F291308

General Info

Members Datasets Scaffolds Average Seq Length
189 141 138 198

Family's Representative Sequence

Representative Sequence 3300041505|Ga0451849_0607786|Ga0451849_0607786_1578_2240
Length 220
Sequence MINARGAAKSKPVMTDLQTRPMPPENMIEDTSIRFEPAPDLLEWARSSFIDETADLINEDHAHLRFASIGALWTNVPNGRAGRRIIGQCEMGLPPAGKWSRARIELQLQQWFGGLPDFLLTFDAHYASVCSDAEFCALVEHELYHAGQERDLFGAPKFRRDGSPAFGMRGHDVEEFVGVVRRYGADAAGVRALVDAANKPPEISRASIGHMCGTCQLRVA

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
6 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
7 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
8 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
9 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
10 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
11 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
12 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
13 2643221557 Ensifer sp. Root558 Isolate Unclassified
14 2643221607 Rhizobium sp. Root73 Isolate Unclassified
15 2643221698 Ensifer sp. Root142 Isolate Unclassified
16 2643221723 Ensifer sp. Root278 Isolate Unclassified
17 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
18 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
19 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
20 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
21 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
22 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
23 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
24 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
25 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
26 2844163670 Ensifer sp. 1H6 Isolate Unclassified
27 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
28 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
29 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
30 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
31 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
32 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
33 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
34 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
35 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
36 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
37 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
38 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
39 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
40 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
41 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
42 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
43 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
44 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
45 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
68 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
138 8004592986 Serratia sp. S119 Isolate Unclassified
139 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
140 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
141 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.02
Metatranscriptomes 0
Isolates 26.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 25.93
Rhizoplane 3.17
Rhizosphere 49.74
