F291200

General Info

Members Datasets Scaffolds Average Seq Length
189 120 165 249

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10002610|Ga0307414_100026106
Length 234
Sequence MVHPRLTVITIVYNNVRDIERTMLSVLNQTYTNLEYIIIDGQSTDGTIAVIEKYRERLSHFVSEPDNGIYDAMNKGLALASGDYILFMNLAPDADIYYGETEMYNDQWESLGQRRHRSPEAFSWRSFQYGMSVSHQAIYVKRAIADPFDTQYKLSSDIDWIIKVAKKSKKIVNTRMYVAKYLVGGISKGKHLQSLKERFDIFNRHYGLVPNLINHTVIALKLGFYYLRHGRTND

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
13 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
14 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
15 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
16 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
17 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
18 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
21 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
22 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
23 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
118 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
119 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
120 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.3
Metatranscriptomes 0
Isolates 12.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0
Rhizoplane 0.53
Rhizosphere 75.13
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000016 3300002737 Bacteria 288734
2 JGI25162J39368_1000866 3300002737 Bacteria 19829
3 JGI25164J39214_1002851 3300002772 Bacteria 2418
4 JGI25152J39213_1000043 3300002773 Bacteria 87508
5 JGI25150J39212_1000023 3300002774 Bacteria 130663
6 JGI25151J46595_10000082 3300003187 Bacteria 130832
7 JGI25165J46597_1001674 3300003214 Bacteria 10067
8 JGI25153J46596_10000060 3300003215 Bacteria 131744
9 rootH1_10034433 3300003316 Bacteria 16075
10 rootL2_10055169 3300003322 Bacteria 1953
11 rootL2_10055170 3300003322 Bacteria 2024
12 rootL2_10106077 3300003322 Bacteria 3701
13 rootH1_10003399 3300003323 Bacteria 54122
14 rootH1_10067009 3300003323 Bacteria 4934
15 rootH1_10080412 3300003323 Bacteria 1967
16 Ga0055529_1017183 3300003763 Bacteria 907
17 Ga0055536_1000006 3300003781 Bacteria 347733
18 Ga0065714_10003934 3300005288 Bacteria 10169
19 Ga0065714_10005338 3300005288 Bacteria 6610
20 Ga0065714_10015070 3300005288 Bacteria 1756
21 Ga0065714_10064490 3300005288 Bacteria 50332
22 Ga0065714_10070460 3300005288 Bacteria 3863
23 Ga0070658_10064482 3300005327 Unclassified 2988
24 Ga0070658_10310542 3300005327 Bacteria 1345
25 Ga0070660_100029818 3300005339 Bacteria 4090
26 Ga0070659_100000669 3300005366 Bacteria 24919
27 Ga0070681_10033819 3300005458 Bacteria 5132
28 Ga0070679_100002914 3300005530 Bacteria 15556
29 Ga0068853_100064873 3300005539 Bacteria 3168
30 Ga0068855_100002648 3300005563 Bacteria 22068
31 Ga0068855_100172099 3300005563 Bacteria 2452
32 Ga0068855_100433783 3300005563 Unclassified 1436
33 Ga0068857_100359118 3300005577 Bacteria 1350
34 Ga0068854_100013127 3300005578 Bacteria 5431
35 Ga0068856_100200938 3300005614 Bacteria 2008
36 Ga0068856_100422920 3300005614 Unclassified 1352
37 Ga0105244_10040439 3300009036 Bacteria 2421
