F290501

General Info

Members Datasets Scaffolds Average Seq Length
189 120 378 141

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100008359|Ga0070714_1000083594
Length 155
Sequence VRLIVQRVAEAAVSWDSGAGPQRRQIGRGLAILAGAGAGDTRADAERLARKVAELRIFADNQGRSNLSLLDVGGAALVVSQFTLYGDLSGGRRPSFIAAGDPEAAARQIEDFVGALRSMQVPVETGEFGAQMRFEIANDGPVTFALSTDDWVTRV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
69 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 2643221591 Devosia sp. Root685 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 2.65
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 8.47
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 4.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100008359 3300005435 Bacteria 8074
2 Ga0070658_10005331 3300005327 Bacteria 10441
3 Ga0070658_10011862 3300005327 Bacteria 6997
4 Ga0070658_10152296 3300005327 Bacteria 1936
5 Ga0070683_100098170 3300005329 Bacteria 2756
6 Ga0070683_100123529 3300005329 Bacteria 2446
7 Ga0070680_100031329 3300005336 Bacteria 4275
8 Ga0070660_100037897 3300005339 Bacteria 3656
9 Ga0070660_100192626 3300005339 Bacteria 1652
10 Ga0070661_100432264 3300005344 Bacteria 1045
11 Ga0070661_100473535 3300005344 Bacteria 999
12 Ga0070671_100187244 3300005355 Bacteria 1754
13 Ga0070667_101191791 3300005367 Bacteria 713
14 Ga0070714_100021689 3300005435 Bacteria 5257
15 Ga0070714_100089368 3300005435 Bacteria 2697
16 Ga0070714_100184034 3300005435 Bacteria 1902
17 Ga0070713_100185955 3300005436 Bacteria 1870
18 Ga0070694_100029508 3300005444 Bacteria 3580
19 Ga0070663_100798358 3300005455 Bacteria 809
20 Ga0070681_10057065 3300005458 Bacteria 3885
21 Ga0070681_10195915 3300005458 Bacteria 1939
22 Ga0070679_100039584 3300005530 Bacteria 4685
23 Ga0070684_100172133 3300005535 Bacteria 1967
24 Ga0070684_102074915 3300005535 Bacteria 536
25 Ga0070696_101563109 3300005546 Bacteria 566
26 Ga0068855_100005352 3300005563 Bacteria 15656
27 Ga0068855_100041672 3300005563 Bacteria 5441
28 Ga0068855_100090563 3300005563 Bacteria 3530
29 Ga0068855_100122723 3300005563 Bacteria 2972
30 Ga0068855_101664341 3300005563 Bacteria 651
31 Ga0068857_100046235 3300005577 Bacteria 3863
32 Ga0070717_10006696 3300006028 Bacteria 8499
33 Ga0070712_100574263 3300006175 Bacteria 952
34 Ga0105240_10249542 3300009093 Bacteria 2053
35 Ga0105240_10276159 3300009093 Bacteria 1933
36 Ga0114129_11787443 3300009147 Bacteria 748
37 Ga0105248_10356902 3300009177 Bacteria 1646
38 Ga0105238_11411868 3300009551 Bacteria 723
39 Ga0157370_10047242 3300013104 Bacteria 4127
40 Ga0157370_10427163 3300013104 Bacteria 1219
41 Ga0157369_10006129 3300013105 Bacteria 13955
42 Ga0157372_10238607 3300013307 Unclassified 2109
43 Ga0157376_10831031 3300014969 Bacteria 938
44 Ga0197907_11073875 3300020069 Bacteria 5132
45 Ga0206356_11144853 3300020070 Bacteria 677
46 Ga0206356_11351312 3300020070 Bacteria 4885
47 Ga0206354_10137113 3300020081 Bacteria 6399
48 Ga0206353_10612199 3300020082 Bacteria 2703
49 Ga0209676_1031011 3300025292 Bacteria 1626
50 Ga0207705_10005937 3300025909 Bacteria 9083