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000039 3300001979 Bacteria 44135
2 JGI25153J46596_10033050 3300003215 Bacteria 1714
3 Ga0055542_1026398 3300003762 Bacteria 782
4 Ga0055528_1030629 3300003790 Bacteria 1421
5 Ga0065704_10077324 3300005289 Bacteria 4777
6 Ga0070659_100162950 3300005366 Unclassified 1824
7 Ga0070714_100171371 3300005435 Bacteria 1969
8 Ga0070713_100300828 3300005436 Unclassified 1477
9 Ga0070710_10002906 3300005437 Bacteria 8155
10 Ga0070710_10004734 3300005437 Bacteria 6433
11 Ga0070711_100005665 3300005439 Bacteria 7483
12 Ga0081540_1081062 3300005983 Unclassified 1460
13 Ga0070716_100003161 3300006173 Bacteria 7711
14 Ga0070712_100055638 3300006175 Unclassified 2772
15 Ga0079104_1000553 3300006946 Bacteria 38820
16 Ga0079104_1001080 3300006946 Bacteria 20430
17 Ga0079104_1001548 3300006946 Bacteria 15115
18 Ga0079104_1009971 3300006946 Bacteria 3169
19 Ga0105251_10000228 3300009011 Bacteria 56620
20 Ga0105244_10000210 3300009036 Bacteria 60031
21 Ga0105244_10000627 3300009036 Bacteria 31284
22 Ga0105250_10000177 3300009092 Bacteria 55597
23 Ga0157373_10003856 3300013100 Bacteria 11334
24 Ga0157370_10000566 3300013104 Bacteria 46142
25 Ga0182007_10000020 3300015262 Bacteria 194053
26 Ga0182005_1055848 3300015265 Bacteria 1076
27 Ga0214542_1000015 3300021321 Bacteria 227912
28 Ga0228710_1033980 3300022740 Bacteria 2119
29 Ga0209673_1005999 3300025273 Bacteria 5977
30 Ga0209025_1001254 3300025294 Bacteria 35128
31 Ga0209758_1001812 3300025297 Bacteria 23607
32 Ga0209257_1000932 3300025304 Bacteria 40483
33 Ga0209257_1010062 3300025304 Bacteria 4892
34 Ga0207696_1000930 3300025711 Bacteria 18083
35 Ga0207655_1000572 3300025728 Bacteria 45734
36 Ga0207655_1001918 3300025728 Bacteria 17823
37 Ga0207713_1000101 3300025735 Bacteria 140693
38 Ga0207692_10000074 3300025898 Bacteria 28818
39 Ga0207699_10364076 3300025906 Bacteria 1023
40 Ga0207693_10017795 3300025915 Bacteria 5666
41 Ga0207664_10077466 3300025929 Bacteria 2694
42 Ga0207665_10003950 3300025939 Bacteria 9926
43 Ga0209281_1000036 3300027111 Bacteria 369415
44 Ga0209281_1000047 3300027111 Bacteria 326514
45 Ga0209281_1000465 3300027111 Bacteria 57106
46 Ga0209281_1000978 3300027111 Bacteria 22852
47 Ga0265327_10016040 3300031251 Bacteria 4790
48 Ga0307405_10000075 3300031731 Bacteria 43232
49 Ga0307412_10001634 3300031911 Bacteria 12358
50 Ga0307414_10000292 3300032004 Bacteria 29264
51 Ga0307414_10000342 3300032004 Bacteria 26394
52 Ga0395900_0000588 3300037418 Bacteria 49918
53 Ga0439466_0000233 3300041411 Bacteria 21720
54 Ga0451849_0607786 3300041505 Bacteria 5129
55 Ga0451843_0202260 3300041509 Bacteria 2073
56 Ga0466986_0074830 3300044650 Bacteria 2346
57 Ga0453683_0009466 3300044673 Bacteria 6501
58 Ga0466967_0594074 3300045976 Bacteria 1092
59 Ga0495617_056039 3300046452 Bacteria 1307
60 Ga0495591_000241 3300046458 Bacteria 52565
61 Ga0495653_0000213 3300046463 Bacteria 47076
62 Ga0495650_0001341 3300046471 Bacteria 24518
63 Ga0495650_0002669 3300046471 Bacteria 13892
64 Ga0495605_0015333 3300046474 Bacteria 4171
65 Ga0495584_0000099 3300046491 Bacteria 57784
66 Ga0495596_0000122 3300046500 Bacteria 53601
