F291461

General Info

Members Datasets Scaffolds Average Seq Length
189 143 184 140

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0248702|Ga0495670_0248702_25_495
Length 156
Sequence MTFIATRKDRTMIDWSIFTLWTSLAGGLVIGVSAALFVLFNGRIAGISGILGGLLRPATGDIGWRIAFLLGLVLAPLAYAAVLPLPAVRVDAGTGTLVVAGLLVGVGTRYASGCTSGHGVCGISRLSPRSLLATLVFMAAGFATVFAVRHLFTQGA

Samples

Sample ID Description Type Environment
1 2511231012 Pseudomonas sp. GM33 Isolate Nodule
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
5 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
60 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
61 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
62 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
63 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
64 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
65 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
66 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
67 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
68 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
71 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
72 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
73 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
76 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
77 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
143 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.99
Nodule 0.53
Rhizoplane 4.76
Rhizosphere 79.37
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10033285 3300003316 Bacteria 1356
2 Ga0055524_1000010 3300003775 Bacteria 282893
3 Ga0065165_1020123 3300005262 Bacteria 2361
4 Ga0065714_10095469 3300005288 Bacteria 1786
5 Ga0070658_10305855 3300005327 Bacteria 1356
6 Ga0070680_100472704 3300005336 Bacteria 1071
7 Ga0070682_100342400 3300005337 Unclassified 1112
8 Ga0070705_100453969 3300005440 Bacteria 962
9 Ga0070700_100519627 3300005441 Bacteria 919
10 Ga0070698_100603474 3300005471 Bacteria 1038
11 Ga0070704_100030197 3300005549 Bacteria 3629
12 Ga0068861_100270752 3300005719 Bacteria 1458
13 Ga0068858_101887049 3300005842 Bacteria 590
14 Ga0075365_10634509 3300006038 Bacteria 755
15 Ga0105244_10009915 3300009036 Bacteria 5813
16 Ga0105250_10041003 3300009092 Bacteria 1856
17 Ga0105243_10012104 3300009148 Bacteria 6521
18 Ga0105242_10092756 3300009176 Bacteria 2544
19 Ga0157371_10252927 3300013102 Bacteria 1269
20 Ga0157370_10079454 3300013104 Bacteria 3088
21 Ga0157378_10110856 3300013297 Bacteria 2515
22 Ga0182008_10002082 3300014497 Bacteria 12787
23 Ga0157376_11791417 3300014969 Bacteria 650
24 Ga0163161_10178192 3300017792 Bacteria 1628
25 Ga0209565_1010299 3300025263 Bacteria 2324
26 Ga0209676_1004442 3300025292 Bacteria 7819
27 Ga0209564_1024910 3300025295 Bacteria 2031
28 Ga0209050_1000536 3300025298 Bacteria 62968
29 Ga0209256_1000007 3300025299 Bacteria 1136599
30 Ga0209051_1001536 3300025303 Bacteria 19214
31 Ga0207655_1055879 3300025728 Bacteria 1560
32 Ga0207713_1024065 3300025735 Bacteria 2848
33 Ga0207705_10564807 3300025909 Bacteria 885
34 Ga0207660_10199335 3300025917 Bacteria 1563
35 Ga0207657_10523041 3300025919 Bacteria 928
