F291052

General Info

Members Datasets Scaffolds Average Seq Length
189 139 378 162

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10489486|Ga0207684_104894862
Length 184
Sequence VSARSTGVFRKSKVSSFAHHLSHQQIRLFMNKGERISRFVAKLGENADIGRTGVARHPFYRAFFQCWNEQRYYEAHDVLEQLWLNTHTSDDDFFKGLIQAAGAFVHLQKRFEHPLHTKHGKRLPPAVRLFRLAERNLSSFAPRHHGLDVAGLCRLLSAYADQIVASDYKTNPWSPDTAPKLKFL

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.47
Rhizosphere 89.95
Stem 0
Stem Tuber 0
Unclassified 31.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10489486 3300025910 Bacteria 1055
2 MBSR1b_contig_1949006 2162886012 Bacteria 1276
3 Ga0065715_10000421 3300005293 Bacteria 13595
4 Ga0065715_10380433 3300005293 Unclassified 908
5 Ga0070658_11035702 3300005327 Bacteria 714
6 Ga0070683_100546439 3300005329 Unclassified 1107
7 Ga0070670_100697155 3300005331 Bacteria 913
8 Ga0070680_100245159 3300005336 Unclassified 1515
9 Ga0070660_100067430 3300005339 Unclassified 2788
10 Ga0070687_100047218 3300005343 Unclassified 2208
11 Ga0070668_100407463 3300005347 Unclassified 1162
12 Ga0070688_100012481 3300005365 Bacteria 4762
13 Ga0070659_100005730 3300005366 Bacteria 8945
14 Ga0070710_10297517 3300005437 Bacteria 1052
15 Ga0070701_10114534 3300005438 Unclassified 1511
16 Ga0070705_100301793 3300005440 Bacteria 1148
17 Ga0070700_100005325 3300005441 Bacteria 6802
18 Ga0070694_100021661 3300005444 Bacteria 4111
19 Ga0070708_100045369 3300005445 Unclassified 3871
20 Ga0070708_100165842 3300005445 Bacteria 2061
21 Ga0070708_100204800 3300005445 Viruses 1848
22 Ga0070678_100015800 3300005456 Bacteria 4808
23 Ga0070662_100016522 3300005457 Bacteria 4957
24 Ga0070681_10074944 3300005458 Bacteria 3344
25 Ga0070685_10274297 3300005466 Bacteria 1127
26 Ga0070706_100000012 3300005467 Bacteria 195040
27 Ga0070706_100009243 3300005467 Bacteria 9181
28 Ga0070706_100089418 3300005467 Bacteria 2855
29 Ga0070706_100335524 3300005467 Bacteria 1410
30 Ga0070706_100543393 3300005467 Bacteria 1081
31 Ga0070707_100020870 3300005468 Bacteria 6183
32 Ga0070707_100030523 3300005468 Bacteria 5132
33 Ga0070707_100099542 3300005468 Bacteria 2817
34 Ga0070698_100005853 3300005471 Bacteria 13438
35 Ga0070698_100007523 3300005471 Bacteria 11783
36 Ga0070698_100078007 3300005471 Bacteria 3311
37 Ga0070698_101200214 3300005471 Unclassified 708
38 Ga0070684_100008408 3300005535 Bacteria 8065
39 Ga0070684_100148802 3300005535 Bacteria 2120
40 Ga0070697_100013077 3300005536 Bacteria 6506
41 Ga0070697_100015621 3300005536 Bacteria 5962
42 Ga0070697_100049715 3300005536 Bacteria 3403
43 Ga0070697_100075801 3300005536 Bacteria 2765
44 Ga0070697_100349514 3300005536 Unclassified 1277
45 Ga0070695_100120234 3300005545 Bacteria 1796
46 Ga0070704_100014408 3300005549 Bacteria 4938
47 Ga0070702_100097207 3300005615 Unclassified 1799
48 Ga0068864_100492099 3300005618 Bacteria 1179
49 Ga0068860_100008587 3300005843 Bacteria 10184
50 Ga0081455_10595874 3300005937 Unclassified 721
51 Ga0081539_10016104 3300005985 Bacteria 5370
52 Ga0081539_10051371 3300005985 Bacteria 2324
53 Ga0070717_10001534 3300006028 Bacteria 16020
54 Ga0070712_100137026 3300006175 Bacteria 1862
55 Ga0097621_100111528 3300006237 Unclassified 2312
56 Ga0068871_100053911 3300006358 Bacteria 3261
57 Ga0075436_100246639 3300006914 Unclassified 1271
58 Ga0075436_100770619 3300006914 Unclassified 715
59 Ga0099794_10228244 3300007265 Unclassified 958
60 Ga0105240_10046198 3300009093 Bacteria 5519
61 Ga0105240_10958022 3300009093 Bacteria 917
62 Ga0111539_11342099 3300009094 Unclassified 830
