F290931

General Info

Members Datasets Scaffolds Average Seq Length
189 153 159 251

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10003860|Ga0157373_100038603
Length 298
Sequence MVPLHARNKSFIVPEFCRIPCRECIAFEAVPMTSGASFPEPASSHGIRADRIEKRLGPTDVLRGVSLDVRPGEVLSILGSSGSGKSTLLRCLNLLTVPDRGDIWVHGERLAIRPAAQKGAPASIVDQRQVRRIRASMGMVFQSFNLWPHKTALENVTEGPVHVKGMRRGAAADLGHHYLAKVGLSEKADAYPRHLSGGQQQRVAIARALAMEPLTLLFDEPTSALDPELVGEVLRVIEVLAGEGRTMVIVTHELAFARQVSTRVAFMHRGLIEEEAPPPQFFLSPASDRLRGFLASHR

Samples

Sample ID Description Type Environment
1 2516143018 Ensifer sp. BR816 Isolate Nodule
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
10 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
11 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
12 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
13 2818991435 Caulobacter henricii 536 Isolate Unclassified
14 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
15 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
16 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
17 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
18 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
92 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
93 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
136 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
139 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
144 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
145 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
146 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
147 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
148 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
149 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
150 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
151 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
152 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
153 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.13
Metatranscriptomes 0
Isolates 15.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 6.88
Rhizoplane 4.76
Rhizosphere 73.54
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1049586 3300003775 Bacteria 966
2 Ga0070709_10020213 3300005434 Bacteria 3861
3 Ga0070714_100051969 3300005435 Bacteria 3495
4 Ga0068867_100534672 3300005459 Bacteria 1013
5 Ga0070706_100045963 3300005467 Bacteria 4031
6 Ga0070706_100236692 3300005467 Bacteria 1705
7 Ga0070707_100285905 3300005468 Bacteria 1602
8 Ga0070698_100020490 3300005471 Bacteria 6930
9 Ga0070698_100038504 3300005471 Bacteria 4926
10 Ga0070698_100064365 3300005471 Bacteria 3695
11 Ga0070704_100521055 3300005549 Bacteria 1035
12 Ga0068856_100324668 3300005614 Bacteria 1557
13 Ga0068860_100215585 3300005843 Bacteria 1863
14 Ga0068862_100249628 3300005844 Bacteria 1617
15 Ga0075364_10030361 3300006051 Bacteria 3468
16 Ga0068865_100132032 3300006881 Bacteria 1872
17 Ga0105240_10002532 3300009093 Bacteria 29322
18 Ga0157373_10003860 3300013100 Bacteria 11322
19 Ga0171462_1054 3300013250 Bacteria 31131
20 Ga0157374_10050460 3300013296 Bacteria 3868
21 Ga0157374_10440348 3300013296 Bacteria 1304
22 Ga0157372_10489435 3300013307 Bacteria 1434