36 Ga0207706_10096987 3300025933 Bacteria 2593
37 Ga0207686_10162392 3300025934 Bacteria 1567
38 Ga0207709_10254621 3300025935 Bacteria 1284
39 Ga0207689_10132686 3300025942 Bacteria 2050
40 Ga0207703_11138772 3300026035 Bacteria 750
41 Ga0207675_100326386 3300026118 Bacteria 1499
42 Ga0209970_1002335 3300027614 Bacteria 3236
43 Ga0209974_10051699 3300027876 Bacteria 1382
44 Ga0307408_100300136 3300031548 Bacteria 1345
45 Ga0307413_10335080 3300031824 Bacteria 1161
46 Ga0307410_10567473 3300031852 Bacteria 943
47 Ga0307406_10479788 3300031901 Bacteria 1004
48 Ga0307412_10269065 3300031911 Bacteria 1332
49 Ga0307416_100356826 3300032002 Bacteria 1482
50 Ga0307411_10128800 3300032005 Bacteria 1846
51 Ga0395899_0324578 3300037312 Bacteria 1036
52 Ga0395900_0080968 3300037418 Bacteria 3337
53 Ga0395900_0163872 3300037418 Bacteria 2266
54 Ga0395900_0781549 3300037418 Bacteria 884
55 Ga0395905_0006945 3300037471 Bacteria 11315
56 Ga0439447_018845 3300041407 Bacteria 1851
57 Ga0439466_0030801 3300041411 Bacteria 1837
58 Ga0439431_0000349 3300041997 Bacteria 9703
59 Ga0439431_0245333 3300041997 Bacteria 530
60 Ga0439437_038404 3300042000 Bacteria 617
61 Ga0439452_020521 3300042010 Bacteria 1732
62 Ga0439456_005644 3300042013 Bacteria 2543
63 Ga0439462_0000841 3300042015 Bacteria 6420
64 Ga0450897_002072 3300042128 Bacteria 1460
65 Ga0450894_013809 3300042131 Bacteria 1062
66 Ga0450898_022228 3300042134 Bacteria 1121
67 Ga0450903_002850 3300042138 Bacteria 3024
68 Ga0450906_013141 3300042145 Bacteria 1530
69 Ga0439446_0010675 3300042156 Bacteria 2479
70 Ga0439446_0148056 3300042156 Bacteria 770
71 Ga0450909_002632 3300042185 Bacteria 2545
72 Ga0439460_0039584 3300042461 Bacteria 1378
73 Ga0451577_1633928 3300042876 Bacteria 568
74 Ga0466981_0426863 3300044669 Bacteria 775
75 Ga0495603_0010544 3300046455 Bacteria 5598
76 Ga0495591_030992 3300046458 Bacteria 1609
77 Ga0495629_0003128 3300046459 Bacteria 12551
78 Ga0495582_0147035 3300046473 Bacteria 1337
79 Ga0495605_0001791 3300046474 Bacteria 13783
80 Ga0495605_0340278 3300046474 Bacteria 630
81 Ga0495639_0542092 3300046475 Bacteria 596
82 Ga0495584_0011487 3300046491 Bacteria 4536
83 Ga0495585_0016240 3300046492 Bacteria 4312
84 Ga0495585_0046178 3300046492 Bacteria 2429
85 Ga0495594_0005718 3300046499 Bacteria 6389
86 Ga0495594_0007381 3300046499 Bacteria 5654
87 Ga0495594_0433345 3300046499 Bacteria 747
88 Ga0495607_0316705 3300046501 Bacteria 729
89 Ga0495583_0000134 3300046506 Bacteria 124077
90 Ga0495583_0070601 3300046506 Bacteria 1536
91 Ga0495606_0001496 3300046507 Bacteria 31075
92 Ga0495606_0052343 3300046507 Bacteria 2656
93 Ga0495606_0413906 3300046507 Bacteria 699
94 Ga0495610_0011992 3300046512 Bacteria 5251
95 Ga0495616_0007970 3300046513 Bacteria 6314
96 Ga0495631_0006515 3300046518 Bacteria 6023
97 Ga0495631_0011390 3300046518 Bacteria 4373
98 Ga0495632_0021184 3300046519 Bacteria 3506
99 Ga0495643_0052085 3300046522 Bacteria 2199
100 Ga0495644_0001445 3300046523 Bacteria 9708
101 Ga0495644_0008480 3300046523 Bacteria 3959
102 Ga0495648_0020199 3300046524 Bacteria 4656
103 Ga0495648_0030704 3300046524 Bacteria 3549