51 Ga0207705_10024292 3300025909 Bacteria 4327
52 Ga0207707_10019912 3300025912 Bacteria 5857
53 Ga0207707_10148954 3300025912 Bacteria 2046
54 Ga0207693_10137945 3300025915 Bacteria 1918
55 Ga0207660_10081572 3300025917 Bacteria 2377
56 Ga0207660_10440614 3300025917 Bacteria 1053
57 Ga0207657_10001972 3300025919 Bacteria 22152
58 Ga0207657_10125442 3300025919 Bacteria 2109
59 Ga0207657_10246557 3300025919 Bacteria 1425
60 Ga0207649_10144258 3300025920 Bacteria 1633
61 Ga0207652_10008538 3300025921 Bacteria 8245
62 Ga0207646_10205359 3300025922 Bacteria 1780
63 Ga0207694_10961188 3300025924 Bacteria 723
64 Ga0207700_10082845 3300025928 Bacteria 2509
65 Ga0207664_10000089 3300025929 Bacteria 85149
66 Ga0207664_10022035 3300025929 Bacteria 4749
67 Ga0207664_10648242 3300025929 Unclassified 949
68 Ga0207711_10874278 3300025941 Bacteria 836
69 Ga0207661_10008803 3300025944 Bacteria 7221
70 Ga0207661_10175862 3300025944 Bacteria 1866
71 Ga0207667_10113701 3300025949 Bacteria 2791
72 Ga0207667_10126049 3300025949 Bacteria 2637
73 Ga0207667_10289336 3300025949 Bacteria 1674
74 Ga0207667_10393462 3300025949 Bacteria 1411
75 Ga0207678_10264851 3300026067 Bacteria 1473
76 Ga0207702_10085551 3300026078 Bacteria 2748
77 Ga0207674_10075017 3300026116 Bacteria 3392
78 Ga0207698_12244016 3300026142 Bacteria 558
79 Ga0265334_10093814 3300028573 Bacteria 1093
80 Ga0265322_10062040 3300028654 Bacteria 1060
81 Ga0265322_10081705 3300028654 Bacteria 917
82 Ga0265338_10058813 3300028800 Bacteria 3390
83 Ga0265338_10178836 3300028800 Bacteria 1619
84 Ga0265332_10046707 3300031238 Bacteria 1865
85 Ga0265329_10014248 3300031242 Bacteria 2811
86 Ga0265339_10054702 3300031249 Bacteria 2167
87 Ga0265327_10071294 3300031251 Bacteria 1738
88 Ga0265316_10044788 3300031344 Bacteria 3516
89 Ga0265316_10157605 3300031344 Bacteria 1698
90 Ga0265316_10552584 3300031344 Bacteria 819
91 Ga0265313_10005262 3300031595 Bacteria 9580
92 Ga0265314_10062187 3300031711 Bacteria 2539
93 Ga0265314_10109686 3300031711 Bacteria 1756
94 Ga0307406_10081983 3300031901 Bacteria 2147
95 Ga0395899_0177492 3300037312 Bacteria 1497
96 Ga0395900_0003795 3300037418 Bacteria 16180
97 Ga0395900_0079448 3300037418 Bacteria 3371
98 Ga0395900_0080951 3300037418 Bacteria 3337
99 Ga0395898_0001107 3300037466 Bacteria 41584
100 Ga0395898_0041492 3300037466 Bacteria 4545
101 Ga0395898_1634334 3300037466 Bacteria 568
102 Ga0395905_0005221 3300037471 Bacteria 13294
103 Ga0395905_0535981 3300037471 Bacteria 1071
104 Ga0395901_0001778 3300038443 Bacteria 22243
105 Ga0395901_0009580 3300038443 Bacteria 9830
106 Ga0395901_0566907 3300038443 Bacteria 1149
107 Ga0395901_0579767 3300038443 Bacteria 1133
108 Ga0395901_1107041 3300038443 Bacteria 762
109 Ga0436363_1336247 3300039450 Unclassified 510
110 Ga0439454_003564 3300042011 Bacteria 1742
111 Ga0450920_068296 3300042122 Bacteria 722
112 Ga0466966_0015990 3300044684 Bacteria 4961
113 Ga0466961_0002757 3300044693 Bacteria 10933
114 Ga0466961_0138647 3300044693 Bacteria 1523
115 Ga0466963_0073128 3300044694 Bacteria 2311
116 Ga0466963_0101345 3300044694 Bacteria 1971