23 Ga0157380_10215870 3300014326 Bacteria 1713
24 Ga0182007_10001160 3300015262 Bacteria 14263
25 Ga0209564_1015098 3300025295 Bacteria 3163
26 Ga0209050_1029049 3300025298 Bacteria 1778
27 Ga0209256_1000353 3300025299 Bacteria 74809
28 Ga0207684_10038741 3300025910 Bacteria 4045
29 Ga0207695_10001423 3300025913 Bacteria 40252
30 Ga0207662_10437563 3300025918 Bacteria 892
31 Ga0207646_10024925 3300025922 Bacteria 5473
32 Ga0207664_10026453 3300025929 Bacteria 4386
33 Ga0207664_10075559 3300025929 Bacteria 2724
34 Ga0207648_10574489 3300026089 Bacteria 1037
35 Ga0268265_10199069 3300028380 Bacteria 1736
36 Ga0268264_10114602 3300028381 Bacteria 2367
37 Ga0265319_1001416 3300028563 Bacteria 14368
38 Ga0265334_10013091 3300028573 Bacteria 3478
39 Ga0265318_10002923 3300028577 Bacteria 8864
40 Ga0307515_10107789 3300028794 Bacteria 3288
41 Ga0265338_10004780 3300028800 Bacteria 18106
42 Ga0265338_10011037 3300028800 Bacteria 10484
43 Ga0265324_10050341 3300029957 Bacteria 1432
44 Ga0265330_10019223 3300031235 Bacteria 3133
45 Ga0265320_10023612 3300031240 Bacteria 3269
46 Ga0265325_10029870 3300031241 Bacteria 2927
47 Ga0265327_10023989 3300031251 Bacteria 3594
48 Ga0265316_10018290 3300031344 Bacteria 6025
49 Ga0265314_10042907 3300031711 Bacteria 3221
50 Ga0307516_10137400 3300031730 Bacteria 2217
51 Ga0373940_0020756 3300035088 Bacteria 1672
52 Ga0373932_0037755 3300035112 Bacteria 1378
53 Ga0373939_0010972 3300035114 Bacteria 2279
54 Ga0373931_0017630 3300035691 Bacteria 3535
55 Ga0373935_0015297 3300035692 Bacteria 4635
56 Ga0373933_0337297 3300035724 Bacteria 978
57 Ga0373937_0000661 3300036401 Bacteria 30177
58 Ga0466965_0038776 3300044683 Bacteria 2341
59 Ga0466966_0007084 3300044684 Bacteria 7431
60 Ga0466966_0046636 3300044684 Bacteria 2766
61 Ga0466966_0078747 3300044684 Bacteria 2055
62 Ga0466961_0010167 3300044693 Bacteria 5994
63 Ga0466963_0015335 3300044694 Bacteria 4742
64 Ga0466963_0040620 3300044694 Bacteria 3049
65 Ga0466963_0042223 3300044694 Bacteria 2993
66 Ga0466963_0089189 3300044694 Bacteria 2097
67 Ga0466963_0329498 3300044694 Bacteria 1075
68 Ga0466964_0005923 3300044706 Bacteria 4551
69 Ga0466964_0047497 3300044706 Bacteria 1752
70 Ga0466971_0000497 3300044719 Bacteria 15441
71 Ga0466957_0000254 3300044842 Bacteria 25608
72 Ga0466957_0079209 3300044842 Bacteria 2044
73 Ga0466959_0003265 3300045049 Bacteria 10566
74 Ga0466959_0010536 3300045049 Bacteria 6615
75 Ga0466959_0244896 3300045049 Bacteria 1237
76 Ga0466958_0010135 3300045836 Bacteria 5268
77 Ga0466967_0014706 3300045976 Bacteria 6110
78 Ga0466967_0028627 3300045976 Bacteria 4654
79 Ga0466967_0052645 3300045976 Bacteria 3574
80 Ga0466967_0068090 3300045976 Bacteria 3177
81 Ga0466967_0175426 3300045976 Bacteria 2019
82 Ga0495592_0000405 3300046454 Bacteria 32861
83 Ga0495603_0237784 3300046455 Bacteria 1049
84 Ga0495638_0000672 3300046460 Bacteria 37144
85 Ga0495651_0000038 3300046462 Bacteria 97248
86 Ga0495651_0034011 3300046462 Bacteria 3974
87 Ga0495651_0118051 3300046462 Bacteria 1952
88 Ga0495653_0002779 3300046463 Bacteria 13962
89 Ga0495580_0005633 3300046472 Bacteria 10302
90 Ga0495582_0103256 3300046473 Bacteria 1597
91 Ga0495606_0011990 3300046507 Bacteria 7000