104 Ga0495648_0043116 3300046524 Bacteria 2832
105 Ga0495666_0015827 3300046526 Bacteria 3758
106 Ga0495642_0003805 3300046528 Bacteria 5912
107 Ga0495642_0020542 3300046528 Bacteria 2594
108 Ga0495654_0022392 3300046530 Bacteria 3282
109 Ga0495654_0119830 3300046530 Bacteria 1192
110 Ga0495587_0023801 3300046536 Bacteria 3762
111 Ga0495609_0001969 3300046538 Bacteria 13017
112 Ga0495609_0320505 3300046538 Bacteria 629
113 Ga0495621_0017267 3300046539 Bacteria 2330
114 Ga0495621_0395226 3300046539 Bacteria 586
115 Ga0495621_0396393 3300046539 Bacteria 585
116 Ga0495597_0008101 3300046542 Bacteria 5286
117 Ga0495597_0012618 3300046542 Bacteria 4070
118 Ga0495622_0006192 3300046557 Bacteria 5556
119 Ga0495633_0036685 3300046558 Bacteria 2347
120 Ga0495633_0042913 3300046558 Bacteria 2146
121 Ga0495668_0003980 3300046616 Bacteria 10763
122 Ga0495668_0013835 3300046616 Bacteria 4745
123 Ga0495611_0008349 3300046648 Bacteria 4384
124 Ga0495611_0019311 3300046648 Bacteria 2926
125 Ga0495611_0279862 3300046648 Bacteria 771
126 Ga0495625_0034995 3300046660 Bacteria 3704
127 Ga0495625_0154195 3300046660 Bacteria 1542
128 Ga0495625_0407344 3300046660 Bacteria 848
129 Ga0495661_0017732 3300046665 Bacteria 4693
130 Ga0495661_0059702 3300046665 Bacteria 2269
131 Ga0495661_0112330 3300046665 Bacteria 1516
132 Ga0495588_0003214 3300046674 Bacteria 7079
133 Ga0495588_0004087 3300046674 Bacteria 6421
134 Ga0495588_0028686 3300046674 Bacteria 2788
135 Ga0495623_0020293 3300046679 Bacteria 4295
136 Ga0495670_0006621 3300046691 Bacteria 5698
137 Ga0495670_0025045 3300046691 Bacteria 2951
138 Ga0495670_0028818 3300046691 Bacteria 2753
139 Ga0495670_0248702 3300046691 Bacteria 947
140 Ga0495670_0534282 3300046691 Bacteria 638
141 Ga0495671_0148494 3300046692 Bacteria 1141
142 Ga0495649_0000750 3300046694 Bacteria 26137
143 Ga0495589_0110688 3300046794 Bacteria 1325
144 Ga0495660_0000799 3300046810 Bacteria 23611
145 Ga0495660_0021858 3300046810 Bacteria 3659
146 Ga0495660_0242633 3300046810 Bacteria 839
147 Ga0495604_0026000 3300047317 Bacteria 4662
148 Ga0495672_0000019 3300047320 Bacteria 448153
149 Ga0495683_0050437 3300047323 Bacteria 2083
150 Ga0495683_0386658 3300047323 Bacteria 584
151 Ga0495687_010372 3300047443 Bacteria 5113
152 Ga0495675_0000551 3300047444 Bacteria 24231
153 Ga0495675_0246121 3300047444 Bacteria 1075
154 Ga0495677_0001319 3300047445 Bacteria 9933
155 Ga0495677_0009606 3300047445 Bacteria 3569
156 Ga0495686_0609983 3300047472 Bacteria 564
157 Ga0495614_0003746 3300048089 Bacteria 6836
158 Ga0495614_0508964 3300048089 Bacteria 573
159 Ga0495626_0082067 3300048091 Bacteria 1430
160 Ga0496100_0286725 3300048903 Bacteria 1229
161 Ga0496101_0243260 3300048904 Bacteria 1400
162 Ga0496109_0089219 3300048912 Bacteria 2850
163 Ga0496112_0498456 3300048915 Bacteria 1153
164 Ga0496113_0001305 3300048916 Bacteria 13776
165 Ga0496114_0166130 3300048917 Bacteria 1921
166 Ga0496114_0180276 3300048917 Bacteria 1844
167 Ga0496114_1022054 3300048917 Bacteria 710
168 Ga0496115_1019053 3300048918 Bacteria 632
169 Ga0496122_0000971 3300048925 Bacteria 51480