63 Ga0111539_11579142 3300009094 Unclassified 761
64 Ga0105245_10861624 3300009098 Unclassified 946
65 Ga0105248_12630172 3300009177 Unclassified 574
66 Ga0105237_10119898 3300009545 Bacteria 2624
67 Ga0105249_10006704 3300009553 Bacteria 10032
68 Ga0105239_10032929 3300010375 Bacteria 5694
69 Ga0105246_10699574 3300011119 Bacteria 888
70 Ga0157373_10301883 3300013100 Unclassified 1137
71 Ga0157369_10018371 3300013105 Bacteria 7841
72 Ga0157374_10069423 3300013296 Bacteria 3318
73 Ga0157374_10165648 3300013296 Bacteria 2154
74 Ga0157374_10206371 3300013296 Bacteria 1926
75 Ga0157378_10058531 3300013297 Bacteria 3437
76 Ga0157378_10175437 3300013297 Bacteria 2013
77 Ga0157378_10177969 3300013297 Bacteria 1999
78 Ga0157378_10442771 3300013297 Unclassified 1288
79 Ga0163162_10064873 3300013306 Bacteria 3698
80 Ga0157372_10013403 3300013307 Bacteria 8754
81 Ga0157372_10290218 3300013307 Bacteria 1902
82 Ga0157375_10012929 3300013308 Bacteria 7415
83 Ga0157377_10010845 3300014745 Bacteria 4525
84 Ga0157379_10105519 3300014968 Unclassified 2529
85 Ga0213872_10002348 3300021361 Bacteria 11241
86 Ga0213872_10007274 3300021361 Bacteria 5465
87 Ga0213874_10174238 3300021377 Bacteria 762
88 Ga0207673_1001307 3300025290 Unclassified 2696
89 Ga0207697_10001697 3300025315 Bacteria 11851
90 Ga0207697_10017807 3300025315 Bacteria 2917
91 Ga0207692_10837694 3300025898 Unclassified 603
92 Ga0207680_10167005 3300025903 Unclassified 1480
93 Ga0207647_10005529 3300025904 Bacteria 9252
94 Ga0207705_10741671 3300025909 Bacteria 763
95 Ga0207684_10000028 3300025910 Bacteria 306450
96 Ga0207684_10020455 3300025910 Bacteria 5655
97 Ga0207684_10109447 3300025910 Bacteria 2365
98 Ga0207695_10639274 3300025913 Bacteria 945
99 Ga0207671_10277250 3300025914 Unclassified 1322
100 Ga0207693_10014613 3300025915 Bacteria 6308
101 Ga0207693_10015974 3300025915 Bacteria 6010
102 Ga0207663_10090853 3300025916 Bacteria 2025
103 Ga0207660_10818104 3300025917 Unclassified 760
104 Ga0207662_10063033 3300025918 Unclassified 2229
105 Ga0207657_10039908 3300025919 Bacteria 4165
106 Ga0207657_10107487 3300025919 Bacteria 2308
107 Ga0207649_10159941 3300025920 Unclassified 1560
108 Ga0207646_10062322 3300025922 Bacteria 3329
109 Ga0207646_10424143 3300025922 Unclassified 1201
110 Ga0207681_10556651 3300025923 Unclassified 944
111 Ga0207659_10003255 3300025926 Bacteria 9724
112 Ga0207664_10234528 3300025929 Unclassified 1596
113 Ga0207644_10143383 3300025931 Bacteria 1842
114 Ga0207690_10029897 3300025932 Bacteria 3468
115 Ga0207706_10084371 3300025933 Bacteria 2793
116 Ga0207670_10005605 3300025936 Bacteria 6903
117 Ga0207665_10010137 3300025939 Bacteria 6187
118 Ga0207711_10385751 3300025941 Unclassified 1300
119 Ga0207661_10028287 3300025944 Bacteria 4291
120 Ga0207661_10453265 3300025944 Bacteria 1168
121 Ga0207712_10005597 3300025961 Bacteria 7920
122 Ga0207668_10333356 3300025972 Unclassified 1263
123 Ga0207658_10315993 3300025986 Bacteria 1351
124 Ga0207703_10028889 3300026035 Bacteria 4376
125 Ga0207708_10002220 3300026075 Bacteria 14360
126 Ga0207676_10054400 3300026095 Bacteria 3137
127 Ga0207675_100383492 3300026118 Bacteria 1382
128 Ga0207683_10014644 3300026121 Bacteria 6679
129 Ga0268266_10796745 3300028379 Unclassified 912
130 Ga0268264_10061504 3300028381 Bacteria 3150
131 Ga0373936_0268008 3300035113 Unclassified 766
132 Ga0373943_0277158 3300035170 Unclassified 947
133 Ga0373946_0302391 3300035171 Unclassified 791
134 Ga0373946_0371769 3300035171 Unclassified 718
135 Ga0373935_0208804 3300035692 Unclassified 1352
