F290795

General Info

Members Datasets Scaffolds Average Seq Length
189 131 378 489

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100047409|Ga0075436_1000474093
Length 552
Sequence MRVICVAPRLEARDTVPSGIATIEVSMLSRREFTISVLGAAAAATQFAHAATSQTAGRSAPKPAATGGGPDSLAGLTLAEASARLDAGTVTSVDLVNACLARIDVYNPKVNAFITVTREQALAQARALDAERRAGKVRGPLHGIPIALKDNIDTAGVRTTAASAVFDDRVPAEDAEVVRRLAAAGAVIVGKTNLHEFAFGGTSATSYYGPVRNPWALERNPGGSSGXSAAAVATDLCYGALGTDTGGSIRTPASYCSVVGLKPTYGLVSIRGIIPLTLSLDHCGPITRSVMDAALLLNALAGYDRLDIASVEHAPEDYVAALKQPVGGLRIGVARAPFFDLLDADVAKVVDEALKVLAGLTTTMTDTVLPTTRDITLPGETYAYHENMFTRMSGRYMIPTRRALQNGADAKAAAYIQGRWRLELLRRTIDDAFKNVDLVVLPTRRRTPRTVDASIKREESDVPRNPELENTGAFNIYGIPAISIPCGFTSKGLPVGLMIAGPRFSEGRVLALAHAFEQATEFHTKKPPIRPDTPVPPLAATDEDATPPKKSS

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 92.06
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100047409 3300006914 Bacteria 2964
2 rootH2_10068433 3300003320 Bacteria 6430
3 Ga0070676_10066369 3300005328 Bacteria 2156
4 Ga0070683_100061297 3300005329 Bacteria 3498
5 Ga0070690_100024148 3300005330 Bacteria 3738
6 Ga0070670_100048250 3300005331 Bacteria 3664
7 Ga0070670_100122234 3300005331 Bacteria 2246
8 Ga0070666_10064702 3300005335 Bacteria 2480
9 Ga0070680_100138231 3300005336 Bacteria 2042
10 Ga0068868_100006716 3300005338 Bacteria 8165
11 Ga0070691_10001173 3300005341 Bacteria 10950
12 Ga0070669_100033756 3300005353 Bacteria 3702
13 Ga0070671_100156199 3300005355 Bacteria 1927
14 Ga0070674_100020591 3300005356 Bacteria 4219
15 Ga0070667_100014058 3300005367 Bacteria 6615
16 Ga0070714_100032395 3300005435 Bacteria 4362
17 Ga0070713_100001199 3300005436 Bacteria 16556
18 Ga0070711_100064293 3300005439 Bacteria 2563
19 Ga0070700_100003310 3300005441 Bacteria 8310
20 Ga0070700_100078059 3300005441 Bacteria 2131
21 Ga0070694_100015558 3300005444 Bacteria 4780
22 Ga0070708_100003417 3300005445 Bacteria 12430
23 Ga0070663_100002767 3300005455 Bacteria 9947
24 Ga0070663_100059282 3300005455 Bacteria 2751
25 Ga0070681_10011044 3300005458 Bacteria 8929
26 Ga0068867_100003579 3300005459 Bacteria 10928
27 Ga0070706_100000434 3300005467 Bacteria 50174
28 Ga0070699_100001567 3300005518 Bacteria 20907
29 Ga0070679_100044241 3300005530 Bacteria 4436
30 Ga0070697_100002325 3300005536 Bacteria 14606
31 Ga0070697_100021303 3300005536 Bacteria 5135
32 Ga0070695_100004467 3300005545 Bacteria 8219
33 Ga0070695_100009361 3300005545 Bacteria 5827
34 Ga0070696_100018799 3300005546 Bacteria 4677
35 Ga0068855_100003594 3300005563 Bacteria 18940
36 Ga0068855_100046663 3300005563 Bacteria 5120
37 Ga0070664_100002587 3300005564 Bacteria 14599
38 Ga0068857_100012912 3300005577 Bacteria 7277
39 Ga0068854_100006424 3300005578 Bacteria 7476
40 Ga0070702_100025150 3300005615 Bacteria 3187
41 Ga0068859_100236988 3300005617 Bacteria 1914
42 Ga0068864_100012292 3300005618 Bacteria 7076
43 Ga0081455_10055232 3300005937 Bacteria 3379
44 Ga0081538_10002702 3300005981 Bacteria 17059
45 Ga0081538_10010929 3300005981 Bacteria 7396
46 Ga0081538_10032658 3300005981 Bacteria 3481
47 Ga0081539_10000017 3300005985 Bacteria 375107
48 Ga0081539_10051843 3300005985 Bacteria 2309
49 Ga0075428_100043172 3300006844 Bacteria 4957
50 Ga0075430_100013049 3300006846 Bacteria 7081
