria 8793
7 Ga0070703_10006722 3300005406 Bacteria 3223
8 Ga0070709_10003076 3300005434 Bacteria 8965
9 Ga0070701_10001967 3300005438 Bacteria 7787
10 Ga0070711_100000082 3300005439 Bacteria 52402
11 Ga0070705_100008984 3300005440 Bacteria 4959
12 Ga0070705_100020594 3300005440 Bacteria 3494
13 Ga0070705_100102729 3300005440 Bacteria 1808
14 Ga0070700_100091453 3300005441 Bacteria 1987
15 Ga0070694_100012826 3300005444 Bacteria 5223
16 Ga0070694_100018153 3300005444 Bacteria 4461
17 Ga0070694_100019198 3300005444 Bacteria 4346
18 Ga0070694_100072802 3300005444 Bacteria 2371
19 Ga0070694_100157323 3300005444 Bacteria 1664
20 Ga0070708_100006652 3300005445 Bacteria 9204
21 Ga0070708_100031012 3300005445 Bacteria 4625
22 Ga0070708_100070954 3300005445 Bacteria 3135
23 Ga0070708_100085862 3300005445 Bacteria 2857
24 Ga0070706_100023616 3300005467 Bacteria 5662
25 Ga0070706_100115768 3300005467 Bacteria 2496
26 Ga0070706_100155074 3300005467 Bacteria 2138
27 Ga0070707_100000560 3300005468 Bacteria 37407
28 Ga0070707_100003354 3300005468 Bacteria 15121
29 Ga0070707_100027686 3300005468 Bacteria 5391
30 Ga0070707_100030383 3300005468 Bacteria 5143
31 Ga0070707_100049447 3300005468 Bacteria 4030
32 Ga0070707_100149320 3300005468 Bacteria 2275
33 Ga0070698_100062088 3300005471 Bacteria 3770
34 Ga0070698_100088550 3300005471 Bacteria 3081
35 Ga0070698_100113840 3300005471 Unclassified 2670
36 Ga0070699_100001873 3300005518 Bacteria 19028
37 Ga0070699_100009871 3300005518 Bacteria 8265
38 Ga0070699_100024297 3300005518 Bacteria 5221
39 Ga0070699_100046898 3300005518 Bacteria 3739
40 Ga0070699_100207083 3300005518 Bacteria 1745
41 Ga0070679_100070742 3300005530 Bacteria 3480
42 Ga0070697_100019748 3300005536 Bacteria 5323
43 Ga0070697_100023901 3300005536 Bacteria 4863
44 Ga0070697_100047542 3300005536 Bacteria 3479
45 Ga0070697_100049893 3300005536 Bacteria 3396
46 Ga0070697_100070535 3300005536 Bacteria 2865
47 Ga0070697_100085370 3300005536 Bacteria 2604
48 Ga0070697_100120820 3300005536 Bacteria 2191
49 Ga0070695_100016580 3300005545 Bacteria 4461
50 Ga0070695_100041297 3300005545 Bacteria 2923
51 Ga0070695_100120868 3300005545 Bacteria 1791
52 Ga0070696_100002676 3300005546 Bacteria 11808
53 Ga0070696_100050378 3300005546 Unclassified 2894
54 Ga0070704_100000226 3300005549 Bacteria 23807
55 Ga0070704_100003465 3300005549 Bacteria 9052
56 Ga0070704_100007252 3300005549 Bacteria 6594
57 Ga0070704_100229074 3300005549 Bacteria 1515
58 Ga0070702_100219754 3300005615 Bacteria 1270
59 Ga0075428_100032294 3300006844 Bacteria 5782
60 Ga0075428_100042330 3300006844 Bacteria 5007
61 Ga0075428_100121950 3300006844 Bacteria 2838
62 Ga0075428_100295522 3300006844 Bacteria 1742
63 Ga0075430_100038077 3300006846 Bacteria 4076
64 Ga0075430_100405943 3300006846 Bacteria 1125
65 Ga0075431_100023493 3300006847 Bacteria 6309
66 Ga0075433_10000474 3300006852 Bacteria 26163
67 Ga0075433_10012211 3300006852 Bacteria 6928
68 Ga0075433_10024574 3300006852 Bacteria 5087