117 Ga0466963_0141818 3300044694 Bacteria 1665
118 Ga0466963_0686870 3300044694 Bacteria 722
119 Ga0466964_0029898 3300044706 Bacteria 2153
120 Ga0466964_0095488 3300044706 Bacteria 1301
121 Ga0466964_0190692 3300044706 Bacteria 978
122 Ga0466964_0243335 3300044706 Bacteria 883
123 Ga0466964_0678124 3300044706 Unclassified 572
124 Ga0466968_0625240 3300044735 Bacteria 545
125 Ga0466957_0059861 3300044842 Bacteria 2335
126 Ga0466957_0187145 3300044842 Bacteria 1354
127 Ga0466957_0441853 3300044842 Bacteria 895
128 Ga0466960_0172523 3300044901 Bacteria 1168
129 Ga0466959_0017099 3300045049 Bacteria 5311
130 Ga0466959_0044141 3300045049 Bacteria 3285
131 Ga0466958_0001260 3300045836 Bacteria 11862
132 Ga0466967_0003721 3300045976 Bacteria 10050
133 Ga0466967_0007599 3300045976 Bacteria 7838
134 Ga0466967_0019791 3300045976 Bacteria 5422
135 Ga0466967_0084319 3300045976 Bacteria 2875
136 Ga0466967_0183318 3300045976 Bacteria 1975
137 Ga0466967_0796197 3300045976 Bacteria 938
138 Ga0466967_1235919 3300045976 Bacteria 744
139 Ga0495629_0080761 3300046459 Bacteria 2270
140 Ga0495641_0065919 3300046461 Bacteria 1630
141 Ga0495618_0245995 3300046514 Bacteria 1123
142 Ga0495652_0494968 3300046529 Bacteria 848
143 Ga0495587_0612117 3300046536 Bacteria 599
144 Ga0495668_0507272 3300046616 Bacteria 665
145 Ga0495647_0168365 3300046681 Bacteria 948
146 Ga0495674_0671895 3300047319 Bacteria 815
147 Ga0496100_0176976 3300048903 Bacteria 1541
148 Ga0496101_1194425 3300048904 Bacteria 596
149 Ga0496104_0469903 3300048907 Bacteria 1169
150 Ga0496104_0673278 3300048907 Bacteria 943
151 Ga0496107_0228107 3300048910 Bacteria 1386
152 Ga0496108_0761938 3300048911 Bacteria 837
153 Ga0496109_0003501 3300048912 Bacteria 13110
154 Ga0496110_0014890 3300048913 Bacteria 6463
155 Ga0496110_0205450 3300048913 Unclassified 1790
156 Ga0496110_0429722 3300048913 Bacteria 1204
157 Ga0496111_0012458 3300048914 Bacteria 5758
158 Ga0496111_0299949 3300048914 Bacteria 1191
159 Ga0496112_0002942 3300048915 Bacteria 13885
160 Ga0496112_0317670 3300048915 Unclassified 1502
161 Ga0496113_0045823 3300048916 Bacteria 3245
162 Ga0496113_1516673 3300048916 Bacteria 517
163 Ga0496116_0447714 3300048919 Bacteria 554
164 Ga0496122_0558651 3300048925 Bacteria 544
165 Ga0496123_0300732 3300048926 Bacteria 766
166 Ga0496124_0024310 3300048927 Bacteria 5513
167 Ga0496124_0184875 3300048927 Bacteria 1600
168 Ga0496125_0000217 3300048928 Bacteria 117498
169 Ga0496125_0449281 3300048928 Bacteria 739
170 Ga0496126_0016086 3300048929 Bacteria 7498
171 Ga0501034_0064037 3300049571 Bacteria 3690
172 Ga0501046_0995865 3300049580 Bacteria 582
173 Ga0501067_0093674 3300049583 Bacteria 1668
174 Ga0501070_0080574 3300049586 Unclassified 2694
175 Ga0501074_0392303 3300049590 Bacteria 984
176 Ga0501076_0319749 3300049592 Bacteria 1273
177 Ga0501079_0105218 3300049741 Bacteria 2190
178 Ga0501080_0150539 3300049742 Bacteria 2151
179 Ga0501080_0412559 3300049742 Unclassified 1214
180 Ga0501080_0860110 3300049742 Bacteria 792
181 Ga0501081_0169007 3300049743 Bacteria 1578