92 Ga0495608_0000602 3300046511 Bacteria 24713
93 Ga0495628_0000025 3300046516 Bacteria 127935
94 Ga0495632_0003958 3300046519 Bacteria 10281
95 Ga0495632_0004510 3300046519 Bacteria 9438
96 Ga0495637_0003586 3300046520 Bacteria 8229
97 Ga0495648_0000120 3300046524 Bacteria 94692
98 Ga0495642_0147361 3300046528 Bacteria 1017
99 Ga0495652_0000088 3300046529 Bacteria 98865
100 Ga0495652_0047252 3300046529 Bacteria 3692
101 Ga0495654_0000116 3300046530 Bacteria 90109
102 Ga0495654_0095684 3300046530 Bacteria 1373
103 Ga0495654_0178709 3300046530 Bacteria 920
104 Ga0495587_0000174 3300046536 Bacteria 46812
105 Ga0495645_0000024 3300046543 Bacteria 125065
106 Ga0495667_0095637 3300046559 Bacteria 1923
107 Ga0495625_0004615 3300046660 Bacteria 12951
108 Ga0495625_0004722 3300046660 Bacteria 12757
109 Ga0495625_0045316 3300046660 Bacteria 3179
110 Ga0495657_0004181 3300046675 Bacteria 11560
111 Ga0495599_0000019 3300046678 Bacteria 141108
112 Ga0495623_0000375 3300046679 Bacteria 29188
113 Ga0495646_0007190 3300046680 Bacteria 7071
114 Ga0495658_0018664 3300046683 Bacteria 3610
115 Ga0495669_0022577 3300046684 Bacteria 2733
116 Ga0495600_0025311 3300046809 Bacteria 3825
117 Ga0495604_0000128 3300047317 Bacteria 63743
118 Ga0495672_0003601 3300047320 Bacteria 13159
119 Ga0495672_0084009 3300047320 Bacteria 1767
120 Ga0495680_0002445 3300047322 Bacteria 19011
121 Ga0495675_0000007 3300047444 Bacteria 162640
122 Ga0495673_0000241 3300047469 Bacteria 77386
123 Ga0495686_0000021 3300047472 Bacteria 426560
124 Ga0495686_0027655 3300047472 Bacteria 3701
125 Ga0495686_0052694 3300047472 Bacteria 2550
126 Ga0495686_0061167 3300047472 Bacteria 2339
127 Ga0495602_0001545 3300048088 Bacteria 22908
128 Ga0496104_0010625 3300048907 Bacteria 8225
129 Ga0496105_0007520 3300048908 Bacteria 8439
130 Ga0496108_0039697 3300048911 Bacteria 3922
131 Ga0496109_0048949 3300048912 Bacteria 3846
132 Ga0496112_0048987 3300048915 Bacteria 4140
133 Ga0496113_0011734 3300048916 Bacteria 5863
134 Ga0496118_0008873 3300048921 Bacteria 10276
135 Ga0496122_0004362 3300048925 Bacteria 17663
136 Ga0496125_0000075 3300048928 Bacteria 234414
137 Ga0496126_0069906 3300048929 Bacteria 3129
138 Ga0501047_0179972 3300049581 Bacteria 1981
139 Ga0501074_0127394 3300049590 Bacteria 1822
140 Ga0501238_011775 3300049671 Bacteria 1178
141 nmdc:mga00v17_83943_c1 3300050491 Bacteria 1993
142 nmdc:mga0n895_262474_c1 3300050512 Bacteria 1753
143 nmdc:mga0a205_148545_c1 3300050515 Bacteria 2244
144 Ga0495601_0001963 3300053077 Bacteria 11500
145 Ga0495612_0004243 3300053078 Bacteria 5951
146 Ga0495619_0003800 3300053085 Bacteria 9713
147 Ga0495619_0014781 3300053085 Bacteria 4932
148 Ga0500643_042000 3300053087 Bacteria 1340
149 Ga0500644_0001741 3300053088 Bacteria 5644
150 Ga0500608_000004 3300053122 Bacteria 108109
151 Ga0500658_0001332 3300053134 Bacteria 9999
152 Ga0500559_0000055 3300053136 Bacteria 89392
153 Ga0500559_0002897 3300053136 Bacteria 8639
154 Ga0500564_000167 3300053138 Bacteria 17431
155 Ga0500603_008481 3300053150 Bacteria 2281
156 Ga0500622_0003704 3300053156 Bacteria 10019
157 Ga0500609_000264 3300053731 Bacteria 7605