38 Ga0105240_10000082 3300009093 Bacteria 195184
39 Ga0105241_10015892 3300009174 Bacteria 5514
40 Ga0105241_10058902 3300009174 Unclassified 2951
41 Ga0105241_10179835 3300009174 Bacteria 1753
42 Ga0105241_10583752 3300009174 Unclassified 1008
43 Ga0105237_10000310 3300009545 Bacteria 67887
44 Ga0105237_10000394 3300009545 Bacteria 62227
45 Ga0105237_10002729 3300009545 Bacteria 21530
46 Ga0105237_10003434 3300009545 Bacteria 18811
47 Ga0105237_10089290 3300009545 Bacteria 3071
48 Ga0105238_10088133 3300009551 Bacteria 3090
49 Ga0105238_10230917 3300009551 Bacteria 1827
50 Ga0105239_10001336 3300010375 Bacteria 33227
51 Ga0105239_10001982 3300010375 Bacteria 26624
52 Ga0105239_10002604 3300010375 Bacteria 22834
53 Ga0105239_10029948 3300010375 Bacteria 5986
54 Ga0157373_10000057 3300013100 Bacteria 99697
55 Ga0157373_10001726 3300013100 Bacteria 16609
56 Ga0157373_10013856 3300013100 Bacteria 5912
57 Ga0157371_10000027 3300013102 Bacteria 269243
58 Ga0157371_10013702 3300013102 Bacteria 6149
59 Ga0157370_10008980 3300013104 Bacteria 10728
60 Ga0157370_10012137 3300013104 Bacteria 8959
61 Ga0157370_10015155 3300013104 Bacteria 7851
62 Ga0157370_10029774 3300013104 Bacteria 5354
63 Ga0157370_10366408 3300013104 Bacteria 1328
64 Ga0157369_10000053 3300013105 Bacteria 162962
65 Ga0157374_10221662 3300013296 Bacteria 1856
66 Ga0157378_10069016 3300013297 Bacteria 3170
67 Ga0163162_10000078 3300013306 Bacteria 89842
68 Ga0163162_10046084 3300013306 Bacteria 4370
69 Ga0157372_10000039 3300013307 Bacteria 165839
70 Ga0157375_10035673 3300013308 Bacteria 4749
71 Ga0182008_10000053 3300014497 Bacteria 102934
72 Ga0182008_10000229 3300014497 Bacteria 43810
73 Ga0182006_1000203 3300015261 Bacteria 61122
74 Ga0182006_1000270 3300015261 Bacteria 46578
75 Ga0182006_1001270 3300015261 Bacteria 15572
76 Ga0182006_1015429 3300015261 Bacteria 3275
77 Ga0182007_10000005 3300015262 Bacteria 442702
78 Ga0183373_1007 3300015682 Bacteria 282776
79 Ga0163161_10000809 3300017792 Bacteria 24489
80 Ga0163161_10000825 3300017792 Bacteria 24230
81 Ga0163161_10001764 3300017792 Bacteria 15793
82 Ga0163161_10002223 3300017792 Bacteria 13977
83 Ga0163161_10010251 3300017792 Bacteria 6489
84 Ga0163161_10069178 3300017792 Bacteria 2580
85 Ga0207427_100122 3300025231 Bacteria 99064
86 Ga0209437_100048 3300025233 Bacteria 405107
87 Ga0209437_100119 3300025233 Bacteria 206549
88 Ga0207425_1000051 3300025245 Bacteria 166795
89 Ga0209026_1000331 3300025250 Bacteria 46716
90 Ga0209129_1000121 3300025258 Bacteria 135404
91 Ga0209129_1008227 3300025258 Bacteria 2935
92 Ga0209233_1000029 3300025261 Bacteria 641642
93 Ga0209455_1002200 3300025272 Bacteria 7719
94 Ga0209676_1000039 3300025292 Bacteria 443158
95 Ga0209025_1000160 3300025294 Bacteria 166795
96 Ga0209758_1000147 3300025297 Bacteria 166795
97 Ga0209050_1000033 3300025298 Bacteria 442615
98 Ga0207705_10080659 3300025909 Unclassified 2371
99 Ga0207654_10456362 3300025911 Unclassified 897
100 Ga0207695_10000053 3300025913 Bacteria 396740
101 Ga0207695_10263474 3300025913 Unclassified 1621
102 Ga0207671_10000366 3300025914 Bacteria 64454