182 Ga0501045_0046796 3300049824 Bacteria 3150
183 nmdc:mga05p37_1785780_c1 3300050507 Bacteria 594
184 nmdc:mga0rr50_878304_c1 3300050513 Bacteria 764
185 Ga0495595_0203147 3300053084 Bacteria 987
186 Ga0501084_0096322 3300054114 Bacteria 2485
187 Ga0501082_0028754 3300060353 Bacteria 4788
188 Ga0530510_0220043 3300061734 Bacteria 1411
189 2643963237 2643221591 Bacteria 4397626
190 Ga0070714_100008359
191 Ga0070658_10005331
192 Ga0070658_10011862
193 Ga0070658_10152296
194 Ga0070683_100098170
195 Ga0070683_100123529
196 Ga0070680_100031329
197 Ga0070660_100037897
198 Ga0070660_100192626
199 Ga0070661_100432264
200 Ga0070661_100473535
201 Ga0070671_100187244
202 Ga0070667_101191791
203 Ga0070714_100021689
204 Ga0070714_100089368
205 Ga0070714_100184034
206 Ga0070713_100185955
207 Ga0070694_100029508
208 Ga0070663_100798358
209 Ga0070681_10057065
210 Ga0070681_10195915
211 Ga0070679_100039584
212 Ga0070684_100172133
213 Ga0070684_102074915
214 Ga0070696_101563109
215 Ga0068855_100005352
216 Ga0068855_100041672
217 Ga0068855_100090563
218 Ga0068855_100122723
219 Ga0068855_101664341
220 Ga0068857_100046235
221 Ga0070717_10006696
222 Ga0070712_100574263
223 Ga0105240_10249542
224 Ga0105240_10276159
225 Ga0114129_11787443
226 Ga0105248_10356902
227 Ga0105238_11411868
228 Ga0157370_10047242
229 Ga0157370_10427163
230 Ga0157369_10006129
231 Ga0157372_10238607
232 Ga0157376_10831031
233 Ga0197907_11073875
234 Ga0206356_11144853
235 Ga0206356_11351312
236 Ga0206354_10137113
237 Ga0206353_10612199
238 Ga0209676_1031011
239 Ga0207705_10005937
240 Ga0207705_10024292
241 Ga0207707_10019912
242 Ga0207707_10148954
243 Ga0207693_10137945
244 Ga0207660_10081572
245 Ga0207660_10440614
246 Ga0207657_10001972
247 Ga0207657_10125442
248 Ga0207657_10246557
249 Ga0207649_10144258
250 Ga0207652_10008538
251 Ga0207646_10205359
252 Ga0207694_10961188
253 Ga0207700_10082845
254 Ga0207664_10000089
255 Ga0207664_10022035
256 Ga0207664_10648242
257 Ga0207711_10874278
258 Ga0207661_10008803
259 Ga0207661_10175862
260 Ga0207667_10113701
261 Ga0207667_10126049
262 Ga0207667_10289336
263 Ga0207667_10393462
264 Ga0207678_10264851
265 Ga0207702_10085551
266 Ga0207674_10075017
267 Ga0207698_12244016
268 Ga0265334_10093814
269 Ga0265322_10062040
270 Ga0265322_10081705
271 Ga0265338_10058813
272 Ga0265338_10178836
273 Ga0265332_10046707
274 Ga0265329_10014248
275 Ga0265339_10054702
276 Ga0265327_10071294
277 Ga0265316_10044788
278 Ga0265316_10157605
279 Ga0265316_10552584
280 Ga0265313_10005262
281 Ga0265314_10062187
282 Ga0265314_10109686
283 Ga0307406_10081983
284 Ga0395899_0177492
285 Ga0395900_0003795
286 Ga0395900_0079448
287 Ga0395900_0080951
288 Ga0395898_0001107
289 Ga0395898_0041492
290 Ga0395898_1634334
291 Ga0395905_0005221
292 Ga0395905_0535981
293 Ga0395901_0001778
294 Ga0395901_0009580
295 Ga0395901_0566907
296 Ga0395901_0579767
297 Ga0395901_1107041
298 Ga0436363_1336247
299 Ga0439454_003564
300 Ga0450920_068296
301 Ga0466966_0015990
302 Ga0466961_0002757
303 Ga0466961_0138647
304 Ga0466963_0073128
305 Ga0466963_0101345
306 Ga0466963_0141818
307 Ga0466963_0686870