158 Ga0466962_0005460 3300061719 Bacteria 6110
159 Ga0466962_0050768 3300061719 Bacteria 1983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016566248 8016574939 191
2 3300049590 Ga0501074_0127394 Ga0501074_0127394_307_972 211
3 iso_pu_bacteria 8019586578 8019593485 214
4 3300046507 Ga0495606_0011990 Ga0495606_0011990_1352_2092 218
5 3300047472 Ga0495686_0027655 Ga0495686_0027655_850_1590 218
6 3300047472 Ga0495686_0052694 Ga0495686_0052694_1525_2265 218
7 3300053136 Ga0500559_0000055 Ga0500559_0000055_6276_7016 220
8 3300046520 Ga0495637_0003586 Ga0495637_0003586_2201_2956 223
9 3300046660 Ga0495625_0045316 Ga0495625_0045316_2225_2965 223
10 3300046528 Ga0495642_0147361 Ga0495642_0147361_318_1001 224
11 iso_pu_bacteria 2582581316 2585333130 235
12 3300046462 Ga0495651_0118051 Ga0495651_0118051_192_935 237
13 3300046529 Ga0495652_0047252 Ga0495652_0047252_673_1416 237
14 3300053078 Ga0495612_0004243 Ga0495612_0004243_3596_4339 237
15 3300053085 Ga0495619_0014781 Ga0495619_0014781_3645_4388 237
16 3300013250 Ga0171462_1054 Ga0171462_105413 239
17 3300031730 Ga0307516_10137400 Ga0307516_101374003 239
18 3300035724 Ga0373933_0337297 Ga0373933_0337297_169_897 239
19 3300044683 Ga0466965_0038776 Ga0466965_0038776_1579_2328 239
20 3300044684 Ga0466966_0046636 Ga0466966_0046636_126_854 239
21 3300046462 Ga0495651_0034011 Ga0495651_0034011_2150_2878 239
22 3300047472 Ga0495686_0061167 Ga0495686_0061167_1487_2215 239
23 3300048929 Ga0496126_0069906 Ga0496126_0069906_1753_2481 239
24 3300053087 Ga0500643_042000 Ga0500643_042000_61_786 239
25 3300053150 Ga0500603_008481 Ga0500603_008481_808_1536 239
26 iso_pu_bacteria 2802429296 2804844055 239
27 iso_pu_bacteria 8025413630 8025419456 239
28 3300014326 Ga0157380_10215870 Ga0157380_102158702 240
29 iso_pu_bacteria 8016522445 8016522550 240
30 iso_pu_bacteria 8016530956 8016530965 240
31 iso_pu_bacteria 8016539877 8016544469 240
32 iso_pu_bacteria 8016548790 8016548937 240
33 iso_pu_bacteria 8016557553 8016566191 240
34 iso_pu_bacteria 8016575299 8016575361 240
35 iso_pu_bacteria 8016595262 8016595362 240
36 iso_pu_bacteria 8019530166 8019530168 240
37 iso_pu_bacteria 8019586578 8019593403 240
38 3300005459 Ga0068867_100534672 Ga0068867_1005346721 241
39 3300005549 Ga0070704_100521055 Ga0070704_1005210551 241
40 3300005843 Ga0068860_100215585 Ga0068860_1002155852 241
41 3300005844 Ga0068862_100249628 Ga0068862_1002496282 241
42 3300006881 Ga0068865_100132032 Ga0068865_1001320323 241
43 3300025918 Ga0207662_10437563 Ga0207662_104375631 241
44 3300026089 Ga0207648_10574489 Ga0207648_105744892 241
45 3300028380 Ga0268265_10199069 Ga0268265_101990692 241
46 3300028381 Ga0268264_10114602 Ga0268264_101146023 241
47 3300035088 Ga0373940_0020756 Ga0373940_0020756_697_1431 241
48 3300035112 Ga0373932_0037755 Ga0373932_0037755_443_1177 241
49 3300035114 Ga0373939_0010972 Ga0373939_0010972_421_1155 241
50 3300035691 Ga0373931_0017630 Ga0373931_0017630_2774_3508 241
51 3300046455 Ga0495603_0237784 Ga0495603_0237784_179_913 241
52 3300046472 Ga0495580_0005633 Ga0495580_0005633_6968_7702 241
53 3300046684 Ga0495669_0022577 Ga0495669_0022577_994_1728 241
54 3300050512 nmdc:mga0n895_262474_c1 nmdc:mga0n895_262474_c1_812_1546 241