69 Ga0075433_10174322 3300006852 Bacteria 1913
70 Ga0075433_10227487 3300006852 Bacteria 1656
71 Ga0075433_10347703 3300006852 Bacteria 1310
72 Ga0075434_100010296 3300006871 Bacteria 8764
73 Ga0075434_100013359 3300006871 Bacteria 7809
74 Ga0075429_100019512 3300006880 Bacteria 5875
75 Ga0075436_100003761 3300006914 Bacteria 10403
76 Ga0075436_100008143 3300006914 Bacteria 7176
77 Ga0075436_100032737 3300006914 Bacteria 3583
78 Ga0075436_100050161 3300006914 Bacteria 2879
79 Ga0075436_100060862 3300006914 Bacteria 2608
80 Ga0075436_100202952 3300006914 Bacteria 1404
81 Ga0075435_100028512 3300007076 Bacteria 4379
82 Ga0075435_100059885 3300007076 Bacteria 3087
83 Ga0075435_100072094 3300007076 Bacteria 2822
84 Ga0075435_100224236 3300007076 Bacteria 1596
85 Ga0075435_100232766 3300007076 Bacteria 1565
86 Ga0099794_10000392 3300007265 Bacteria 14789
87 Ga0099794_10015719 3300007265 Bacteria 3345
88 Ga0099796_10027025 3300010159 Bacteria 1829
89 Ga0157369_10001411 3300013105 Bacteria 29522
90 Ga0207653_10000511 3300025885 Bacteria 14871
91 Ga0207653_10002454 3300025885 Bacteria 5891
92 Ga0207684_10011717 3300025910 Bacteria 7649
93 Ga0207684_10049187 3300025910 Bacteria 3577
94 Ga0207684_10068683 3300025910 Bacteria 3011
95 Ga0207707_10000702 3300025912 Bacteria 33259
96 Ga0207663_10000338 3300025916 Bacteria 20484
97 Ga0207660_10009841 3300025917 Bacteria 6191
98 Ga0207660_10028274 3300025917 Bacteria 3834
99 Ga0207652_10002164 3300025921 Bacteria 16837
100 Ga0207652_10007303 3300025921 Bacteria 8901
101 Ga0207646_10001365 3300025922 Bacteria 30231
102 Ga0207646_10013127 3300025922 Bacteria 7929
103 Ga0207646_10016181 3300025922 Bacteria 7009
104 Ga0207646_10023689 3300025922 Bacteria 5635
105 Ga0207646_10061129 3300025922 Bacteria 3363
106 Ga0207665_10009498 3300025939 Bacteria 6388
107 Ga0209588_1000599 3300027671 Bacteria 9129
108 Ga0209588_1020397 3300027671 Bacteria 2076
109 Ga0307408_100008372 3300031548 Bacteria 6830
110 Ga0307408_100146875 3300031548 Bacteria 1857
111 Ga0307413_10006521 3300031824 Bacteria 5342
112 Ga0307413_10105166 3300031824 Unclassified 1876
113 Ga0307410_10131266 3300031852 Bacteria 1840
114 Ga0307410_10216955 3300031852 Unclassified 1469
115 Ga0307407_10019304 3300031903 Bacteria 3468
116 Ga0307412_10127807 3300031911 Bacteria 1841
117 Ga0307409_100000894 3300031995 Bacteria 13819
118 Ga0307409_100053544 3300031995 Bacteria 3101
119 Ga0307409_100147314 3300031995 Bacteria 2038
120 Ga0307416_100015330 3300032002 Bacteria 5291
121 Ga0307416_100208018 3300032002 Bacteria 1863
122 Ga0307411_10008839 3300032005 Bacteria 5248
123 Ga0307411_10033913 3300032005 Bacteria 3171
124 Ga0451577_0095363 3300042876 Bacteria 2657
125 Ga0451577_0096256 3300042876 Bacteria 2643
126 Ga0453683_0005077 3300044673 Bacteria 9236
127 Ga0453683_0076041 3300044673 Bacteria 2102
128 Ga0451576_0021172 3300045051 Bacteria 7069
129 Ga0451576_0037916 3300045051 Bacteria 5103
130 Ga0451576_0057820 3300045051 Bacteria 4053
131 Ga0451576_0072557 3300045051 Bacteria 3582