67 Ga0495607_0000189 3300046501 Bacteria 65909
68 Ga0495607_0001348 3300046501 Bacteria 21884
69 Ga0495607_0001894 3300046501 Bacteria 17751
70 Ga0495606_0000616 3300046507 Bacteria 56019
71 Ga0495606_0001345 3300046507 Bacteria 33456
72 Ga0495606_0224635 3300046507 Bacteria 1056
73 Ga0495616_0008590 3300046513 Bacteria 6032
74 Ga0495616_0030614 3300046513 Bacteria 2826
75 Ga0495620_0000118 3300046515 Bacteria 63497
76 Ga0495620_0000176 3300046515 Bacteria 50146
77 Ga0495620_0001103 3300046515 Bacteria 16493
78 Ga0495632_0001166 3300046519 Bacteria 22360
79 Ga0495632_0001791 3300046519 Bacteria 17331
80 Ga0495632_0011845 3300046519 Bacteria 5070
81 Ga0495632_0044497 3300046519 Bacteria 2215
82 Ga0495632_0080614 3300046519 Bacteria 1552
83 Ga0495637_0000030 3300046520 Bacteria 138704
84 Ga0495637_0017489 3300046520 Bacteria 3339
85 Ga0495637_0160631 3300046520 Bacteria 843
86 Ga0495643_0012680 3300046522 Bacteria 5076
87 Ga0495654_0000177 3300046530 Bacteria 62703
88 Ga0495654_0000489 3300046530 Bacteria 32670
89 Ga0495609_0110993 3300046538 Bacteria 1183
90 Ga0495668_0000886 3300046616 Bacteria 33702
91 Ga0495668_0003269 3300046616 Bacteria 12322
92 Ga0495668_0036509 3300046616 Bacteria 2753
93 Ga0495625_0000280 3300046660 Bacteria 79446
94 Ga0495625_0059418 3300046660 Bacteria 2713
95 Ga0495661_0000024 3300046665 Bacteria 188844
96 Ga0495671_0000254 3300046692 Bacteria 45834
97 Ga0495671_0000517 3300046692 Bacteria 29556
98 Ga0495649_0004791 3300046694 Bacteria 8764
99 Ga0495649_0015993 3300046694 Bacteria 4259
100 Ga0495660_0000011 3300046810 Bacteria 361397
101 Ga0495660_0000161 3300046810 Bacteria 72505
102 Ga0495660_0000778 3300046810 Bacteria 23878
103 Ga0495660_0019907 3300046810 Bacteria 3849
104 Ga0495676_0000141 3300047321 Bacteria 55004
105 Ga0495679_000249 3300047446 Bacteria 44622
106 Ga0495679_006782 3300047446 Bacteria 4874
107 Ga0495673_0000912 3300047469 Bacteria 26978
108 Ga0495673_0001068 3300047469 Bacteria 24078
109 Ga0495673_0001134 3300047469 Bacteria 22855
110 Ga0495673_0028130 3300047469 Bacteria 2666
111 Ga0495686_0000451 3300047472 Bacteria 62066
112 Ga0495686_0133639 3300047472 Bacteria 1469
113 Ga0496102_0004719 3300048905 Bacteria 11538
114 Ga0496103_0012694 3300048906 Bacteria 4997
115 Ga0496106_0000724 3300048909 Bacteria 23777
116 Ga0496107_0297443 3300048910 Bacteria 1201
117 Ga0496116_0006623 3300048919 Bacteria 10468
118 Ga0496117_0000520 3300048920 Bacteria 63488
119 Ga0496118_0000515 3300048921 Bacteria 63488
120 Ga0496121_0002736 3300048924 Bacteria 26258
121 Ga0496121_0007975 3300048924 Bacteria 12644
122 Ga0496121_0064202 3300048924 Bacteria 2995
123 Ga0496121_0284491 3300048924 Unclassified 1129
124 Ga0496122_0009746 3300048925 Bacteria 10036
125 Ga0496122_0058620 3300048925 Bacteria 2848
126 Ga0496123_0002657 3300048926 Bacteria 21611
127 Ga0496124_0000421 3300048927 Bacteria 75739
128 Ga0496124_0187518 3300048927 Bacteria 1586
129 Ga0496125_0179398 3300048928 Bacteria 1413
130 Ga0496126_0003825 3300048929 Bacteria 18648
131 Ga0496126_0155139 3300048929 Unclassified 1960
132 Ga0495678_000407 3300049459 Bacteria 43484
133 Ga0495678_000752 3300049459 Bacteria 29419
134 Ga0495682_0000123 3300049460 Bacteria 67837