55 3300050515 nmdc:mga0a205_148545_c1 nmdc:mga0a205_148545_c1_889_1623 241
56 iso_pu_bacteria 2857504554 2857509040 241
57 3300006051 Ga0075364_10030361 Ga0075364_100303612 242
58 3300047320 Ga0495672_0084009 Ga0495672_0084009_155_913 242
59 3300048928 Ga0496125_0000075 Ga0496125_0000075_141712_142521 242
60 3300050491 nmdc:mga00v17_83943_c1 nmdc:mga00v17_83943_c1_243_971 242
61 iso_pu_bacteria 2643221545 2643750499 242
62 iso_pu_bacteria 2643221691 2644509594 242
63 iso_pu_bacteria 2758568016 2758640557 243
64 3300005434 Ga0070709_10020213 Ga0070709_100202134 244
65 3300013296 Ga0157374_10050460 Ga0157374_100504603 244
66 3300025929 Ga0207664_10026453 Ga0207664_100264533 244
67 3300028563 Ga0265319_1001416 Ga0265319_10014168 244
68 3300028573 Ga0265334_10013091 Ga0265334_100130913 244
69 3300028577 Ga0265318_10002923 Ga0265318_100029234 244
70 3300028794 Ga0307515_10107789 Ga0307515_101077893 244
71 3300028800 Ga0265338_10011037 Ga0265338_100110378 244
72 3300029957 Ga0265324_10050341 Ga0265324_100503412 244
73 3300031235 Ga0265330_10019223 Ga0265330_100192233 244
74 3300031240 Ga0265320_10023612 Ga0265320_100236123 244
75 3300031241 Ga0265325_10029870 Ga0265325_100298704 244
76 3300031251 Ga0265327_10023989 Ga0265327_100239893 244
77 3300031344 Ga0265316_10018290 Ga0265316_100182903 244
78 3300031711 Ga0265314_10042907 Ga0265314_100429073 244
79 3300044684 Ga0466966_0078747 Ga0466966_0078747_688_1452 244
80 3300044693 Ga0466961_0010167 Ga0466961_0010167_333_1097 244
81 3300044694 Ga0466963_0040620 Ga0466963_0040620_619_1383 244
82 3300044694 Ga0466963_0042223 Ga0466963_0042223_1264_2028 244
83 3300044694 Ga0466963_0329498 Ga0466963_0329498_300_1064 244
84 3300044706 Ga0466964_0005923 Ga0466964_0005923_763_1527 244
85 3300044706 Ga0466964_0047497 Ga0466964_0047497_489_1253 244
86 3300044719 Ga0466971_0000497 Ga0466971_0000497_6242_7006 244
87 3300044842 Ga0466957_0000254 Ga0466957_0000254_7401_8165 244
88 3300044842 Ga0466957_0079209 Ga0466957_0079209_433_1197 244
89 3300045049 Ga0466959_0003265 Ga0466959_0003265_5179_5943 244
90 3300045049 Ga0466959_0244896 Ga0466959_0244896_23_787 244
91 3300045836 Ga0466958_0010135 Ga0466958_0010135_966_1730 244
92 3300045976 Ga0466967_0028627 Ga0466967_0028627_767_1531 244
93 3300045976 Ga0466967_0175426 Ga0466967_0175426_315_1079 244
94 3300046460 Ga0495638_0000672 Ga0495638_0000672_31498_32232 244
95 3300046524 Ga0495648_0000120 Ga0495648_0000120_83537_84271 244
96 3300047469 Ga0495673_0000241 Ga0495673_0000241_66178_66912 244
97 3300048907 Ga0496104_0010625 Ga0496104_0010625_4256_5020 244
98 3300048908 Ga0496105_0007520 Ga0496105_0007520_4255_5019 244
99 3300048911 Ga0496108_0039697 Ga0496108_0039697_334_1098 244
100 3300048912 Ga0496109_0048949 Ga0496109_0048949_2704_3468 244
101 3300048915 Ga0496112_0048987 Ga0496112_0048987_2990_3754 244
102 3300048916 Ga0496113_0011734 Ga0496113_0011734_4714_5478 244
103 3300053088 Ga0500644_0001741 Ga0500644_0001741_1195_1929 244
104 3300053138 Ga0500564_000167 Ga0500564_000167_2396_3130 244
105 3300061719 Ga0466962_0005460 Ga0466962_0005460_4894_5658 244
106 3300061719 Ga0466962_0050768 Ga0466962_0050768_1035_1799 244