51 Ga0075434_100015820 3300006871 Bacteria 7243
52 Ga0075434_100021717 3300006871 Bacteria 6243
53 Ga0075429_100014462 3300006880 Bacteria 6840
54 Ga0075436_100001557 3300006914 Bacteria 15650
55 Ga0097620_100236987 3300006931 Bacteria 1914
56 Ga0075435_100000054 3300007076 Bacteria 58537
57 Ga0075435_100020622 3300007076 Bacteria 5055
58 Ga0075435_100060083 3300007076 Bacteria 3081
59 Ga0075435_100076041 3300007076 Unclassified 2751
60 Ga0105240_10001879 3300009093 Bacteria 34906
61 Ga0105240_10082552 3300009093 Bacteria 3946
62 Ga0105240_10275161 3300009093 Bacteria 1937
63 Ga0111539_10021230 3300009094 Bacteria 7995
64 Ga0111539_10059855 3300009094 Bacteria 4515
65 Ga0111539_10069614 3300009094 Bacteria 4155
66 Ga0114129_10003300 3300009147 Bacteria 22656
67 Ga0114129_10017326 3300009147 Bacteria 10255
68 Ga0114129_10027994 3300009147 Bacteria 7982
69 Ga0114129_10098457 3300009147 Bacteria 4048
70 Ga0114129_10138838 3300009147 Bacteria 3333
71 Ga0114129_10174134 3300009147 Bacteria 2932
72 Ga0114129_10386651 3300009147 Bacteria 1847
73 Ga0105243_10021034 3300009148 Bacteria 4951
74 Ga0105248_10004398 3300009177 Bacteria 15595
75 Ga0105248_10014168 3300009177 Bacteria 8778
76 Ga0105248_10067025 3300009177 Bacteria 4030
77 Ga0105237_10018758 3300009545 Bacteria 7153
78 Ga0105238_10029505 3300009551 Bacteria 5587
79 Ga0105249_10061582 3300009553 Bacteria 3444
80 Ga0105239_10043198 3300010375 Unclassified 4939
81 Ga0157370_10064411 3300013104 Bacteria 3470
82 Ga0157370_10130933 3300013104 Bacteria 2340
83 Ga0157369_10028101 3300013105 Bacteria 6227
84 Ga0163162_10102879 3300013306 Bacteria 2950
85 Ga0157372_10098195 3300013307 Bacteria 3341
86 Ga0157372_10355608 3300013307 Bacteria 1706
87 Ga0163163_10003788 3300014325 Bacteria 12882
88 Ga0163163_10007597 3300014325 Bacteria 9575
89 Ga0163163_10022225 3300014325 Bacteria 6001
90 Ga0163163_10060295 3300014325 Bacteria 3756
91 Ga0157380_10017519 3300014326 Bacteria 5302
92 Ga0213875_10000806 3300021388 Bacteria 23422
93 Ga0213875_10028509 3300021388 Bacteria 2651
94 Ga0207680_10084119 3300025903 Bacteria 2007
95 Ga0207705_10000558 3300025909 Bacteria 31252
96 Ga0207684_10000966 3300025910 Bacteria 32224
97 Ga0207695_10004719 3300025913 Bacteria 18460
98 Ga0207695_10089197 3300025913 Bacteria 3101
99 Ga0207671_10082973 3300025914 Bacteria 2406
100 Ga0207659_10007776 3300025926 Bacteria 6621
101 Ga0207700_10000916 3300025928 Bacteria 16916
102 Ga0207664_10012212 3300025929 Bacteria 6138
103 Ga0207644_10076881 3300025931 Bacteria 2457
104 Ga0207706_10079321 3300025933 Bacteria 2887
105 Ga0207669_10008659 3300025937 Bacteria 4790
106 Ga0207704_10058430 3300025938 Bacteria 2375
107 Ga0207691_10008439 3300025940 Bacteria 9892
108 Ga0207679_10002772 3300025945 Bacteria 10853
109 Ga0207667_10020835 3300025949 Bacteria 7280
110 Ga0207667_10043132 3300025949 Bacteria 4787
111 Ga0207668_10059035 3300025972 Bacteria 2685
112 Ga0207640_10042884 3300025981 Bacteria 2888
113 Ga0207678_10029031 3300026067 Bacteria 4827
114 Ga0207708_10000880 3300026075 Bacteria 22549
115 Ga0207708_10077884 3300026075 Bacteria 2545
116 Ga0207702_10055121 3300026078 Bacteria 3371
117 Ga0207676_10115321 3300026095 Bacteria 2255