132 Ga0451576_0074434 3300045051 Bacteria 3534
133 Ga0451576_0126693 3300045051 Bacteria 2660
134 Ga0451576_0179793 3300045051 Bacteria 2208
135 Ga0451576_0290060 3300045051 Bacteria 1711
136 Ga0501031_0164509 3300049568 Bacteria 1450
137 Ga0501032_0008058 3300049569 Bacteria 7679
138 Ga0501032_0045040 3300049569 Bacteria 2985
139 Ga0501032_0063187 3300049569 Bacteria 2479
140 Ga0501034_0145398 3300049571 Bacteria 2348
141 Ga0501036_0276522 3300049572 Bacteria 1405
142 Ga0501037_0003410 3300049573 Bacteria 11558
143 Ga0501038_0003572 3300049574 Bacteria 14468
144 Ga0501039_0342662 3300049575 Bacteria 1175
145 Ga0501042_0052205 3300049578 Bacteria 2916
146 Ga0501042_0245099 3300049578 Bacteria 1293
147 Ga0501046_0033981 3300049580 Bacteria 4117
148 Ga0501046_0279540 3300049580 Bacteria 1223
149 Ga0501048_0194803 3300049582 Bacteria 1436
150 Ga0501067_0018410 3300049583 Bacteria 3870
151 Ga0501067_0198222 3300049583 Bacteria 1118
152 Ga0501068_0121850 3300049584 Bacteria 1626
153 Ga0501069_0107575 3300049585 Bacteria 1586
154 Ga0501069_0192093 3300049585 Bacteria 1181
155 Ga0501070_0013416 3300049586 Bacteria 6907
156 Ga0501070_0077849 3300049586 Bacteria 2744
157 Ga0501070_0257361 3300049586 Bacteria 1427
158 Ga0501070_0306868 3300049586 Bacteria 1292
159 Ga0501071_0015280 3300049587 Bacteria 5268
160 Ga0501072_0064700 3300049588 Bacteria 2884
161 Ga0501073_0033022 3300049589 Bacteria 3687
162 Ga0501074_0004999 3300049590 Bacteria 9515
163 Ga0501075_0028917 3300049591 Bacteria 4095
164 Ga0501076_0186616 3300049592 Bacteria 1691
165 Ga0501080_0182381 3300049742 Bacteria 1931
166 Ga0501045_0019145 3300049824 Bacteria 4876
167 Ga0501045_0033700 3300049824 Bacteria 3714
168 nmdc:mga05p37_78746_c1 3300050507 Unclassified 4059
169 nmdc:mga0qj67_324538_c1 3300050509 Bacteria 1246
170 nmdc:mga0n895_1521_c1 3300050512 Bacteria 17406
171 nmdc:mga0n895_1526_c1 3300050512 Bacteria 17388
172 nmdc:mga0n895_33484_c1 3300050512 Bacteria 4940
173 nmdc:mga0n895_34143_c1 3300050512 Bacteria 4895
174 nmdc:mga0n895_4745_c1 3300050512 Bacteria 11230
175 nmdc:mga0n895_5733_c1 3300050512 Bacteria 10424
176 nmdc:mga0n895_595215_c1 3300050512 Bacteria 1109
177 nmdc:mga0rr50_170586_c1 3300050513 Bacteria 1773
178 nmdc:mga0rr50_197053_c1 3300050513 Bacteria 1654
179 nmdc:mga0rr50_34342_c1 3300050513 Bacteria 3631
180 nmdc:mga0rr50_385884_c1 3300050513 Bacteria 1182
181 nmdc:mga0rr50_392618_c1 3300050513 Bacteria 1171
182 nmdc:mga0rr50_88521_c1 3300050513 Bacteria 2406
183 nmdc:mga08x19_10089_c1 3300050514 Bacteria 5665
184 nmdc:mga08x19_13887_c1 3300050514 Bacteria 4877
185 nmdc:mga08x19_33544_c1 3300050514 Bacteria 3240
186 nmdc:mga0a205_11850_c1 3300050515 Bacteria 8047
187 nmdc:mga0a205_129050_c1 3300050515 Bacteria 2429
188 nmdc:mga0a205_176070_c1 3300050515 Bacteria 2035
189 nmdc:mga0a205_33904_c1 3300050515 Bacteria 4896
190 nmdc:mga0a205_948_c1 3300050515 Bacteria 23916
191 Ga0070705_100032839
192 Ga0070680_100008119
193 Ga0070680_100452937