135 Ga0500618_000313 3300053125 Bacteria 35843
136 Ga0500618_001988 3300053125 Bacteria 8353
137 Ga0500658_0001769 3300053134 Bacteria 8521
138 Ga0500645_000584 3300053730 Bacteria 23561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005437 Ga0070710_10004734 Ga0070710_100047341 140
2 iso_pu_bacteria 2915980308 2915986912 140
3 iso_pu_bacteria 2916061851 2916062763 140
4 3300006175 Ga0070712_100055638 Ga0070712_1000556385 145
5 3300005289 Ga0065704_10077324 Ga0065704_1007732410 149
6 3300005435 Ga0070714_100171371 Ga0070714_1001713714 156
7 3300025906 Ga0207699_10364076 Ga0207699_103640761 156
8 3300025929 Ga0207664_10077466 Ga0207664_100774661 156
9 iso_pu_bacteria 2513237156 2513989695 156
10 3300005983 Ga0081540_1081062 Ga0081540_10810622 159
11 3300048924 Ga0496121_0002736 Ga0496121_0002736_20610_21137 159
12 3300049459 Ga0495678_000752 Ga0495678_000752_244_777 161
13 3300009036 Ga0105244_10000210 Ga0105244_1000021062 163
14 3300041411 Ga0439466_0000233 Ga0439466_0000233_10545_11084 163
15 3300046452 Ga0495617_056039 Ga0495617_056039_713_1252 163
16 3300046471 Ga0495650_0002669 Ga0495650_0002669_5750_6289 163
17 3300046491 Ga0495584_0000099 Ga0495584_0000099_31221_31760 163
18 3300046616 Ga0495668_0003269 Ga0495668_0003269_11641_12180 163
19 3300046810 Ga0495660_0019907 Ga0495660_0019907_3285_3824 163
20 3300021321 Ga0214542_1000015 Ga0214542_100001515 164
21 3300005439 Ga0070711_100005665 Ga0070711_1000056658 165
22 iso_pu_bacteria 2517487022 2517565054 166
23 iso_pu_bacteria 2512875026 2512974532 167
24 iso_pu_bacteria 2513237089 2513607579 167
25 iso_pu_bacteria 2513237160 2514009194 167
26 iso_pu_bacteria 2802428858 2802722278 167
27 iso_pu_bacteria 2802428859 2802728728 167
28 iso_pu_bacteria 2802428860 2802735039 167
29 iso_pu_bacteria 2802428861 2802741354 167
30 iso_pu_bacteria 2802428862 2802747875 167
31 iso_pu_bacteria 2937029754 2937035526 167
32 iso_pu_bacteria 2937036028 2937042077 167
33 iso_pu_bacteria 2937078374 2937084096 167
34 iso_pu_bacteria 2937084907 2937087411 167
35 iso_pu_bacteria 2960660292 2960662002 167
36 iso_pu_bacteria 2960680706 2960687305 167
37 iso_pu_bacteria 2960693952 2960695981 167
38 iso_pu_bacteria 2967728569 2967734889 167
39 iso_pu_bacteria 2970122695 2970123144 167
40 iso_pu_bacteria 2970143518 2970144179 167
41 iso_pu_bacteria 2977530762 2977531568 167
42 iso_pu_bacteria 2977544691 2977545913 167
43 iso_pu_bacteria 8003999396 8004005885 167
44 3300048919 Ga0496116_0006623 Ga0496116_0006623_9153_9707 168
45 3300048928 Ga0496125_0179398 Ga0496125_0179398_400_954 168
46 3300053125 Ga0500618_001988 Ga0500618_001988_6155_6712 169
47 3300025915 Ga0207693_10017795 Ga0207693_100177957 171
48 3300048929 Ga0496126_0155139 Ga0496126_0155139_423_1004 171
49 3300009036 Ga0105244_10000627 Ga0105244_1000062730 173
50 3300046501 Ga0495607_0000189 Ga0495607_0000189_40644_41231 173
51 3300046501 Ga0495607_0001894 Ga0495607_0001894_17141_17713 173
52 3300046507 Ga0495606_0224635 Ga0495606_0224635_18_587 173
53 3300046515 Ga0495620_0000176 Ga0495620_0000176_25356_25928 173
54 3300046519 Ga0495632_0011845 Ga0495632_0011845_4422_4994 173
55 3300049459 Ga0495678_000407 Ga0495678_000407_13091_13663 173