170 Ga0496123_0000786 3300048926 Bacteria 51250
171 Ga0496125_0000676 3300048928 Bacteria 56883
172 Ga0496125_0007001 3300048928 Bacteria 12068
173 Ga0496126_0351793 3300048929 Bacteria 1205
174 Ga0496126_0570816 3300048929 Bacteria 895
175 Ga0495682_0235979 3300049460 Bacteria 647
176 nmdc:mga0qj67_43291_c1 3300050509 Bacteria 3545
177 Ga0500610_0000111 3300053079 Bacteria 24806
178 Ga0500651_0127353 3300053093 Bacteria 1542
179 Ga0500592_025255 3300053116 Bacteria 958
180 Ga0500594_0001188 3300053118 Bacteria 5616
181 Ga0500568_0000921 3300053139 Bacteria 20296
182 Ga0500568_0018860 3300053139 Bacteria 3009
183 Ga0500586_000382 3300053145 Bacteria 8852
184 Ga0500634_0006588 3300053161 Bacteria 5634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0396393 Ga0495621_0396393_208_567 110
2 3300050509 nmdc:mga0qj67_43291_c1 nmdc:mga0qj67_43291_c1_1000_1428 112
3 3300046499 Ga0495594_0007381 Ga0495594_0007381_3550_3981 121
4 3300046526 Ga0495666_0015827 Ga0495666_0015827_2617_3048 121
5 3300046691 Ga0495670_0028818 Ga0495670_0028818_106_537 121
6 3300048089 Ga0495614_0508964 Ga0495614_0508964_107_538 121
7 3300031548 Ga0307408_100300136 Ga0307408_1003001363 125
8 3300046528 Ga0495642_0020542 Ga0495642_0020542_132_563 125
9 3300046536 Ga0495587_0023801 Ga0495587_0023801_2560_2991 125
10 3300046660 Ga0495625_0154195 Ga0495625_0154195_288_719 125
11 3300046475 Ga0495639_0542092 Ga0495639_0542092_94_525 126
12 3300046522 Ga0495643_0052085 Ga0495643_0052085_138_569 126
13 3300046674 Ga0495588_0003214 Ga0495588_0003214_3169_3600 126
14 3300046694 Ga0495649_0000750 Ga0495649_0000750_10510_10941 126
15 3300047323 Ga0495683_0386658 Ga0495683_0386658_77_508 126
16 3300048904 Ga0496101_0243260 Ga0496101_0243260_350_781 126
17 3300048912 Ga0496109_0089219 Ga0496109_0089219_888_1319 126
18 3300048915 Ga0496112_0498456 Ga0496112_0498456_448_879 126
19 3300048916 Ga0496113_0001305 Ga0496113_0001305_1202_1633 126
20 3300048925 Ga0496122_0000971 Ga0496122_0000971_49836_50267 126
21 3300048926 Ga0496123_0000786 Ga0496123_0000786_1112_1543 126
22 3300048928 Ga0496125_0007001 Ga0496125_0007001_1234_1665 126
23 3300031852 Ga0307410_10567473 Ga0307410_105674732 127
24 3300046665 Ga0495661_0059702 Ga0495661_0059702_487_915 127
25 3300046691 Ga0495670_0534282 Ga0495670_0534282_155_589 127
26 3300046810 Ga0495660_0242633 Ga0495660_0242633_190_621 127
27 3300047320 Ga0495672_0000019 Ga0495672_0000019_87437_87868 127
28 3300053139 Ga0500568_0018860 Ga0500568_0018860_1598_2044 127
29 3300046455 Ga0495603_0010544 Ga0495603_0010544_1330_1761 128
30 3300046459 Ga0495629_0003128 Ga0495629_0003128_8166_8597 128
31 3300046473 Ga0495582_0147035 Ga0495582_0147035_532_963 128
32 3300046474 Ga0495605_0001791 Ga0495605_0001791_3838_4269 128
33 3300046492 Ga0495585_0046178 Ga0495585_0046178_1738_2169 128
34 3300046499 Ga0495594_0005718 Ga0495594_0005718_2782_3213 128
35 3300046513 Ga0495616_0007970 Ga0495616_0007970_1844_2275 128
36 3300046518 Ga0495631_0011390 Ga0495631_0011390_2648_3079 128
37 3300046523 Ga0495644_0001445 Ga0495644_0001445_5425_5856 128
38 3300046524 Ga0495648_0030704 Ga0495648_0030704_1654_2082 128