103 Ga0207671_10000925 3300025914 Bacteria 36841
104 Ga0207671_10001993 3300025914 Bacteria 22502
105 Ga0207671_10002661 3300025914 Bacteria 18743
106 Ga0207671_10072801 3300025914 Unclassified 2565
107 Ga0207694_10062968 3300025924 Bacteria 2889
108 Ga0207694_10291752 3300025924 Bacteria 1341
109 Ga0207690_10005247 3300025932 Bacteria 7644
110 Ga0207667_10000394 3300025949 Bacteria 58926
111 Ga0207667_10013681 3300025949 Bacteria 9274
112 Ga0207667_10252014 3300025949 Bacteria 1806
113 Ga0207667_10405407 3300025949 Bacteria 1388
114 Ga0207640_10015494 3300025981 Bacteria 4414
115 Ga0207639_10193804 3300026041 Unclassified 1738
116 Ga0307515_10054408 3300028794 Bacteria 5877
117 Ga0307509_10040809 3300031507 Bacteria 5044
118 Ga0307405_10000085 3300031731 Bacteria 39496
119 Ga0307407_10000001 3300031903 Bacteria 570048
120 Ga0307412_10134215 3300031911 Bacteria 1803
121 Ga0307409_100038519 3300031995 Bacteria 3537
122 Ga0307416_100000008 3300032002 Bacteria 401343
123 Ga0307414_10002610 3300032004 Bacteria 9482
124 Ga0307414_10108625 3300032004 Bacteria 2105
125 Ga0307411_10034183 3300032005 Bacteria 3161
126 Ga0495651_0288001 3300046462 Bacteria 1107
127 Ga0495650_0000144 3300046471 Bacteria 165957
128 Ga0495585_0000091 3300046492 Bacteria 95620
129 Ga0495583_0156720 3300046506 Bacteria 941
130 Ga0495606_0000919 3300046507 Bacteria 43453
131 Ga0495606_0010375 3300046507 Bacteria 7741
132 Ga0495606_0024835 3300046507 Bacteria 4307
133 Ga0495606_0054212 3300046507 Bacteria 2597
134 Ga0495606_0088628 3300046507 Bacteria 1907
135 Ga0495610_0000108 3300046512 Bacteria 96839
136 Ga0495610_0000129 3300046512 Bacteria 83051
137 Ga0495610_0000959 3300046512 Bacteria 26649
138 Ga0495610_0061267 3300046512 Bacteria 1788
139 Ga0495616_0001475 3300046513 Bacteria 16329
140 Ga0495637_0017723 3300046520 Bacteria 3312
141 Ga0495637_0053731 3300046520 Bacteria 1676
142 Ga0495652_0191174 3300046529 Bacteria 1562
143 Ga0495652_0308855 3300046529 Bacteria 1147
144 Ga0495609_0026136 3300046538 Bacteria 2673
145 Ga0495633_0010157 3300046558 Bacteria 5154
146 Ga0495633_0067577 3300046558 Bacteria 1669
147 Ga0495668_0168726 3300046616 Bacteria 1199
148 Ga0495625_0000059 3300046660 Bacteria 180330
149 Ga0495625_0004553 3300046660 Bacteria 13050
150 Ga0495661_0003215 3300046665 Bacteria 12199
151 Ga0495661_0012945 3300046665 Bacteria 5619
152 Ga0495661_0078692 3300046665 Bacteria 1907
153 Ga0495661_0123858 3300046665 Bacteria 1424
154 Ga0495649_0000031 3300046694 Bacteria 151547
155 Ga0495660_0013167 3300046810 Bacteria 4793
156 Ga0495687_000741 3300047443 Bacteria 35578
157 Ga0495673_0045319 3300047469 Bacteria 1956
158 Ga0495686_0002591 3300047472 Bacteria 16802
159 Ga0495686_0040694 3300047472 Bacteria 2963
160 Ga0495686_0287335 3300047472 Bacteria 912
161 Ga0496115_0458728 3300048918 Bacteria 1028
162 Ga0496123_0000777 3300048926 Bacteria 51679
163 Ga0501238_009468 3300049671 Bacteria 1293
164 Ga0500618_000018 3300053125 Bacteria 163272
165 Ga0500634_0135322 3300053161 Bacteria 1176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015261 Ga0182006_1000203 Ga0182006_100020320 228