107 iso_pu_bacteria 2885318864 2885320062 244
108 3300005435 Ga0070714_100051969 Ga0070714_1000519694 245
109 3300005468 Ga0070707_100285905 Ga0070707_1002859052 245
110 3300005471 Ga0070698_100064365 Ga0070698_1000643652 245
111 3300013307 Ga0157372_10489435 Ga0157372_104894352 245
112 3300025929 Ga0207664_10075559 Ga0207664_100755593 245
113 3300036401 Ga0373937_0000661 Ga0373937_0000661_3345_4112 245
114 3300044694 Ga0466963_0015335 Ga0466963_0015335_627_1394 245
115 3300044694 Ga0466963_0089189 Ga0466963_0089189_647_1414 245
116 3300045976 Ga0466967_0014706 Ga0466967_0014706_2597_3364 245
117 3300045976 Ga0466967_0052645 Ga0466967_0052645_2770_3537 245
118 3300046454 Ga0495592_0000405 Ga0495592_0000405_14906_15673 245
119 3300046462 Ga0495651_0000038 Ga0495651_0000038_34443_35210 245
120 3300046463 Ga0495653_0002779 Ga0495653_0002779_4968_5735 245
121 3300046511 Ga0495608_0000602 Ga0495608_0000602_17232_17999 245
122 3300046516 Ga0495628_0000025 Ga0495628_0000025_120386_121153 245
123 3300046529 Ga0495652_0000088 Ga0495652_0000088_34463_35230 245
124 3300046536 Ga0495587_0000174 Ga0495587_0000174_34463_35230 245
125 3300046543 Ga0495645_0000024 Ga0495645_0000024_34438_35205 245
126 3300046559 Ga0495667_0095637 Ga0495667_0095637_683_1450 245
127 3300046675 Ga0495657_0004181 Ga0495657_0004181_717_1484 245
128 3300046678 Ga0495599_0000019 Ga0495599_0000019_20323_21090 245
129 3300046679 Ga0495623_0000375 Ga0495623_0000375_26680_27447 245
130 3300046680 Ga0495646_0007190 Ga0495646_0007190_5433_6200 245
131 3300046809 Ga0495600_0025311 Ga0495600_0025311_718_1485 245
132 3300047317 Ga0495604_0000128 Ga0495604_0000128_28516_29283 245
133 3300047322 Ga0495680_0002445 Ga0495680_0002445_4584_5351 245
134 3300047444 Ga0495675_0000007 Ga0495675_0000007_127431_128198 245
135 3300048088 Ga0495602_0001545 Ga0495602_0001545_10836_11603 245
136 3300053077 Ga0495601_0001963 Ga0495601_0001963_5921_6688 245
137 3300053085 Ga0495619_0003800 Ga0495619_0003800_5236_6003 245
138 3300053122 Ga0500608_000004 Ga0500608_000004_1803_2540 245
139 3300053136 Ga0500559_0002897 Ga0500559_0002897_357_1094 245
140 3300053156 Ga0500622_0003704 Ga0500622_0003704_4720_5457 245
141 3300025295 Ga0209564_1015098 Ga0209564_10150984 246
142 3300025298 Ga0209050_1029049 Ga0209050_10290493 246
143 3300044684 Ga0466966_0007084 Ga0466966_0007084_6590_7384 246
144 3300045049 Ga0466959_0010536 Ga0466959_0010536_713_1507 246
145 3300046519 Ga0495632_0003958 Ga0495632_0003958_83_823 246
146 3300046519 Ga0495632_0004510 Ga0495632_0004510_775_1515 246
147 3300046530 Ga0495654_0000116 Ga0495654_0000116_66253_66993 246
148 3300046530 Ga0495654_0178709 Ga0495654_0178709_81_821 246
149 3300046660 Ga0495625_0004615 Ga0495625_0004615_7153_7893 246
150 3300046660 Ga0495625_0004722 Ga0495625_0004722_3470_4222 246
151 3300047320 Ga0495672_0003601 Ga0495672_0003601_3039_3779 246
152 3300049581 Ga0501047_0179972 Ga0501047_0179972_295_1095 246
153 3300049671 Ga0501238_011775 Ga0501238_011775_285_1037 246
154 3300053134 Ga0500658_0001332 Ga0500658_0001332_183_923 246
155 3300053731 Ga0500609_000264 Ga0500609_000264_6680_7420 246
156 iso_pu_bacteria 2516143018 2516210404 246