39 3300046538 Ga0495609_0001969 Ga0495609_0001969_9128_9556 128
40 3300046557 Ga0495622_0006192 Ga0495622_0006192_1634_2065 128
41 3300046558 Ga0495633_0042913 Ga0495633_0042913_330_761 128
42 3300046616 Ga0495668_0013835 Ga0495668_0013835_3894_4325 128
43 3300046648 Ga0495611_0008349 Ga0495611_0008349_2187_2618 128
44 3300046665 Ga0495661_0017732 Ga0495661_0017732_2126_2557 128
45 3300046674 Ga0495588_0004087 Ga0495588_0004087_5572_6003 128
46 3300046691 Ga0495670_0006621 Ga0495670_0006621_2734_3165 128
47 3300047323 Ga0495683_0050437 Ga0495683_0050437_398_829 128
48 3300047445 Ga0495677_0001319 Ga0495677_0001319_696_1127 128
49 3300048089 Ga0495614_0003746 Ga0495614_0003746_3177_3608 128
50 3300037471 Ga0395905_0006945 Ga0395905_0006945_2320_2751 129
51 3300044669 Ga0466981_0426863 Ga0466981_0426863_15_431 129
52 3300046506 Ga0495583_0070601 Ga0495583_0070601_249_692 129
53 3300046519 Ga0495632_0021184 Ga0495632_0021184_2220_2663 129
54 3300053093 Ga0500651_0127353 Ga0500651_0127353_117_560 129
55 3300006038 Ga0075365_10634509 Ga0075365_106345092 130
56 3300046810 Ga0495660_0021858 Ga0495660_0021858_2079_2525 130
57 3300047443 Ga0495687_010372 Ga0495687_010372_418_864 130
58 iso_pu_bacteria 2511231012 2511300009 130
59 iso_pu_bacteria 2643221556 2643796641 130
60 iso_pu_bacteria 2643221684 2644470254 130
61 3300005327 Ga0070658_10305855 Ga0070658_103058553 131
62 3300005337 Ga0070682_100342400 Ga0070682_1003424002 131
63 iso_pu_bacteria 2765235838 2765568040 131
64 iso_pu_bacteria 2928084124 2928084625 131
65 3300005471 Ga0070698_100603474 Ga0070698_1006034742 132
66 3300031901 Ga0307406_10479788 Ga0307406_104797882 132
67 3300046512 Ga0495610_0011992 Ga0495610_0011992_3398_3823 132
68 3300053118 Ga0500594_0001188 Ga0500594_0001188_3295_3720 132
69 3300053145 Ga0500586_000382 Ga0500586_000382_5223_5648 132
70 3300027614 Ga0209970_1002335 Ga0209970_10023354 133
71 3300027876 Ga0209974_10051699 Ga0209974_100516992 133
72 3300046501 Ga0495607_0316705 Ga0495607_0316705_166_594 133
73 3300046524 Ga0495648_0043116 Ga0495648_0043116_362_790 133
74 3300046530 Ga0495654_0119830 Ga0495654_0119830_212_640 133
75 3300046648 Ga0495611_0279862 Ga0495611_0279862_216_662 133
76 3300046660 Ga0495625_0034995 Ga0495625_0034995_909_1355 133
77 3300047472 Ga0495686_0609983 Ga0495686_0609983_31_459 133
78 3300048929 Ga0496126_0570816 Ga0496126_0570816_146_574 133
79 3300003775 Ga0055524_1000010 Ga0055524_100001070 134
80 3300005262 Ga0065165_1020123 Ga0065165_10201232 134
81 3300005288 Ga0065714_10095469 Ga0065714_100954692 134
82 3300005336 Ga0070680_100472704 Ga0070680_1004727042 134
83 3300005440 Ga0070705_100453969 Ga0070705_1004539692 134
84 3300005549 Ga0070704_100030197 Ga0070704_1000301973 134
85 3300009036 Ga0105244_10009915 Ga0105244_100099156 134
86 3300009092 Ga0105250_10041003 Ga0105250_100410033 134
87 3300009148 Ga0105243_10012104 Ga0105243_100121043 134
88 3300013102 Ga0157371_10252927 Ga0157371_102529272 134
89 3300013104 Ga0157370_10079454 Ga0157370_100794543 134
90 3300014497 Ga0182008_10002082 Ga0182008_1000208211 134
91 3300017792 Ga0163161_10178192 Ga0163161_101781921 134