2 3300047472 Ga0495686_0287335 Ga0495686_0287335_42_728 228
3 3300048926 Ga0496123_0000777 Ga0496123_0000777_37223_37909 228
4 3300032004 Ga0307414_10002610 Ga0307414_100026106 234
5 3300013100 Ga0157373_10013856 Ga0157373_100138563 239
6 3300013104 Ga0157370_10012137 Ga0157370_100121376 239
7 3300013104 Ga0157370_10029774 Ga0157370_100297742 239
8 3300017792 Ga0163161_10010251 Ga0163161_100102516 239
9 3300046507 Ga0495606_0054212 Ga0495606_0054212_1333_2052 239
10 iso_pu_bacteria 2585427687 2586207799 244
11 iso_pu_bacteria 2738541302 2738854630 244
12 iso_pu_bacteria 2739367651 2739587151 244
13 iso_pu_bacteria 2739367656 2739615239 244
14 iso_pu_bacteria 2739367663 2739645633 244
15 iso_pu_bacteria 2818991437 2819547612 244
16 iso_pu_bacteria 2842722452 2842726624 244
17 iso_pu_bacteria 2842909656 2842911468 244
18 iso_pu_bacteria 2849281842 2849284186 244
19 iso_pu_bacteria 2857627736 2857628259 244
20 iso_pu_bacteria 2904445276 2904449635 244
21 iso_pu_bacteria 2945997725 2946003072 244
22 iso_pu_bacteria 2738541283 2738756070 245
23 iso_pu_bacteria 2852623160 2852625515 245
24 iso_pu_bacteria 2884933994 2884934517 245
25 iso_pu_bacteria 2890737413 2890738432 246
26 iso_pu_bacteria 2898713307 2898713889 246
27 iso_pu_bacteria 8055588893 8055591886 246
28 iso_pu_bacteria 2919437846 2919440523 247
29 3300002773 JGI25152J39213_1000043 JGI25152J39213_100004377 248
30 3300002774 JGI25150J39212_1000023 JGI25150J39212_100002349 248
31 3300003187 JGI25151J46595_10000082 JGI25151J46595_1000008249 248
32 3300003215 JGI25153J46596_10000060 JGI25153J46596_1000006050 248
33 3300003781 Ga0055536_1000006 Ga0055536_100000630 248
34 3300005288 Ga0065714_10005338 Ga0065714_100053384 248
35 3300005288 Ga0065714_10015070 Ga0065714_100150701 248
36 3300005288 Ga0065714_10064490 Ga0065714_1006449016 248
37 3300005563 Ga0068855_100172099 Ga0068855_1001720991 248
38 3300009036 Ga0105244_10040439 Ga0105244_100404393 248
39 3300013102 Ga0157371_10000027 Ga0157371_1000002753 248
40 3300013104 Ga0157370_10015155 Ga0157370_100151553 248
41 3300013105 Ga0157369_10000053 Ga0157369_10000053104 248
42 3300013306 Ga0163162_10000078 Ga0163162_100000784 248
43 3300013308 Ga0157375_10035673 Ga0157375_100356732 248
44 3300014497 Ga0182008_10000229 Ga0182008_1000022941 248
45 3300015261 Ga0182006_1001270 Ga0182006_100127015 248
46 3300015262 Ga0182007_10000005 Ga0182007_10000005311 248
47 3300015682 Ga0183373_1007 Ga0183373_1007170 248
48 3300017792 Ga0163161_10000809 Ga0163161_1000080913 248
49 3300017792 Ga0163161_10000825 Ga0163161_1000082515 248
50 3300017792 Ga0163161_10069178 Ga0163161_100691783 248
51 3300025245 Ga0207425_1000051 Ga0207425_100005182 248
52 3300025258 Ga0209129_1000121 Ga0209129_100012149 248
53 3300025292 Ga0209676_1000039 Ga0209676_1000039125 248
54 3300025294 Ga0209025_1000160 Ga0209025_100016078 248
55 3300025297 Ga0209758_1000147 Ga0209758_100014778 248
56 3300025298 Ga0209050_1000033 Ga0209050_1000033324 248
57 3300025949 Ga0207667_10405407 Ga0207667_104054072 248
58 3300031731 Ga0307405_10000085 Ga0307405_1000008525 248
59 3300031903 Ga0307407_10000001 Ga0307407_10000001157 248