56 3300005436 Ga0070713_100300828 Ga0070713_1003008282 174
57 3300046500 Ga0495596_0000122 Ga0495596_0000122_17177_17764 174
58 3300046530 Ga0495654_0000177 Ga0495654_0000177_25929_26516 174
59 3300046616 Ga0495668_0000886 Ga0495668_0000886_17002_17589 174
60 iso_pu_bacteria 2513237140 2513886942 174
61 iso_pu_bacteria 2643221557 2643808607 174
62 3300015265 Ga0182005_1055848 Ga0182005_10558482 176
63 3300013100 Ga0157373_10003856 Ga0157373_1000385618 177
64 3300046474 Ga0495605_0015333 Ga0495605_0015333_631_1227 177
65 3300046513 Ga0495616_0008590 Ga0495616_0008590_4716_5312 177
66 3300046513 Ga0495616_0030614 Ga0495616_0030614_626_1222 177
67 3300046515 Ga0495620_0000118 Ga0495620_0000118_7261_7857 177
68 3300046519 Ga0495632_0001166 Ga0495632_0001166_19817_20413 177
69 3300046694 Ga0495649_0015993 Ga0495649_0015993_3193_3789 177
70 3300047446 Ga0495679_000249 Ga0495679_000249_26294_26890 177
71 3300048925 Ga0496122_0009746 Ga0496122_0009746_6707_7303 177
72 3300048926 Ga0496123_0002657 Ga0496123_0002657_14757_15353 177
73 3300053125 Ga0500618_000313 Ga0500618_000313_31959_32558 177
74 3300025294 Ga0209025_1001254 Ga0209025_100125439 178
75 3300025304 Ga0209257_1010062 Ga0209257_10100625 178
76 3300037418 Ga0395900_0000588 Ga0395900_0000588_43796_44398 178
77 3300041509 Ga0451843_0202260 Ga0451843_0202260_335_919 178
78 3300048910 Ga0496107_0297443 Ga0496107_0297443_10_603 178
79 3300048924 Ga0496121_0007975 Ga0496121_0007975_3678_4262 178
80 3300046463 Ga0495653_0000213 Ga0495653_0000213_22613_23215 180
81 3300048925 Ga0496122_0058620 Ga0496122_0058620_1248_1838 180
82 3300025728 Ga0207655_1001918 Ga0207655_100191811 182
83 3300046458 Ga0495591_000241 Ga0495591_000241_24438_25049 182
84 3300046694 Ga0495649_0004791 Ga0495649_0004791_7136_7747 182
85 3300047469 Ga0495673_0001134 Ga0495673_0001134_8832_9443 182
86 3300047472 Ga0495686_0133639 Ga0495686_0133639_579_1190 182
87 iso_pu_bacteria 2599185307 2599971410 182
88 iso_pu_bacteria 2599185352 2600192065 182
89 iso_pu_bacteria 2643221698 2644540184 182
90 iso_pu_bacteria 2643221723 2644675508 182
91 iso_pu_bacteria 2844163670 2844166856 182
92 iso_pu_bacteria 8005563573 8005569577 182
93 iso_pu_bacteria 8049293176 8049294057 182
94 iso_pu_bacteria 8055431914 8055435247 182
95 3300046522 Ga0495643_0012680 Ga0495643_0012680_1793_2404 183
96 3300047472 Ga0495686_0000451 Ga0495686_0000451_49712_50311 183
97 3300048924 Ga0496121_0064202 Ga0496121_0064202_505_1113 183
98 3300046538 Ga0495609_0110993 Ga0495609_0110993_67_672 184
99 3300005437 Ga0070710_10002906 Ga0070710_100029069 185
100 3300006173 Ga0070716_100003161 Ga0070716_1000031617 185
101 3300025898 Ga0207692_10000074 Ga0207692_1000007430 185
102 3300025939 Ga0207665_10003950 Ga0207665_100039509 185
103 3300031251 Ga0265327_10016040 Ga0265327_100160406 185
104 3300046810 Ga0495660_0000161 Ga0495660_0000161_33870_34490 185
105 3300048929 Ga0496126_0003825 Ga0496126_0003825_12843_13463 185
106 iso_pu_bacteria 2643221607 2644049325 185
107 iso_pu_bacteria 2775506902 2776271117 185
108 iso_pu_bacteria 2775506904 2776283012 185
109 iso_pu_bacteria 2791355092 2792626732 185