136 Ga0373937_0137405 3300036401 Bacteria 2285
137 Ga0373937_0362586 3300036401 Unclassified 1373
138 Ga0373925_0467819 3300037068 Unclassified 1034
139 Ga0436360_0108775 3300039438 Bacteria 4684
140 Ga0436360_0222819 3300039438 Bacteria 3314
141 Ga0436360_0489177 3300039438 Unclassified 1644
142 Ga0436361_0195339 3300039447 Bacteria 13603
143 Ga0436361_0396885 3300039447 Bacteria 9052
144 Ga0436361_0869682 3300039447 Bacteria 2133
145 Ga0436361_1143413 3300039447 Unclassified 1906
146 Ga0436363_0726330 3300039450 Bacteria 51520
147 Ga0436362_0361019 3300039453 Unclassified 928
148 Ga0436362_0373471 3300039453 Bacteria 2105
149 Ga0436362_0930313 3300039453 Unclassified 4031
150 Ga0451798_0610967 3300041458 Bacteria 838
151 Ga0451800_0067941 3300041459 Unclassified 537
152 Ga0451839_0536982 3300041496 Bacteria 597
153 Ga0466967_0836462 3300045976 Bacteria 914
154 Ga0495651_0011240 3300046462 Bacteria 6880
155 Ga0495580_0717329 3300046472 Bacteria 653
156 Ga0495608_0665177 3300046511 Bacteria 622
157 Ga0495628_0138935 3300046516 Bacteria 1855
158 Ga0495652_0012654 3300046529 Bacteria 7602
159 Ga0495599_0247331 3300046678 Bacteria 1086
160 Ga0495658_0081715 3300046683 Bacteria 1898
161 Ga0495613_0367849 3300046689 Bacteria 985
162 Ga0495624_0130066 3300046690 Bacteria 1544
163 Ga0495674_0116909 3300047319 Unclassified 2256
164 Ga0495675_0248857 3300047444 Bacteria 1068
165 Ga0495602_0794527 3300048088 Bacteria 636
166 Ga0496102_1067266 3300048905 Unclassified 728
167 Ga0496104_0081967 3300048907 Bacteria 3077
168 Ga0496105_0558065 3300048908 Unclassified 893
169 Ga0496106_0042942 3300048909 Bacteria 3391
170 Ga0496107_0254182 3300048910 Unclassified 1307
171 Ga0496108_1007214 3300048911 Unclassified 711
172 Ga0496109_0231337 3300048912 Bacteria 1739
173 Ga0496110_0015553 3300048913 Bacteria 6336
174 Ga0496112_0215782 3300048915 Bacteria 1875
175 Ga0496112_0253657 3300048915 Unclassified 1710
176 Ga0496112_0643766 3300048915 Bacteria 990
177 Ga0496113_0665942 3300048916 Bacteria 832
178 Ga0496113_1451449 3300048916 Bacteria 530
179 Ga0496114_0058697 3300048917 Bacteria 3213
180 nmdc:mga08y16_233067_c1 3300050511 Bacteria 1904
181 nmdc:mga0n895_399826_c1 3300050512 Unclassified 1389
182 nmdc:mga0n895_441485_c1 3300050512 Unclassified 1314
183 nmdc:mga0rr50_1093448_c1 3300050513 Bacteria 678
184 nmdc:mga08x19_346999_c1 3300050514 Unclassified 1036
185 nmdc:mga08x19_638705_c1 3300050514 Unclassified 755
186 Ga0495601_0013771 3300053077 Unclassified 4867
187 Ga0495612_0155877 3300053078 Bacteria 996
188 Ga0495595_0057205 3300053084 Bacteria 1819
189 Ga0495619_0135366 3300053085 Bacteria 1695
190 Ga0207684_10489486
191 MBSR1b_contig_1949006
192 Ga0065715_10000421
193 Ga0065715_10380433
194 Ga0070658_11035702
195 Ga0070683_100546439
196 Ga0070670_100697155
197 Ga0070680_100245159
198 Ga0070660_100067430
199 Ga0070687_100047218
200 Ga0070668_100407463
201 Ga0070688_100012481
202 Ga0070659_100005730
203 Ga0070710_10297517
204 Ga0070701_10114534
205 Ga0070705_100301793
206 Ga0070700_100005325
207 Ga0070694_100021661
208 Ga0070708_100045369
209 Ga0070708_100165842
210 Ga0070708_100204800
211 Ga0070678_100015800
212 Ga0070662_100016522
213 Ga0070681_10074944
214 Ga0070685_10274297
215 Ga0070706_100000012
216 Ga0070706_100009243
217 Ga0070706_100089418
218 Ga0070706_100335524
219 Ga0070706_100543393
220 Ga0070707_100020870
221 Ga0070707_100030523
222 Ga0070707_100099542
223 Ga0070698_100005853
224 Ga0070698_100007523
225 Ga0070698_100078007
226 Ga0070698_101200214