60 3300031995 Ga0307409_100038519 Ga0307409_1000385192 248
61 3300032002 Ga0307416_100000008 Ga0307416_100000008232 248
62 3300032004 Ga0307414_10108625 Ga0307414_101086252 248
63 3300046512 Ga0495610_0000108 Ga0495610_0000108_33334_34080 248
64 3300046512 Ga0495610_0000129 Ga0495610_0000129_30226_30972 248
65 3300046520 Ga0495637_0053731 Ga0495637_0053731_377_1123 248
66 3300046558 Ga0495633_0067577 Ga0495633_0067577_386_1132 248
67 iso_pu_bacteria 2738543023 2739304159 248
68 iso_pu_bacteria 2852627209 2852630670 248
69 iso_pu_bacteria 2896317667 2896320486 248
70 iso_pu_bacteria 3003233435 3003237301 248
71 3300005288 Ga0065714_10003934 Ga0065714_100039348 249
72 3300005288 Ga0065714_10070460 Ga0065714_100704602 249
73 3300009545 Ga0105237_10000394 Ga0105237_1000039438 249
74 3300013100 Ga0157373_10001726 Ga0157373_1000172617 249
75 3300013104 Ga0157370_10008980 Ga0157370_100089804 249
76 3300014497 Ga0182008_10000053 Ga0182008_1000005379 249
77 3300015261 Ga0182006_1000270 Ga0182006_100027036 249
78 3300017792 Ga0163161_10001764 Ga0163161_1000176415 249
79 3300017792 Ga0163161_10002223 Ga0163161_100022238 249
80 3300025914 Ga0207671_10000925 Ga0207671_1000092510 249
81 3300028794 Ga0307515_10054408 Ga0307515_100544085 249
82 3300046665 Ga0495661_0003215 Ga0495661_0003215_10142_10891 249
83 3300046665 Ga0495661_0078692 Ga0495661_0078692_713_1462 249
84 3300048918 Ga0496115_0458728 Ga0496115_0458728_108_857 249
85 3300049671 Ga0501238_009468 Ga0501238_009468_192_941 249
86 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016173 250
87 3300002737 JGI25162J39368_1000866 JGI25162J39368_100086618 250
88 3300002772 JGI25164J39214_1002851 JGI25164J39214_10028511 250
89 3300003214 JGI25165J46597_1001674 JGI25165J46597_100167410 250
90 3300003316 rootH1_10034433 rootH1_100344333 250
91 3300003322 rootL2_10055169 rootL2_100551694 250
92 3300003322 rootL2_10055170 rootL2_100551702 250
93 3300003322 rootL2_10106077 rootL2_101060773 250
94 3300003323 rootH1_10003399 rootH1_1000339910 250
95 3300003323 rootH1_10067009 rootH1_100670093 250
96 3300003323 rootH1_10080412 rootH1_100804123 250
97 3300003763 Ga0055529_1017183 Ga0055529_10171831 250
98 3300005327 Ga0070658_10064482 Ga0070658_100644822 250
99 3300005327 Ga0070658_10310542 Ga0070658_103105422 250
100 3300005339 Ga0070660_100029818 Ga0070660_1000298184 250
101 3300005366 Ga0070659_100000669 Ga0070659_10000066930 250
102 3300005458 Ga0070681_10033819 Ga0070681_100338195 250
103 3300005530 Ga0070679_100002914 Ga0070679_1000029147 250
104 3300005539 Ga0068853_100064873 Ga0068853_1000648732 250
105 3300005563 Ga0068855_100002648 Ga0068855_1000026482 250
106 3300005563 Ga0068855_100433783 Ga0068855_1004337832 250
107 3300005577 Ga0068857_100359118 Ga0068857_1003591182 250
108 3300005578 Ga0068854_100013127 Ga0068854_1000131275 250
109 3300005614 Ga0068856_100200938 Ga0068856_1002009383 250
110 3300005614 Ga0068856_100422920 Ga0068856_1004229202 250
111 3300009093 Ga0105240_10000082 Ga0105240_1000008250 250
112 3300009174 Ga0105241_10015892 Ga0105241_100158922 250