118 Ga0207674_10002945 3300026116 Bacteria 21147
119 Ga0207428_10005292 3300027907 Bacteria 12045
120 Ga0207428_10023082 3300027907 Bacteria 5236
121 Ga0207428_10155012 3300027907 Bacteria 1742
122 Ga0307511_10002832 3300030521 Bacteria 18016
123 Ga0314311_1109478 3300030733 Bacteria 2692
124 Ga0265314_10016317 3300031711 Bacteria 5870
125 Ga0265342_10041011 3300031712 Bacteria 2805
126 Ga0307406_10017688 3300031901 Bacteria 4154
127 Ga0307409_100083536 3300031995 Bacteria 2590
128 Ga0373954_0004997 3300035118 Bacteria 5729
129 Ga0373956_0053664 3300035119 Bacteria 1815
130 Ga0373943_0029061 3300035170 Bacteria 2610
131 Ga0373955_0029673 3300035172 Bacteria 2847
132 Ga0373935_0033239 3300035692 Bacteria 3209
133 Ga0373927_0010812 3300035695 Bacteria 6081
134 Ga0373933_0059813 3300035724 Bacteria 2296
135 Ga0373937_0080380 3300036401 Bacteria 3014
136 Ga0373925_0055843 3300037068 Bacteria 2957
137 Ga0373925_0167767 3300037068 Bacteria 1732
138 Ga0436364_0022724 3300037853 Bacteria 40434
139 Ga0436364_0328145 3300037853 Bacteria 88179
140 Ga0436364_0514631 3300037853 Bacteria 102563
141 Ga0436364_0842524 3300037853 Bacteria 10160
142 Ga0436364_1224679 3300037853 Bacteria 3280
143 Ga0436365_1069678 3300039437 Bacteria 8813
144 Ga0495638_0041236 3300046460 Bacteria 2922
145 Ga0495651_0006481 3300046462 Bacteria 8946
146 Ga0495580_0001079 3300046472 Bacteria 23942
147 Ga0495582_0025787 3300046473 Bacteria 3221
148 Ga0495585_0017353 3300046492 Bacteria 4159
149 Ga0495628_0066655 3300046516 Bacteria 2814
150 Ga0495652_0035828 3300046529 Bacteria 4317
151 Ga0495667_0104956 3300046559 Bacteria 1827
152 Ga0495625_0120143 3300046660 Unclassified 1789
153 Ga0495647_0000540 3300046681 Bacteria 11112
154 Ga0495658_0007146 3300046683 Bacteria 5518
155 Ga0495675_0012435 3300047444 Bacteria 5358
156 Ga0495684_0047545 3300047471 Bacteria 3281
157 Ga0496102_0122948 3300048905 Bacteria 2425
158 Ga0496104_0030275 3300048907 Bacteria 5029
159 Ga0496108_0022099 3300048911 Bacteria 5230
160 Ga0496117_0045986 3300048920 Bacteria 3145
161 Ga0496118_0003808 3300048921 Bacteria 18588
162 Ga0501039_0141865 3300049575 Bacteria 1887
163 Ga0501079_0029078 3300049741 Bacteria 4243
164 nmdc:mga05p37_145717_c1 3300050507 Bacteria 2900
165 nmdc:mga05p37_16869_c2 3300050507 Bacteria 4513
166 nmdc:mga05p37_3088_c1 3300050507 Bacteria 19346
167 nmdc:mga05p37_65304_c1 3300050507 Unclassified 4477
168 nmdc:mga09592_13578_c1 3300050508 Bacteria 6654
169 nmdc:mga09592_32784_c1 3300050508 Bacteria 4331
170 nmdc:mga06r32_281413_c1 3300050510 Bacteria 1650
171 nmdc:mga06r32_53654_c1 3300050510 Unclassified 3862
172 nmdc:mga06r32_7138_c1 3300050510 Bacteria 10065
173 nmdc:mga06r32_75353_c1 3300050510 Bacteria 3274
174 nmdc:mga08y16_15012_c1 3300050511 Bacteria 8148
175 nmdc:mga08y16_178564_c1 3300050511 Bacteria 2205
176 nmdc:mga0n895_170752_c1 3300050512 Bacteria 2206
177 nmdc:mga0n895_1792_c1 3300050512 Bacteria 16311
178 nmdc:mga0n895_257963_c1 3300050512 Bacteria 1769
179 nmdc:mga0n895_2676_c1 3300050512 Bacteria 14058
180 nmdc:mga0n895_35722_c1 3300050512 Bacteria 4794
181 nmdc:mga0n895_62819_c1 3300050512 Bacteria 3672
182 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