194 Ga0070689_100050317
195 Ga0070692_10006103
196 Ga0070703_10001016
197 Ga0070703_10006722
198 Ga0070709_10003076
199 Ga0070701_10001967
200 Ga0070711_100000082
201 Ga0070705_100008984
202 Ga0070705_100020594
203 Ga0070705_100102729
204 Ga0070700_100091453
205 Ga0070694_100012826
206 Ga0070694_100018153
207 Ga0070694_100019198
208 Ga0070694_100072802
209 Ga0070694_100157323
210 Ga0070708_100006652
211 Ga0070708_100031012
212 Ga0070708_100070954
213 Ga0070708_100085862
214 Ga0070706_100023616
215 Ga0070706_100115768
216 Ga0070706_100155074
217 Ga0070707_100000560
218 Ga0070707_100003354
219 Ga0070707_100027686
220 Ga0070707_100030383
221 Ga0070707_100049447
222 Ga0070707_100149320
223 Ga0070698_100062088
224 Ga0070698_100088550
225 Ga0070698_100113840
226 Ga0070699_100001873
227 Ga0070699_100009871
228 Ga0070699_100024297
229 Ga0070699_100046898
230 Ga0070699_100207083
231 Ga0070679_100070742
232 Ga0070697_100019748
233 Ga0070697_100023901
234 Ga0070697_100047542
235 Ga0070697_100049893
236 Ga0070697_100070535
237 Ga0070697_100085370
238 Ga0070697_100120820
239 Ga0070695_100016580
240 Ga0070695_100041297
241 Ga0070695_100120868
242 Ga0070696_100002676
243 Ga0070696_100050378
244 Ga0070704_100000226
245 Ga0070704_100003465
246 Ga0070704_100007252
247 Ga0070704_100229074
248 Ga0070702_100219754
249 Ga0075428_100032294
250 Ga0075428_100042330
251 Ga0075428_100121950
252 Ga0075428_100295522
253 Ga0075430_100038077
254 Ga0075430_100405943
255 Ga0075431_100023493
256 Ga0075433_10000474
257 Ga0075433_10012211
258 Ga0075433_10024574
259 Ga0075433_10174322
260 Ga0075433_10227487
261 Ga0075433_10347703
262 Ga0075434_100010296
263 Ga0075434_100013359
264 Ga0075429_100019512
265 Ga0075436_100003761
266 Ga0075436_100008143
267 Ga0075436_100032737
268 Ga0075436_100050161
269 Ga0075436_100060862
270 Ga0075436_100202952
271 Ga0075435_100028512
272 Ga0075435_100059885
273 Ga0075435_100072094
274 Ga0075435_100224236
275 Ga0075435_100232766
276 Ga0099794_10000392
277 Ga0099794_10015719
278 Ga0099796_10027025
279 Ga0157369_10001411
280 Ga0207653_10000511
281 Ga0207653_10002454
282 Ga0207684_10011717
283 Ga0207684_10049187
284 Ga0207684_10068683
285 Ga0207707_10000702
286 Ga0207663_10000338
287 Ga0207660_10009841
288 Ga0207660_10028274
289 Ga0207652_10002164
290 Ga0207652_10007303
291 Ga0207646_10001365
292 Ga0207646_10013127
293 Ga0207646_10016181
294 Ga0207646_10023689
295 Ga0207646_10061129
296 Ga0207665_10009498
297 Ga0209588_1000599
298 Ga0209588_1020397
299 Ga0307408_100008372
300 Ga0307408_100146875
301 Ga0307413_10006521
302 Ga0307413_10105166
303 Ga0307410_10131266
304 Ga0307410_10216955
305 Ga0307407_10019304
306 Ga0307412_10127807
307 Ga0307409_100000894
308 Ga0307409_100053544
309 Ga0307409_100147314
310 Ga0307416_100015330
311 Ga0307416_100208018
312 Ga0307411_10008839
313 Ga0307411_10033913
314 Ga0451577_0095363
315 Ga0451577_0096256
316 Ga0453683_0005077
317 Ga0453683_0076041
318 Ga0451576_0021172
319 Ga0451576_0037916
320 Ga0451576_0057820
321 Ga0451576_0072557