157 iso_pu_bacteria 2554235003 2554249185 246
158 iso_pu_bacteria 3004334049 3004338540 246
159 3300005467 Ga0070706_100236692 Ga0070706_1002366922 247
160 3300005614 Ga0068856_100324668 Ga0068856_1003246682 247
161 3300013100 Ga0157373_10003860 Ga0157373_100038603 247
162 3300028800 Ga0265338_10004780 Ga0265338_100047803 247
163 3300035692 Ga0373935_0015297 Ga0373935_0015297_674_1486 247
164 3300045976 Ga0466967_0068090 Ga0466967_0068090_2180_2989 247
165 3300046473 Ga0495582_0103256 Ga0495582_0103256_518_1303 247
166 3300046530 Ga0495654_0095684 Ga0495654_0095684_335_1120 247
167 3300046683 Ga0495658_0018664 Ga0495658_0018664_2074_2859 247
168 3300047472 Ga0495686_0000021 Ga0495686_0000021_258387_259184 247
169 3300048925 Ga0496122_0004362 Ga0496122_0004362_7411_8184 247
170 iso_pu_bacteria 2582581280 2585153258 247
171 iso_pu_bacteria 2582581293 2585196947 247
172 iso_pu_bacteria 2599185240 2599748475 247
173 iso_pu_bacteria 2599185355 2600210387 247
174 iso_pu_bacteria 2675903129 2676746717 247
175 iso_pu_bacteria 2818991435 2819539261 247
176 iso_pu_bacteria 2818991454 2819648224 247
177 iso_pu_bacteria 2870068957 2870076190 247
178 3300009093 Ga0105240_10002532 Ga0105240_100025322 248
179 3300013296 Ga0157374_10440348 Ga0157374_104403481 248
180 3300015262 Ga0182007_10001160 Ga0182007_100011607 248
181 3300025913 Ga0207695_10001423 Ga0207695_100014232 248
182 3300048921 Ga0496118_0008873 Ga0496118_0008873_4183_4992 250
183 3300003775 Ga0055524_1049586 Ga0055524_10495862 251
184 3300005467 Ga0070706_100045963 Ga0070706_1000459634 251
185 3300005471 Ga0070698_100020490 Ga0070698_1000204903 251
186 3300005471 Ga0070698_100038504 Ga0070698_1000385045 251
187 3300025299 Ga0209256_1000353 Ga0209256_100035312 251
188 3300025910 Ga0207684_10038741 Ga0207684_100387414 251
189 3300025922 Ga0207646_10024925 Ga0207646_100249253 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

62

223

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9785 8 246
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9755 6 246
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9727 9 246
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9676 6 246
1b0u-assembly1.cif.gz_A-2 atp-binding subunit of the histidine permease from salmonella typhimurium 0.9671 8 247
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.972 9 246 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9601 9 246 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9594 9 244 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 6 226 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9392 19 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y8S784-F1-model_v4 deleted 0.9878 98 247
AF-A0A2S6DDZ0-F1-model_v4 deleted 0.9856 144 240
AF-A0A1A9R3F0-F1-model_v4 ABC transporter ATP-binding protein 0.9848 9 248 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A7W9B063-F1-model_v4 Polar amino acid transport system ATP-binding protein 0.9837 6 246 GO:0005524
GO:0005886
GO:0015424
GO:0016887
AF-A0A7X7G2J4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9821 9 246 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.74 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map