183 nmdc:mga08x19_15973_c1 3300050514 Bacteria 4574
184 nmdc:mga08x19_33589_c1 3300050514 Bacteria 3238
185 nmdc:mga08x19_552_c1 3300050514 Bacteria 24509
186 nmdc:mga0a205_80326_c1 3300050515 Bacteria 3151
187 nmdc:mga0a205_96179_c1 3300050515 Bacteria 2860
188 Ga0495595_0045468 3300053084 Bacteria 2020
189 Ga0530510_0016447 3300061734 Bacteria 5236
190 Ga0075436_100047409
191 rootH2_10068433
192 Ga0070676_10066369
193 Ga0070683_100061297
194 Ga0070690_100024148
195 Ga0070670_100048250
196 Ga0070670_100122234
197 Ga0070666_10064702
198 Ga0070680_100138231
199 Ga0068868_100006716
200 Ga0070691_10001173
201 Ga0070669_100033756
202 Ga0070671_100156199
203 Ga0070674_100020591
204 Ga0070667_100014058
205 Ga0070714_100032395
206 Ga0070713_100001199
207 Ga0070711_100064293
208 Ga0070700_100003310
209 Ga0070700_100078059
210 Ga0070694_100015558
211 Ga0070708_100003417
212 Ga0070663_100002767
213 Ga0070663_100059282
214 Ga0070681_10011044
215 Ga0068867_100003579
216 Ga0070706_100000434
217 Ga0070699_100001567
218 Ga0070679_100044241
219 Ga0070697_100002325
220 Ga0070697_100021303
221 Ga0070695_100004467
222 Ga0070695_100009361
223 Ga0070696_100018799
224 Ga0068855_100003594
225 Ga0068855_100046663
226 Ga0070664_100002587
227 Ga0068857_100012912
228 Ga0068854_100006424
229 Ga0070702_100025150
230 Ga0068859_100236988
231 Ga0068864_100012292
232 Ga0081455_10055232
233 Ga0081538_10002702
234 Ga0081538_10010929
235 Ga0081538_10032658
236 Ga0081539_10000017
237 Ga0081539_10051843
238 Ga0075428_100043172
239 Ga0075430_100013049
240 Ga0075434_100015820
241 Ga0075434_100021717
242 Ga0075429_100014462
243 Ga0075436_100001557
244 Ga0097620_100236987
245 Ga0075435_100000054
246 Ga0075435_100020622
247 Ga0075435_100060083
248 Ga0075435_100076041
249 Ga0105240_10001879
250 Ga0105240_10082552
251 Ga0105240_10275161
252 Ga0111539_10021230
253 Ga0111539_10059855
254 Ga0111539_10069614
255 Ga0114129_10003300
256 Ga0114129_10017326
257 Ga0114129_10027994
258 Ga0114129_10098457
259 Ga0114129_10138838
260 Ga0114129_10174134
261 Ga0114129_10386651
262 Ga0105243_10021034
263 Ga0105248_10004398
264 Ga0105248_10014168
265 Ga0105248_10067025
266 Ga0105237_10018758
267 Ga0105238_10029505
268 Ga0105249_10061582
269 Ga0105239_10043198
270 Ga0157370_10064411
271 Ga0157370_10130933
272 Ga0157369_10028101
273 Ga0163162_10102879
274 Ga0157372_10098195
275 Ga0157372_10355608
276 Ga0163163_10003788
277 Ga0163163_10007597
278 Ga0163163_10022225
279 Ga0163163_10060295
280 Ga0157380_10017519
281 Ga0213875_10000806
282 Ga0213875_10028509
283 Ga0207680_10084119
284 Ga0207705_10000558
285 Ga0207684_10000966
286 Ga0207695_10004719
287 Ga0207695_10089197
288 Ga0207671_10082973
289 Ga0207659_10007776
290 Ga0207700_10000916
291 Ga0207664_10012212
292 Ga0207644_10076881
293 Ga0207706_10079321
294 Ga0207669_10008659
295 Ga0207704_10058430
296 Ga0207691_10008439
297 Ga0207679_10002772
298 Ga0207667_10020835
299 Ga0207667_10043132
300 Ga0207668_10059035
301 Ga0207640_10042884
302 Ga0207678_10029031
303 Ga0207708_10000880
304 Ga0207708_10077884
305 Ga0207702_10055121
306 Ga0207676_10115321
307 Ga0207674_10002945
308 Ga0207428_10005292
309 Ga0207428_10023082
310 Ga0207428_10155012
311 Ga0307511_10002832
312 Ga0314311_1109478