322 Ga0451576_0074434
323 Ga0451576_0126693
324 Ga0451576_0179793
325 Ga0451576_0290060
326 Ga0501031_0164509
327 Ga0501032_0008058
328 Ga0501032_0045040
329 Ga0501032_0063187
330 Ga0501034_0145398
331 Ga0501036_0276522
332 Ga0501037_0003410
333 Ga0501038_0003572
334 Ga0501039_0342662
335 Ga0501042_0052205
336 Ga0501042_0245099
337 Ga0501046_0033981
338 Ga0501046_0279540
339 Ga0501048_0194803
340 Ga0501067_0018410
341 Ga0501067_0198222
342 Ga0501068_0121850
343 Ga0501069_0107575
344 Ga0501069_0192093
345 Ga0501070_0013416
346 Ga0501070_0077849
347 Ga0501070_0257361
348 Ga0501070_0306868
349 Ga0501071_0015280
350 Ga0501072_0064700
351 Ga0501073_0033022
352 Ga0501074_0004999
353 Ga0501075_0028917
354 Ga0501076_0186616
355 Ga0501080_0182381
356 Ga0501045_0019145
357 Ga0501045_0033700
358 nmdc:mga05p37_78746_c1
359 nmdc:mga0qj67_324538_c1
360 nmdc:mga0n895_1521_c1
361 nmdc:mga0n895_1526_c1
362 nmdc:mga0n895_33484_c1
363 nmdc:mga0n895_34143_c1
364 nmdc:mga0n895_4745_c1
365 nmdc:mga0n895_5733_c1
366 nmdc:mga0n895_595215_c1
367 nmdc:mga0rr50_170586_c1
368 nmdc:mga0rr50_197053_c1
369 nmdc:mga0rr50_34342_c1
370 nmdc:mga0rr50_385884_c1
371 nmdc:mga0rr50_392618_c1
372 nmdc:mga0rr50_88521_c1
373 nmdc:mga08x19_10089_c1
374 nmdc:mga08x19_13887_c1
375 nmdc:mga08x19_33544_c1
376 nmdc:mga0a205_11850_c1
377 nmdc:mga0a205_129050_c1
378 nmdc:mga0a205_176070_c1
379 nmdc:mga0a205_33904_c1
380 nmdc:mga0a205_948_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

36

198

0.97

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

203

333

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9327 2 308
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9263 1 309
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.877 1 309
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8747 2 308
6b4c-assembly5.cif.gz_E structure of viperin from trichoderma virens 0.8103 8 213
ID Description Score Start End Superfamily
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.97 2 337 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9644 2 337 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9327 2 308 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9109 2 325 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9088 2 337 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2A5DHD3-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9801 2 337 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-A0A2A5DHD3-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9744 2 337 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047
AF-W4L4M7-F1-model_v4 Radical SAM core domain-containing protein 0.9698 2 221 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A2V5MKD8-F1-model_v4 GTP 3',8-cyclase MoaA 0.9669 2 185 GO:0006777
GO:0046872
GO:0051536
GO:0061798
GO:0061799
AF-A0A2D5XL18-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) (Molybdenum cofactor biosynthesis protein A) 0.9649 1 337 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
GO:1904047

Map