110 3300006946 Ga0079104_1001548 Ga0079104_100154810 186
111 3300009092 Ga0105250_10000177 Ga0105250_1000017735 186
112 3300022740 Ga0228710_1033980 Ga0228710_10339802 186
113 3300025728 Ga0207655_1000572 Ga0207655_100057236 186
114 3300031731 Ga0307405_10000075 Ga0307405_1000007551 186
115 3300031911 Ga0307412_10001634 Ga0307412_1000163414 186
116 3300032004 Ga0307414_10000292 Ga0307414_1000029236 186
117 3300046501 Ga0495607_0001348 Ga0495607_0001348_16253_16876 186
118 3300046507 Ga0495606_0001345 Ga0495606_0001345_27038_27661 186
119 3300046515 Ga0495620_0001103 Ga0495620_0001103_10077_10700 186
120 3300046519 Ga0495632_0001791 Ga0495632_0001791_8101_8724 186
121 3300046519 Ga0495632_0044497 Ga0495632_0044497_1516_2139 186
122 3300046519 Ga0495632_0080614 Ga0495632_0080614_842_1465 186
123 3300046520 Ga0495637_0000030 Ga0495637_0000030_91013_91636 186
124 3300046520 Ga0495637_0017489 Ga0495637_0017489_1253_1876 186
125 3300046530 Ga0495654_0000489 Ga0495654_0000489_6825_7448 186
126 3300046616 Ga0495668_0036509 Ga0495668_0036509_1101_1724 186
127 3300046665 Ga0495661_0000024 Ga0495661_0000024_30327_30950 186
128 3300046692 Ga0495671_0000254 Ga0495671_0000254_41668_42291 186
129 3300046692 Ga0495671_0000517 Ga0495671_0000517_4428_5051 186
130 3300046810 Ga0495660_0000778 Ga0495660_0000778_10558_11181 186
131 3300047321 Ga0495676_0000141 Ga0495676_0000141_32438_33061 186
132 3300047469 Ga0495673_0000912 Ga0495673_0000912_2125_2748 186
133 3300047469 Ga0495673_0001068 Ga0495673_0001068_20780_21403 186
134 3300048905 Ga0496102_0004719 Ga0496102_0004719_9876_10484 186
135 3300048906 Ga0496103_0012694 Ga0496103_0012694_4153_4761 186
136 3300048909 Ga0496106_0000724 Ga0496106_0000724_16037_16645 186
137 3300048920 Ga0496117_0000520 Ga0496117_0000520_34245_34853 186
138 3300048921 Ga0496118_0000515 Ga0496118_0000515_34245_34853 186
139 3300048924 Ga0496121_0284491 Ga0496121_0284491_59_667 186
140 3300048927 Ga0496124_0000421 Ga0496124_0000421_27268_27891 186
141 3300049460 Ga0495682_0000123 Ga0495682_0000123_32061_32684 186
142 iso_pu_bacteria 2510461076 2510894171 186
143 iso_pu_bacteria 2510461076 2510899196 186
144 3300005366 Ga0070659_100162950 Ga0070659_1001629503 187
145 3300006946 Ga0079104_1000553 Ga0079104_100055344 187
146 3300006946 Ga0079104_1009971 Ga0079104_10099715 187
147 3300027111 Ga0209281_1000036 Ga0209281_100003698 187
148 3300027111 Ga0209281_1000047 Ga0209281_100004740 187
149 3300027111 Ga0209281_1000978 Ga0209281_10009785 187
150 3300032004 Ga0307414_10000342 Ga0307414_1000034224 187
151 3300053134 Ga0500658_0001769 Ga0500658_0001769_4685_5305 187
152 3300053730 Ga0500645_000584 Ga0500645_000584_17002_17622 187
153 iso_pu_bacteria 2511231052 2511503351 187
154 iso_pu_bacteria 2844454524 2844459651 187
155 iso_pu_bacteria 2512875016 2512929928 188
156 iso_pu_bacteria 2876363079 2876366510 188
157 iso_pu_bacteria 2903521522 2903524378 188
158 iso_pu_bacteria 2903528002 2903533439 188
159 iso_pu_bacteria 2963644680 2963649305 188
160 3300003215 JGI25153J46596_10033050 JGI25153J46596_100330503 189
161 3300025297 Ga0209758_1001812 Ga0209758_100181214 189
162 iso_pu_bacteria 2515154134 2515739077 189