313 Ga0265314_10016317
314 Ga0265342_10041011
315 Ga0307406_10017688
316 Ga0307409_100083536
317 Ga0373954_0004997
318 Ga0373956_0053664
319 Ga0373943_0029061
320 Ga0373955_0029673
321 Ga0373935_0033239
322 Ga0373927_0010812
323 Ga0373933_0059813
324 Ga0373937_0080380
325 Ga0373925_0055843
326 Ga0373925_0167767
327 Ga0436364_0022724
328 Ga0436364_0328145
329 Ga0436364_0514631
330 Ga0436364_0842524
331 Ga0436364_1224679
332 Ga0436365_1069678
333 Ga0495638_0041236
334 Ga0495651_0006481
335 Ga0495580_0001079
336 Ga0495582_0025787
337 Ga0495585_0017353
338 Ga0495628_0066655
339 Ga0495652_0035828
340 Ga0495667_0104956
341 Ga0495625_0120143
342 Ga0495647_0000540
343 Ga0495658_0007146
344 Ga0495675_0012435
345 Ga0495684_0047545
346 Ga0496102_0122948
347 Ga0496104_0030275
348 Ga0496108_0022099
349 Ga0496117_0045986
350 Ga0496118_0003808
351 Ga0501039_0141865
352 Ga0501079_0029078
353 nmdc:mga05p37_145717_c1
354 nmdc:mga05p37_16869_c2
355 nmdc:mga05p37_3088_c1
356 nmdc:mga05p37_65304_c1
357 nmdc:mga09592_13578_c1
358 nmdc:mga09592_32784_c1
359 nmdc:mga06r32_281413_c1
360 nmdc:mga06r32_53654_c1
361 nmdc:mga06r32_7138_c1
362 nmdc:mga06r32_75353_c1
363 nmdc:mga08y16_15012_c1
364 nmdc:mga08y16_178564_c1
365 nmdc:mga0n895_170752_c1
366 nmdc:mga0n895_1792_c1
367 nmdc:mga0n895_257963_c1
368 nmdc:mga0n895_2676_c1
369 nmdc:mga0n895_35722_c1
370 nmdc:mga0n895_62819_c1
371 nmdc:mga0rr50_5_c1
372 nmdc:mga08x19_15973_c1
373 nmdc:mga08x19_33589_c1
374 nmdc:mga08x19_552_c1
375 nmdc:mga0a205_80326_c1
376 nmdc:mga0a205_96179_c1
377 Ga0495595_0045468
378 Ga0530510_0016447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

94

510

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c62-assembly1.cif.gz_A an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. 0.9017 47 506
1o9n-assembly1.cif.gz_B crystal structure of the k62a mutant of malonamidase e2 from bradyrhizobium japonicum 0.8975 47 505
6c6g-assembly1.cif.gz_B-2 an unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. inhibitor bound complex. 0.8931 47 507
1o9p-assembly1.cif.gz_B crystal structure of the s131a mutant of malonamidase e2 complexed with malonate from bradyrhizobium japonicum 0.8921 47 507
2dc0-assembly1.cif.gz_B crystal structure of amidase 0.8896 47 505
ID Description Score Start End Superfamily
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9348 44 278 3.90.1300.10
af_P9WQ93_21_468_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9262 49 506 3.90.1300.10
af_P9WQ93_21_468_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9182 49 506 3.90.1300.10
4gyrA01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9039 46 504 3.90.1300.10
6c6gA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8988 47 507 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A843SP36-F1-model_v4 Amidase domain-containing protein 0.9927 46 199 GO:0003824
AF-A0A6I3AVD0-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.9916 45 209 GO:0016740
AF-A0A6M1ZBX2-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7) 0.9914 46 223 GO:0016740
GO:0050567
AF-A0A382BA98-F1-model_v4 Amidase domain-containing protein 0.9904 41 284 GO:0003824
AF-A0A3C0SA14-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA 0.9904 45 284 GO:0016740

Map