227 Ga0070684_100008408
228 Ga0070684_100148802
229 Ga0070697_100013077
230 Ga0070697_100015621
231 Ga0070697_100049715
232 Ga0070697_100075801
233 Ga0070697_100349514
234 Ga0070695_100120234
235 Ga0070704_100014408
236 Ga0070702_100097207
237 Ga0068864_100492099
238 Ga0068860_100008587
239 Ga0081455_10595874
240 Ga0081539_10016104
241 Ga0081539_10051371
242 Ga0070717_10001534
243 Ga0070712_100137026
244 Ga0097621_100111528
245 Ga0068871_100053911
246 Ga0075436_100246639
247 Ga0075436_100770619
248 Ga0099794_10228244
249 Ga0105240_10046198
250 Ga0105240_10958022
251 Ga0111539_11342099
252 Ga0111539_11579142
253 Ga0105245_10861624
254 Ga0105248_12630172
255 Ga0105237_10119898
256 Ga0105249_10006704
257 Ga0105239_10032929
258 Ga0105246_10699574
259 Ga0157373_10301883
260 Ga0157369_10018371
261 Ga0157374_10069423
262 Ga0157374_10165648
263 Ga0157374_10206371
264 Ga0157378_10058531
265 Ga0157378_10175437
266 Ga0157378_10177969
267 Ga0157378_10442771
268 Ga0163162_10064873
269 Ga0157372_10013403
270 Ga0157372_10290218
271 Ga0157375_10012929
272 Ga0157377_10010845
273 Ga0157379_10105519
274 Ga0213872_10002348
275 Ga0213872_10007274
276 Ga0213874_10174238
277 Ga0207673_1001307
278 Ga0207697_10001697
279 Ga0207697_10017807
280 Ga0207692_10837694
281 Ga0207680_10167005
282 Ga0207647_10005529
283 Ga0207705_10741671
284 Ga0207684_10000028
285 Ga0207684_10020455
286 Ga0207684_10109447
287 Ga0207695_10639274
288 Ga0207671_10277250
289 Ga0207693_10014613
290 Ga0207693_10015974
291 Ga0207663_10090853
292 Ga0207660_10818104
293 Ga0207662_10063033
294 Ga0207657_10039908
295 Ga0207657_10107487
296 Ga0207649_10159941
297 Ga0207646_10062322
298 Ga0207646_10424143
299 Ga0207681_10556651
300 Ga0207659_10003255
301 Ga0207664_10234528
302 Ga0207644_10143383
303 Ga0207690_10029897
304 Ga0207706_10084371
305 Ga0207670_10005605
306 Ga0207665_10010137
307 Ga0207711_10385751
308 Ga0207661_10028287
309 Ga0207661_10453265
310 Ga0207712_10005597
311 Ga0207668_10333356
312 Ga0207658_10315993
313 Ga0207703_10028889
314 Ga0207708_10002220
315 Ga0207676_10054400
316 Ga0207675_100383492
317 Ga0207683_10014644
318 Ga0268266_10796745
319 Ga0268264_10061504
320 Ga0373936_0268008
321 Ga0373943_0277158
322 Ga0373946_0302391
323 Ga0373946_0371769
324 Ga0373935_0208804
325 Ga0373937_0137405
326 Ga0373937_0362586
327 Ga0373925_0467819
328 Ga0436360_0108775
329 Ga0436360_0222819
330 Ga0436360_0489177
331 Ga0436361_0195339
332 Ga0436361_0396885
333 Ga0436361_0869682
334 Ga0436361_1143413
335 Ga0436363_0726330
336 Ga0436362_0361019
337 Ga0436362_0373471
338 Ga0436362_0930313
339 Ga0451798_0610967
340 Ga0451800_0067941
341 Ga0451839_0536982
342 Ga0466967_0836462
343 Ga0495651_0011240
344 Ga0495580_0717329
345 Ga0495608_0665177
346 Ga0495628_0138935
347 Ga0495652_0012654
348 Ga0495599_0247331
349 Ga0495658_0081715
350 Ga0495613_0367849
351 Ga0495624_0130066
352 Ga0495674_0116909
353 Ga0495675_0248857
354 Ga0495602_0794527
355 Ga0496102_1067266
356 Ga0496104_0081967
357 Ga0496105_0558065
358 Ga0496106_0042942
359 Ga0496107_0254182
360 Ga0496108_1007214
361 Ga0496109_0231337
362 Ga0496110_0015553
363 Ga0496112_0215782
364 Ga0496112_0253657
365 Ga0496112_0643766
366 Ga0496113_0665942
367 Ga0496113_1451449
368 Ga0496114_0058697
369 nmdc:mga08y16_233067_c1
370 nmdc:mga0n895_399826_c1
371 nmdc:mga0n895_441485_c1
372 nmdc:mga0rr50_1093448_c1
373 nmdc:mga08x19_346999_c1
374 nmdc:mga08x19_638705_c1
375 Ga0495601_0013771
376 Ga0495612_0155877
377 Ga0495595_0057205
378 Ga0495619_0135366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03745