92 3300025263 Ga0209565_1010299 Ga0209565_10102994 134
93 3300025292 Ga0209676_1004442 Ga0209676_10044426 134
94 3300025295 Ga0209564_1024910 Ga0209564_10249102 134
95 3300025298 Ga0209050_1000536 Ga0209050_100053645 134
96 3300025299 Ga0209256_1000007 Ga0209256_1000007448 134
97 3300025303 Ga0209051_1001536 Ga0209051_100153618 134
98 3300025728 Ga0207655_1055879 Ga0207655_10558793 134
99 3300025735 Ga0207713_1024065 Ga0207713_10240653 134
100 3300025917 Ga0207660_10199335 Ga0207660_101993353 134
101 3300025935 Ga0207709_10254621 Ga0207709_102546212 134
102 3300037418 Ga0395900_0080968 Ga0395900_0080968_783_1214 134
103 3300037418 Ga0395900_0781549 Ga0395900_0781549_120_551 134
104 3300041411 Ga0439466_0030801 Ga0439466_0030801_1144_1578 134
105 3300042013 Ga0439456_005644 Ga0439456_005644_935_1369 134
106 3300042138 Ga0450903_002850 Ga0450903_002850_1218_1652 134
107 3300042461 Ga0439460_0039584 Ga0439460_0039584_342_776 134
108 3300042876 Ga0451577_1633928 Ga0451577_1633928_31_462 134
109 3300046458 Ga0495591_030992 Ga0495591_030992_301_735 134
110 3300046474 Ga0495605_0340278 Ga0495605_0340278_32_469 134
111 3300046491 Ga0495584_0011487 Ga0495584_0011487_1505_1942 134
112 3300046492 Ga0495585_0016240 Ga0495585_0016240_947_1384 134
113 3300046499 Ga0495594_0433345 Ga0495594_0433345_228_659 134
114 3300046506 Ga0495583_0000134 Ga0495583_0000134_103105_103536 134
115 3300046507 Ga0495606_0001496 Ga0495606_0001496_13591_14022 134
116 3300046507 Ga0495606_0052343 Ga0495606_0052343_1132_1563 134
117 3300046507 Ga0495606_0413906 Ga0495606_0413906_248_685 134
118 3300046518 Ga0495631_0006515 Ga0495631_0006515_2456_2893 134
119 3300046523 Ga0495644_0008480 Ga0495644_0008480_1254_1691 134
120 3300046524 Ga0495648_0020199 Ga0495648_0020199_3061_3492 134
121 3300046528 Ga0495642_0003805 Ga0495642_0003805_46_483 134
122 3300046538 Ga0495609_0320505 Ga0495609_0320505_52_501 134
123 3300046539 Ga0495621_0395226 Ga0495621_0395226_112_543 134
124 3300046542 Ga0495597_0008101 Ga0495597_0008101_1049_1486 134
125 3300046542 Ga0495597_0012618 Ga0495597_0012618_1357_1806 134
126 3300046558 Ga0495633_0036685 Ga0495633_0036685_657_1094 134
127 3300046616 Ga0495668_0003980 Ga0495668_0003980_3710_4147 134
128 3300046648 Ga0495611_0019311 Ga0495611_0019311_2118_2555 134
129 3300046665 Ga0495661_0112330 Ga0495661_0112330_890_1327 134
130 3300046679 Ga0495623_0020293 Ga0495623_0020293_2757_3191 134
131 3300046691 Ga0495670_0025045 Ga0495670_0025045_344_775 134
132 3300046692 Ga0495671_0148494 Ga0495671_0148494_180_617 134
133 3300046794 Ga0495589_0110688 Ga0495589_0110688_696_1133 134
134 3300046810 Ga0495660_0000799 Ga0495660_0000799_19718_20149 134
135 3300047317 Ga0495604_0026000 Ga0495604_0026000_1858_2289 134
136 3300047444 Ga0495675_0000551 Ga0495675_0000551_2009_2443 134
137 3300047444 Ga0495675_0246121 Ga0495675_0246121_199_630 134
138 3300047445 Ga0495677_0009606 Ga0495677_0009606_2332_2769 134
139 3300048091 Ga0495626_0082067 Ga0495626_0082067_896_1345 134
140 3300048917 Ga0496114_0166130 Ga0496114_0166130_13_444 134
141 3300048917 Ga0496114_0180276 Ga0496114_0180276_663_1094 134