113 3300009174 Ga0105241_10058902 Ga0105241_100589022 250
114 3300009174 Ga0105241_10179835 Ga0105241_101798352 250
115 3300009174 Ga0105241_10583752 Ga0105241_105837522 250
116 3300009545 Ga0105237_10000310 Ga0105237_1000031031 250
117 3300009545 Ga0105237_10002729 Ga0105237_1000272911 250
118 3300009545 Ga0105237_10003434 Ga0105237_100034349 250
119 3300009545 Ga0105237_10089290 Ga0105237_100892902 250
120 3300009551 Ga0105238_10088133 Ga0105238_100881333 250
121 3300009551 Ga0105238_10230917 Ga0105238_102309172 250
122 3300010375 Ga0105239_10001336 Ga0105239_1000133620 250
123 3300010375 Ga0105239_10001982 Ga0105239_100019824 250
124 3300010375 Ga0105239_10002604 Ga0105239_1000260410 250
125 3300010375 Ga0105239_10029948 Ga0105239_100299484 250
126 3300013100 Ga0157373_10000057 Ga0157373_1000005748 250
127 3300013102 Ga0157371_10013702 Ga0157371_100137022 250
128 3300013104 Ga0157370_10366408 Ga0157370_103664082 250
129 3300013296 Ga0157374_10221662 Ga0157374_102216622 250
130 3300013297 Ga0157378_10069016 Ga0157378_100690164 250
131 3300013306 Ga0163162_10046084 Ga0163162_100460841 250
132 3300013307 Ga0157372_10000039 Ga0157372_1000003964 250
133 3300015261 Ga0182006_1015429 Ga0182006_10154292 250
134 3300025231 Ga0207427_100122 Ga0207427_10012273 250
135 3300025233 Ga0209437_100048 Ga0209437_100048223 250
136 3300025233 Ga0209437_100119 Ga0209437_10011989 250
137 3300025250 Ga0209026_1000331 Ga0209026_100033123 250
138 3300025258 Ga0209129_1008227 Ga0209129_10082272 250
139 3300025261 Ga0209233_1000029 Ga0209233_1000029153 250
140 3300025272 Ga0209455_1002200 Ga0209455_10022006 250
141 3300025909 Ga0207705_10080659 Ga0207705_100806592 250
142 3300025911 Ga0207654_10456362 Ga0207654_104563622 250
143 3300025913 Ga0207695_10000053 Ga0207695_10000053301 250
144 3300025913 Ga0207695_10263474 Ga0207695_102634742 250
145 3300025914 Ga0207671_10000366 Ga0207671_1000036634 250
146 3300025914 Ga0207671_10001993 Ga0207671_1000199313 250
147 3300025914 Ga0207671_10002661 Ga0207671_100026616 250
148 3300025914 Ga0207671_10072801 Ga0207671_100728012 250
149 3300025924 Ga0207694_10062968 Ga0207694_100629682 250
150 3300025924 Ga0207694_10291752 Ga0207694_102917521 250
151 3300025932 Ga0207690_10005247 Ga0207690_1000524712 250
152 3300025949 Ga0207667_10000394 Ga0207667_1000039421 250
153 3300025949 Ga0207667_10013681 Ga0207667_100136815 250
154 3300025949 Ga0207667_10252014 Ga0207667_102520142 250
155 3300025981 Ga0207640_10015494 Ga0207640_100154942 250
156 3300026041 Ga0207639_10193804 Ga0207639_101938042 250
157 3300031507 Ga0307509_10040809 Ga0307509_100408093 250
158 3300031911 Ga0307412_10134215 Ga0307412_101342152 250
159 3300032005 Ga0307411_10034183 Ga0307411_100341832 250
160 3300046462 Ga0495651_0288001 Ga0495651_0288001_257_1012 250
161 3300046471 Ga0495650_0000144 Ga0495650_0000144_142263_143015 250
162 3300046492 Ga0495585_0000091 Ga0495585_0000091_28539_29291 250
163 3300046506 Ga0495583_0156720 Ga0495583_0156720_90_842 250
164 3300046507 Ga0495606_0000919 Ga0495606_0000919_9885_10637 250
165 3300046507 Ga0495606_0010375 Ga0495606_0010375_4461_5213 250