DUF309

Domain of unknown function (DUF309)

60

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ijq-assembly1.cif.gz_A crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.8353 23 155
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.7772 23 155
2cxd-assembly2.cif.gz_B crystal structure of conserved hypothetical protein, ttha0068 from thermus thermophilus hb8 0.7719 32 133
7pks-assembly1.cif.gz_g structural basis of integrator-mediated transcription regulation 0.7462 8 137
2ijq-assembly2.cif.gz_B crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309 0.7425 23 155
ID Description Score Start End Superfamily
2ijqA00 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.8353 23 155 1.10.3450.10
af_I1N8K6_35_196_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.7897 17 139 1.10.3450.10
2ijqB00 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.7772 23 155 1.10.3450.10
2cxdB00 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.7709 32 133 1.10.3450.10
2ijqB00 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.7425 23 155 1.10.3450.10
ID Description Score Start End GO Terms
AF-A0A2V6B6D4-F1-model_v4 DUF309 domain-containing protein 0.9928 1 155
AF-A0A2V5WJL1-F1-model_v4 DUF309 domain-containing protein 0.9926 1 158
AF-A0A2V5WJL1-F1-model_v4 DUF309 domain-containing protein 0.9864 1 158
AF-A0A2V5PTE0-F1-model_v4 DUF309 domain-containing protein 0.9849 1 155
AF-A0A2V5VGA9-F1-model_v4 DUF309 domain-containing protein 0.9812 1 155

Map