163 3300003790 Ga0055528_1030629 Ga0055528_10306292 191
164 3300013104 Ga0157370_10000566 Ga0157370_1000056633 191
165 3300025273 Ga0209673_1005999 Ga0209673_10059996 191
166 3300025711 Ga0207696_1000930 Ga0207696_100093019 191
167 3300046507 Ga0495606_0000616 Ga0495606_0000616_25275_25904 191
168 3300046810 Ga0495660_0000011 Ga0495660_0000011_179547_180176 191
169 3300047446 Ga0495679_006782 Ga0495679_006782_3202_3831 191
170 3300047469 Ga0495673_0028130 Ga0495673_0028130_357_986 191
171 iso_pu_bacteria 2772190666 2772438727 191
172 iso_pu_bacteria 8004592986 8004594418 191
173 3300003762 Ga0055542_1026398 Ga0055542_10263981 192
174 3300006946 Ga0079104_1001080 Ga0079104_100108029 192
175 3300009011 Ga0105251_10000228 Ga0105251_1000022827 192
176 3300025735 Ga0207713_1000101 Ga0207713_100010128 192
177 3300027111 Ga0209281_1000465 Ga0209281_100046529 192
178 3300046520 Ga0495637_0160631 Ga0495637_0160631_21_671 192
179 3300015262 Ga0182007_10000020 Ga0182007_10000020148 193
180 3300025304 Ga0209257_1000932 Ga0209257_100093246 193
181 3300044650 Ga0466986_0074830 Ga0466986_0074830_292_942 193
182 3300045976 Ga0466967_0594074 Ga0466967_0594074_127_777 193
183 3300046471 Ga0495650_0001341 Ga0495650_0001341_15572_16210 193
184 3300046660 Ga0495625_0000280 Ga0495625_0000280_934_1572 193
185 3300046660 Ga0495625_0059418 Ga0495625_0059418_1580_2215 193
186 3300048927 Ga0496124_0187518 Ga0496124_0187518_337_1023 193
187 3300001979 JGI24740J21852_10000039 JGI24740J21852_1000003937 194
188 3300041505 Ga0451849_0607786 Ga0451849_0607786_1578_2240 194
189 3300044673 Ga0453683_0009466 Ga0453683_0009466_5608_6264 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18894

PhageMetallopep

Putative phage metallopeptidase

42

198

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.785 107 137
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.5616 49 137
6mdx-assembly1.cif.gz_A mechanism of protease dependent dpc repair 0.5564 35 141
1jil-assembly1.cif.gz_A crystal structure of s. aureus tyrrs in complex with sb284485 0.5516 91 114
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.4337 49 173
ID Description Score Start End Superfamily
af_A0A1D6JTF3_15_142_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7636 59 137 3.30.2010.10
af_P25894_60_145_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6987 109 144 3.30.2010.10
af_K7KY12_259_325_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6865 109 143 3.30.2010.10
af_A0A1D6FHQ3_2_88_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.6698 56 137 3.30.2010.10
af_A0A1D6LI78_20_121_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.665 57 136 3.30.2010.10
ID Description Score Start End GO Terms
AF-J3BN68-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9817 5 133
AF-J3BN68-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9596 5 133
AF-A0A368YHP0-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9545 32 135
AF-A0A7W0G1C1-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9347 9 135
AF-A0A3M4AVS5-F1-model_v4 Putative phage metallopeptidase domain-containing protein 0.9278 10 147

Feature Viewer

pLDDT pTM Quality
79.42 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map