308 Ga0466964_0029898
309 Ga0466964_0095488
310 Ga0466964_0190692
311 Ga0466964_0243335
312 Ga0466964_0678124
313 Ga0466968_0625240
314 Ga0466957_0059861
315 Ga0466957_0187145
316 Ga0466957_0441853
317 Ga0466960_0172523
318 Ga0466959_0017099
319 Ga0466959_0044141
320 Ga0466958_0001260
321 Ga0466967_0003721
322 Ga0466967_0007599
323 Ga0466967_0019791
324 Ga0466967_0084319
325 Ga0466967_0183318
326 Ga0466967_0796197
327 Ga0466967_1235919
328 Ga0495629_0080761
329 Ga0495641_0065919
330 Ga0495618_0245995
331 Ga0495652_0494968
332 Ga0495587_0612117
333 Ga0495668_0507272
334 Ga0495647_0168365
335 Ga0495674_0671895
336 Ga0496100_0176976
337 Ga0496101_1194425
338 Ga0496104_0469903
339 Ga0496104_0673278
340 Ga0496107_0228107
341 Ga0496108_0761938
342 Ga0496109_0003501
343 Ga0496110_0014890
344 Ga0496110_0205450
345 Ga0496110_0429722
346 Ga0496111_0012458
347 Ga0496111_0299949
348 Ga0496112_0002942
349 Ga0496112_0317670
350 Ga0496113_0045823
351 Ga0496113_1516673
352 Ga0496116_0447714
353 Ga0496122_0558651
354 Ga0496123_0300732
355 Ga0496124_0024310
356 Ga0496124_0184875
357 Ga0496125_0000217
358 Ga0496125_0449281
359 Ga0496126_0016086
360 Ga0501034_0064037
361 Ga0501046_0995865
362 Ga0501067_0093674
363 Ga0501070_0080574
364 Ga0501074_0392303
365 Ga0501076_0319749
366 Ga0501079_0105218
367 Ga0501080_0150539
368 Ga0501080_0412559
369 Ga0501080_0860110
370 Ga0501081_0169007
371 Ga0501045_0046796
372 nmdc:mga05p37_1785780_c1
373 nmdc:mga0rr50_878304_c1
374 Ga0495595_0203147
375 Ga0501084_0096322
376 Ga0501082_0028754
377 Ga0530510_0220043
378 2643963237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

2

147

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9352 5 134
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9218 5 134
3kod-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-serine 0.9135 15 138
3lmv-assembly3.cif.gz_E d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9122 15 140
3ko3-assembly2.cif.gz_C d-tyrosyl-trna(tyr) deacylase from plasmodium falciparum incomplex with adp, obtained through soaking native enzyme crystal with the atp 0.9117 15 138
ID Description Score Start End Superfamily
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9352 5 134 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9312 15 134 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9197 15 140 3.50.80.10
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9142 20 137 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9086 10 134 3.50.80.10
ID Description Score Start End GO Terms
AF-R5N008-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9602 12 138 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A535JA58-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9585 15 137 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A078KQG7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9571 12 138 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-C0QEP4-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9559 12 140 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A5C7TYH7-F1-model_v4 deleted 0.9537 12 138

Map