166 3300046507 Ga0495606_0024835 Ga0495606_0024835_2095_2847 250
167 3300046507 Ga0495606_0088628 Ga0495606_0088628_1039_1791 250
168 3300046512 Ga0495610_0000959 Ga0495610_0000959_254_1006 250
169 3300046512 Ga0495610_0061267 Ga0495610_0061267_452_1204 250
170 3300046513 Ga0495616_0001475 Ga0495616_0001475_5245_5997 250
171 3300046520 Ga0495637_0017723 Ga0495637_0017723_2379_3131 250
172 3300046529 Ga0495652_0191174 Ga0495652_0191174_796_1551 250
173 3300046529 Ga0495652_0308855 Ga0495652_0308855_34_786 250
174 3300046538 Ga0495609_0026136 Ga0495609_0026136_1342_2094 250
175 3300046558 Ga0495633_0010157 Ga0495633_0010157_929_1681 250
176 3300046616 Ga0495668_0168726 Ga0495668_0168726_392_1144 250
177 3300046660 Ga0495625_0000059 Ga0495625_0000059_34683_35435 250
178 3300046660 Ga0495625_0004553 Ga0495625_0004553_3405_4157 250
179 3300046665 Ga0495661_0012945 Ga0495661_0012945_254_1006 250
180 3300046665 Ga0495661_0123858 Ga0495661_0123858_419_1171 250
181 3300046694 Ga0495649_0000031 Ga0495649_0000031_7396_8148 250
182 3300046810 Ga0495660_0013167 Ga0495660_0013167_3488_4240 250
183 3300047443 Ga0495687_000741 Ga0495687_000741_8576_9328 250
184 3300047469 Ga0495673_0045319 Ga0495673_0045319_592_1344 250
185 3300047472 Ga0495686_0002591 Ga0495686_0002591_4059_4811 250
186 3300047472 Ga0495686_0040694 Ga0495686_0040694_1511_2269 250
187 3300053125 Ga0500618_000018 Ga0500618_000018_87670_88422 250
188 3300053161 Ga0500634_0135322 Ga0500634_0135322_342_1094 250
189 iso_pu_bacteria 2954016120 2954019932 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

7

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z86-assembly1.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.8865 4 220
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.876 3 220
2z86-assembly1.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.8757 4 220
2z87-assembly2.cif.gz_A crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.8733 4 220
2z86-assembly2.cif.gz_C crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.8728 4 220
ID Description Score Start End Superfamily
af_P9WMX9_1_212_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8708 3 202 3.90.550.10
af_Q2FV58_23_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8611 5 101 3.90.550.10
af_P71239_1_245_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8441 5 230 3.90.550.10
af_P9WMX7_1_219_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8259 1 206 3.90.550.10
af_P9WMX9_1_212_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8204 3 202 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4Q5SEX3-F1-model_v4 Glycosyltransferase 0.9888 2 201 GO:0016740
AF-A0A4Q3E4A0-F1-model_v4 Glycosyltransferase 0.9875 4 179 GO:0016740
AF-A0A2T0TUE1-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9724 2 250 GO:0016758
AF-A0A1H9JC37-F1-model_v4 Glycosyltransferase involved in cell wall bisynthesis 0.9687 4 250 GO:0016020
GO:0016740
AF-A0A1I2G1Y9-F1-model_v4 Glycosyltransferase involved in cell wall bisynthesis 0.9684 3 250 GO:0016020
GO:0016740

Feature Viewer

pLDDT pTM Quality
91.52 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map