142 3300048918 Ga0496115_1019053 Ga0496115_1019053_50_481 134
143 3300048928 Ga0496125_0000676 Ga0496125_0000676_24262_24693 134
144 3300048929 Ga0496126_0351793 Ga0496126_0351793_498_929 134
145 3300049460 Ga0495682_0235979 Ga0495682_0235979_129_560 134
146 3300003316 rootH1_10033285 rootH1_100332852 135
147 3300005441 Ga0070700_100519627 Ga0070700_1005196271 135
148 3300005719 Ga0068861_100270752 Ga0068861_1002707523 135
149 3300005842 Ga0068858_101887049 Ga0068858_1018870492 135
150 3300009176 Ga0105242_10092756 Ga0105242_100927563 135
151 3300013297 Ga0157378_10110856 Ga0157378_101108564 135
152 3300014969 Ga0157376_11791417 Ga0157376_117914172 135
153 3300025909 Ga0207705_10564807 Ga0207705_105648072 135
154 3300025919 Ga0207657_10523041 Ga0207657_105230412 135
155 3300025933 Ga0207706_10096987 Ga0207706_100969874 135
156 3300025934 Ga0207686_10162392 Ga0207686_101623922 135
157 3300025942 Ga0207689_10132686 Ga0207689_101326863 135
158 3300026035 Ga0207703_11138772 Ga0207703_111387722 135
159 3300026118 Ga0207675_100326386 Ga0207675_1003263863 135
160 3300031824 Ga0307413_10335080 Ga0307413_103350802 135
161 3300031911 Ga0307412_10269065 Ga0307412_102690652 135
162 3300032002 Ga0307416_100356826 Ga0307416_1003568262 135
163 3300032005 Ga0307411_10128800 Ga0307411_101288003 135
164 3300037312 Ga0395899_0324578 Ga0395899_0324578_442_876 135
165 3300037418 Ga0395900_0163872 Ga0395900_0163872_214_648 135
166 3300041407 Ga0439447_018845 Ga0439447_018845_1132_1566 135
167 3300041997 Ga0439431_0000349 Ga0439431_0000349_2185_2619 135
168 3300041997 Ga0439431_0245333 Ga0439431_0245333_20_454 135
169 3300042000 Ga0439437_038404 Ga0439437_038404_71_505 135
170 3300042010 Ga0439452_020521 Ga0439452_020521_703_1137 135
171 3300042015 Ga0439462_0000841 Ga0439462_0000841_313_747 135
172 3300042128 Ga0450897_002072 Ga0450897_002072_821_1255 135
173 3300042131 Ga0450894_013809 Ga0450894_013809_414_848 135
174 3300042134 Ga0450898_022228 Ga0450898_022228_544_978 135
175 3300042145 Ga0450906_013141 Ga0450906_013141_372_806 135
176 3300042156 Ga0439446_0010675 Ga0439446_0010675_258_692 135
177 3300042156 Ga0439446_0148056 Ga0439446_0148056_123_557 135
178 3300042185 Ga0450909_002632 Ga0450909_002632_2006_2440 135
179 3300046530 Ga0495654_0022392 Ga0495654_0022392_979_1416 135
180 3300046539 Ga0495621_0017267 Ga0495621_0017267_1510_1947 135
181 3300046660 Ga0495625_0407344 Ga0495625_0407344_67_504 135
182 3300046674 Ga0495588_0028686 Ga0495588_0028686_1274_1711 135
183 3300046691 Ga0495670_0248702 Ga0495670_0248702_25_495 135
184 3300048903 Ga0496100_0286725 Ga0496100_0286725_202_636 135
185 3300048917 Ga0496114_1022054 Ga0496114_1022054_192_626 135
186 3300053079 Ga0500610_0000111 Ga0500610_0000111_20838_21275 135
187 3300053116 Ga0500592_025255 Ga0500592_025255_267_704 135
188 3300053139 Ga0500568_0000921 Ga0500568_0000921_5120_5557 135
189 3300053161 Ga0500634_0006588 Ga0500634_0006588_3209_3646 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04143

Sulf_transp

Sulphur transport

3

144

0.78

Feature Viewer

pLDDT pTM Quality
63.64 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map